BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_G01 (928 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61080.1 68414.m06877 proline-rich family protein 30 1.9 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 30 2.5 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 29 4.4 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 28 7.6 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/65 (24%), Positives = 20/65 (30%) Frame = +1 Query: 685 PCSXVPATXXXXPPPGPXPXXGXXPXXXXPXXXXPPXXXXXXXAXXXXXPPXPXPXXLXX 864 P + +P PPP P P P PP + PP P P + Sbjct: 463 PPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAA 522 Query: 865 XXXPP 879 PP Sbjct: 523 PPPPP 527 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/68 (26%), Positives = 19/68 (27%), Gaps = 3/68 (4%) Frame = +1 Query: 685 PCSXVPATXXXXPPPGPXPXXGXXPXXXXP---XXXXPPXXXXXXXAXXXXXPPXPXPXX 855 P +P T PPP P P P P PP PP P P Sbjct: 512 PPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQ 571 Query: 856 LXXXXXPP 879 PP Sbjct: 572 NRAPSPPP 579 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/58 (27%), Positives = 18/58 (31%) Frame = +1 Query: 685 PCSXVPATXXXXPPPGPXPXXGXXPXXXXPXXXXPPXXXXXXXAXXXXXPPXPXPXXL 858 P + +PA PPP P P P PP A P P P L Sbjct: 647 PPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPL 704 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/54 (25%), Positives = 16/54 (29%) Frame = +1 Query: 688 CSXVPATXXXXPPPGPXPXXGXXPXXXXPXXXXPPXXXXXXXAXXXXXPPXPXP 849 C+ + PPP P P P P PP PP P P Sbjct: 369 CASFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/65 (24%), Positives = 16/65 (24%) Frame = +1 Query: 685 PCSXVPATXXXXPPPGPXPXXGXXPXXXXPXXXXPPXXXXXXXAXXXXXPPXPXPXXLXX 864 P P PPP P P P P P PP P P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Query: 865 XXXPP 879 PP Sbjct: 437 PPSPP 441 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/67 (23%), Positives = 16/67 (23%) Frame = +1 Query: 724 PPGPXPXXGXXPXXXXPXXXXPPXXXXXXXAXXXXXPPXPXPXXLXXXXXPPXXXXXXXP 903 PP P P P P PP PP P P PP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Query: 904 XXXXXXP 924 P Sbjct: 439 SPPYVYP 445 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 28.3 bits (60), Expect = 7.6 Identities = 14/52 (26%), Positives = 15/52 (28%) Frame = +1 Query: 724 PPGPXPXXGXXPXXXXPXXXXPPXXXXXXXAXXXXXPPXPXPXXLXXXXXPP 879 PP P P P P PP + PP P P PP Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Score = 28.3 bits (60), Expect = 7.6 Identities = 14/50 (28%), Positives = 14/50 (28%) Frame = +1 Query: 700 PATXXXXPPPGPXPXXGXXPXXXXPXXXXPPXXXXXXXAXXXXXPPXPXP 849 P PPP P P P P PP PP P P Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,768,636 Number of Sequences: 28952 Number of extensions: 237796 Number of successful extensions: 704 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 641 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2207676696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -