BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G01 (928 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 29 5.2 08_02_0774 - 21047696-21048889 28 9.2 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/55 (27%), Positives = 16/55 (29%) Frame = +1 Query: 685 PCSXVPATXXXXPPPGPXPXXGXXPXXXXPXXXXPPXXXXXXXAXXXXXPPXPXP 849 P A PPP P P G P P PP + P P P Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPP 589 >08_02_0774 - 21047696-21048889 Length = 397 Score = 28.3 bits (60), Expect = 9.2 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = -1 Query: 388 RSASPKASIGSRIVVVLISSPNLLPRASSGGAVL*IA---GKPIGCL 257 R+AS +AS+ RIV S + P AS AVL A G+P+G L Sbjct: 48 RNASLRASVAPRIVPKAKSGSQISPEASYKVAVLGAAGGIGQPLGLL 94 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,350,964 Number of Sequences: 37544 Number of extensions: 303629 Number of successful extensions: 724 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 613 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 691 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2647531240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -