BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F24 (976 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0686 - 30900748-30902167,30903442-30904742 38 0.016 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 37 0.021 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 37 0.028 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 36 0.049 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 34 0.20 05_01_0142 - 940421-940701,941262-941574 33 0.26 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 33 0.34 03_01_0515 - 3864796-3865425 33 0.34 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 33 0.46 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 33 0.46 07_01_0479 + 3606663-3607448 33 0.46 07_01_0080 + 587674-588510 33 0.46 01_01_0070 - 542603-542686,542803-543441 33 0.46 12_02_1174 - 26696869-26698191 32 0.60 11_06_0610 - 25449085-25453284 32 0.60 08_01_0059 - 394001-394708 32 0.60 02_02_0663 - 12740733-12741104,12741260-12741326,12741709-127418... 32 0.60 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 32 0.80 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 32 0.80 07_01_0516 - 3850252-3852870 32 0.80 06_03_1156 - 28069663-28070393,28070966-28071231,28072023-28072909 32 0.80 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 32 0.80 03_06_0599 + 34984869-34985319,34986581-34987563 32 0.80 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 32 0.80 11_04_0415 - 17395988-17396161,17397349-17397444,17397489-173980... 31 1.1 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 31 1.1 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 31 1.1 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 31 1.1 08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 31 1.1 07_03_0600 + 19866757-19867218,19867920-19868429 31 1.1 07_03_0154 + 14509979-14512033 31 1.1 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 31 1.1 08_02_1019 - 23657175-23658047 31 1.4 06_01_0486 - 3455030-3455770 31 1.4 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 31 1.4 04_03_0904 + 20717005-20718087 31 1.4 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 31 1.4 12_02_0299 - 17051570-17052474,17053542-17053755 31 1.8 07_03_0560 + 19479597-19480667 31 1.8 07_03_0559 + 19475893-19476783 31 1.8 05_01_0380 + 2978256-2979284 31 1.8 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 31 1.8 04_04_1125 + 31085106-31085714 31 1.8 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 31 1.8 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 31 1.8 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 31 1.8 01_06_0146 + 26969011-26969995,26970878-26970930 31 1.8 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 30 2.4 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 30 2.4 09_04_0506 - 18188785-18190599 30 2.4 08_02_1256 + 25645085-25645396 30 2.4 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 30 2.4 05_05_0101 - 22398814-22399164 30 2.4 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 30 2.4 09_03_0145 - 12749288-12751510 30 3.2 09_02_0543 + 10427321-10428315,10428440-10429154 30 3.2 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 30 3.2 03_05_1081 + 30235677-30236474 30 3.2 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 30 3.2 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 30 3.2 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 29 4.2 10_03_0023 - 7151465-7152111,7152222-7152405 29 4.2 09_04_0365 - 16962608-16963174,16963301-16963486,16963824-169638... 29 4.2 09_02_0495 + 9880714-9881196 29 4.2 07_03_1433 + 26513728-26514135,26525534-26526280 29 4.2 07_03_1067 + 23728642-23728690,23728832-23729010 29 4.2 07_03_0177 - 14770777-14772045 29 4.2 05_06_0078 - 25412770-25413852 29 4.2 04_04_0675 + 27183826-27184443 29 4.2 03_06_0471 + 34169562-34169892,34170121-34170347 29 4.2 03_02_0765 + 11000724-11002496 29 4.2 03_02_0738 - 10824121-10825572 29 4.2 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 29 4.2 02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089,527... 29 4.2 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 29 5.6 12_01_0135 + 1042889-1044255,1045368-1045809 29 5.6 12_01_0085 - 689489-689935 29 5.6 11_01_0133 + 1121392-1122731,1123417-1123858 29 5.6 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 29 5.6 10_08_0173 + 15414628-15414890,15415001-15415074,15416322-154164... 29 5.6 07_03_1751 - 29215074-29216270 29 5.6 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 29 5.6 06_03_1310 + 29238644-29240260 29 5.6 05_04_0419 + 21103418-21103597,21103768-21103931,21104420-21104846 29 5.6 03_03_0278 - 16126803-16129049 29 5.6 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 29 5.6 02_02_0240 + 8196140-8198248,8198381-8198650 29 5.6 02_01_0381 - 2764331-2764342,2768966-2769907 29 5.6 01_06_0175 + 27229878-27230056,27231102-27231159,27231230-272312... 29 5.6 01_05_0024 - 17262504-17263308,17264251-17264399,17264879-172649... 29 5.6 01_01_0570 - 4231100-4232560 29 5.6 12_01_0841 - 7873458-7874225 29 7.4 08_02_0796 - 21300251-21300373,21300846-21301721 29 7.4 08_02_0329 - 15833124-15833825 29 7.4 08_01_1010 - 10215625-10216335,10216372-10216473 29 7.4 07_03_0558 + 19461369-19462448 29 7.4 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 29 7.4 06_03_1450 + 30246702-30247346,30248603-30248689,30248789-302489... 29 7.4 05_04_0303 - 20010761-20011756 29 7.4 03_05_0576 + 25765137-25766420 29 7.4 02_04_0413 + 22681957-22682035,22682253-22682788 29 7.4 02_02_0369 - 9505330-9505652,9507262-9507532,9507649-9507690,950... 29 7.4 02_01_0062 - 448105-448145,448780-448866,449664-449790 29 7.4 01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871 29 7.4 01_01_0082 + 625198-625719 29 7.4 04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 24 8.9 09_06_0172 + 21329904-21331512,21331595-21331740,21332333-213325... 28 9.8 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 28 9.8 09_02_0369 - 8012470-8013120 28 9.8 08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180,526... 28 9.8 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 28 9.8 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 28 9.8 05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 28 9.8 04_04_1704 - 35481041-35481461,35481682-35481810,35482291-354823... 28 9.8 04_01_0034 - 401208-402923 28 9.8 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 28 9.8 03_02_0553 - 9420960-9421164,9421634-9421812,9421902-9421970,942... 28 9.8 03_01_0023 + 198414-198968 28 9.8 02_03_0120 + 15463163-15465250 28 9.8 01_05_0224 + 19485296-19485493,19485584-19487817,19487903-194881... 28 9.8 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P PPP PP PPP G PPP P PP Sbjct: 335 APPPPPPKGPPP--PPPAKGPPPPPPPKGPSPPP 366 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P PPP PP PPP G PPP P PP Sbjct: 311 PAPPPPPPPKPA-AAAPPPPPPPKAAPP--PPPPKGPPPPPPAKGPPPPP 357 Score = 35.1 bits (77), Expect = 0.085 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P +P PPP P PPP PPP P PP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPP 358 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Frame = +1 Query: 652 SPRXPPP------XXXPPQIPPPXXGXPPPRXXXXPGXPP 753 SP PPP PP PPP PPP P PP Sbjct: 310 SPAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 29.9 bits (64), Expect = 3.2 Identities = 20/50 (40%), Positives = 21/50 (42%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPR 726 P K P P K P P P G SP PPP PPP PPP+ Sbjct: 340 PPKGPPPPPPAKGPPPPPPP--KGPSPPPPPPPGGKKGGPPP----PPPK 383 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P G P PP PP+ P P PP P PP Sbjct: 329 PPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = +1 Query: 610 KXPNP*KGPGWXGFSPRXP--PPXXXPPQIPPPXXGXPPPRXXXXP-GXPP 753 + P K P G P PP PPQ+PPP PPP P G PP Sbjct: 243 RQPEANKPPAAPGTLPNGSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPP 293 Score = 35.5 bits (78), Expect = 0.065 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 4/55 (7%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPP--PXXXPPQIPPPXXG--XPPPRXXXXPGXPP 753 GP + P P P P PP P PP+IPPP G PPP PP Sbjct: 263 GPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPP 317 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXX--PPQIPPPXXGXPPPRXXXXP 741 P P + P P G PR PPP P PPP PPR P Sbjct: 273 PPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPPP 323 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP G PP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P+ PP PP PPP PPPR P PP Sbjct: 348 APKLMPPPPPPPPPPPPPPPPPPPRPPPPP--PP 379 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP PP Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP PP P P P P PP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPP 375 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP PP P P P P PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP P P PP + P PP Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +1 Query: 568 GXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 G T P P P P P PPP PP PP G PPP Sbjct: 337 GGTQENNATSDAPKLMPPPPPPPPPPPPPPPPPPPRPPPPP-PPIKKGAPPP 387 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P P P Sbjct: 359 PPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 35.9 bits (79), Expect = 0.049 Identities = 30/109 (27%), Positives = 34/109 (31%) Frame = +1 Query: 427 PPPPGXXGFXFGXLFRXPVX*FXAPVXRXGXRXXLPXXGXFGFPTNXGXTPXKXFXPXGP 606 PPPP + + F AP P F F P + P P Sbjct: 30 PPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGP---PQQQQPPPPP 86 Query: 607 XKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P G + PPP PP PPP PPP P PP Sbjct: 87 QMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQP--PP 133 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPPR PP Sbjct: 113 PPSPPPSAPPP--PPPPPTQPPPREAQLAPPPP 143 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/64 (31%), Positives = 23/64 (35%), Gaps = 6/64 (9%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQI---PPPXXGXPP---PRXXXX 738 P F P P P P + PP PP + PPP G PP P+ Sbjct: 14 PQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFG 73 Query: 739 PGXP 750 PG P Sbjct: 74 PGPP 77 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP P P P P P T PP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPPPTQPP 132 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPP--XXGXPPPRXXXXPGXPP 753 ++P PPP P PPP G PPP+ PP Sbjct: 7 YAPHPPPPQGGFPPQPPPMNPYGPPPPQQPAYGHMPP 43 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 652 SPRXPPPXXXPP--QIPPPXXGXPPPRXXXXPGXPP 753 +P PPP P +PPP G PPP P PP Sbjct: 26 NPYGPPPPQQPAYGHMPPP-QGAPPPFLAPPPPPPP 60 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 634 PGWXGFSPRXPP--PXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P GF P+ PP P PP P PPP+ P P Sbjct: 13 PPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAP 54 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 655 PRXPPP-XXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P+ PPP PP PPP G P P P PP Sbjct: 1923 PKQPPPHAPPPPPPPPPVEGKPKPPPHAPPPPPP 1956 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 33.5 bits (73), Expect = 0.26 Identities = 25/73 (34%), Positives = 27/73 (36%), Gaps = 2/73 (2%) Frame = +1 Query: 541 GXFGFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQ--IPPPXXGX 714 G G+P + G P P G P P P G P PPP PPQ P P Sbjct: 25 GGHGYPPHQGYPPQGYPPPPGAYPPP-PGAYPPPPGAYP--PPPGAYPPQHGYPQPGGYP 81 Query: 715 PPPRXXXXPGXPP 753 PP G PP Sbjct: 82 PPGGYPQHGGYPP 94 Score = 31.5 bits (68), Expect = 1.1 Identities = 21/68 (30%), Positives = 23/68 (33%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 G G P + + P G P P P G P P PP PP G P P Sbjct: 22 GVAGGHGYPPHQGYPPQG--YPPPPGAYPPPPGAYPPPPGAYPPPPGAYPPQHGYPQPGG 79 Query: 730 XXXPGXPP 753 PG P Sbjct: 80 YPPPGGYP 87 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 33.1 bits (72), Expect = 0.34 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P TP + G P P PP PP PPP PPP+ Sbjct: 312 PARSRRTPPRTRFSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPP--PPPPPPPPPPKLNT 369 Query: 736 XPGXPP 753 P PP Sbjct: 370 APKPPP 375 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P PPP PP PPP P+ P PP Sbjct: 348 APPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/47 (29%), Positives = 18/47 (38%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIP 696 P+ P P P P P P +P+ PPP PP +P Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVP 384 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P P P Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPP 376 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/63 (23%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = -3 Query: 560 VGKPXXPXXGXXXRSPXRKTGAXNXXTGXRK-RXPKXKPXXPGGGGVXXXXKXPPXPPPX 384 + P P R+P R + ++ P +P P PP PPP Sbjct: 304 IAAPPAPPPARSRRTPPRTRFSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPP 363 Query: 383 PEK 375 P K Sbjct: 364 PPK 366 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P PP P Sbjct: 353 PPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVP 384 >03_01_0515 - 3864796-3865425 Length = 209 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 PPP PP PPP PPP P P Sbjct: 83 PPPPPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 31.9 bits (69), Expect = 0.80 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 PT P P P P GP P PPP PPP PPP Sbjct: 43 PTEASPPPLAP-PPSVTSSPPPPAAGP----LMPPPPPPPSVTSSPPPPPLPPPPPPPAA 97 Query: 736 XPGXPP 753 P PP Sbjct: 98 SPPPPP 103 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP P PPP PPP PP Sbjct: 86 PPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPP 118 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P+ P P PPP PP PPP PP P PP Sbjct: 73 PPPPPSVTSSPPPPPLPPPPPPPAASPP--PPPPSPPPPSPVKSSPPPPP 120 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPP 949 PPPLPP P P P PP Sbjct: 85 PPPLPPPPPPPAASPPPPPPSPP 107 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 652 SPRXPPPXXXPPQI-PPPXXGXPPPRXXXXPGXPP 753 SP PP PP + PPP PP P PP Sbjct: 38 SPPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPP 72 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +2 Query: 869 PXXXPPPL--PPXXPXXPXXPTPXSTHPP 949 P PPP PP P P P+P + PP Sbjct: 89 PPPPPPPAASPPPPPPSPPPPSPVKSSPP 117 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 32.7 bits (71), Expect = 0.46 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQIP--PPXXGXPPPRXXXXPGXPP 753 P P P SP PPP PP +P PP PPP P PP Sbjct: 1164 PPPATPPPPPPLSPSLPPPPPPPP-LPSGPPPQPAPPPLPIQPPPIPP 1210 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P GP P P P P PPP PP P PPP P PP Sbjct: 1143 PEGPP--PLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPP 1193 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P SP PP PP PP PPP P PP Sbjct: 1137 PPPPPLPEGPPPLPSDSPPCQPP--LPPSPPPATPPPPPPLSPSLPPPPP 1184 Score = 29.9 bits (64), Expect = 3.2 Identities = 21/64 (32%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPP--PXXXPPQIPPPXXGXPPPRX 729 P G P P P + P P P P PP P PP PPP PPP+ Sbjct: 1141 PLPEGPPPLPSDSP--PCQPPLPPSPP--PATPPPPPPLSPSLPPPPPPPPLPSGPPPQP 1196 Query: 730 XXXP 741 P Sbjct: 1197 APPP 1200 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXX--PPQIPPPXXGXPPPRXXXXPGXP 750 P P P P P G P+ PP PP IPPP P P P Sbjct: 1174 PLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVPSSPSSLGYQPPAP 1227 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPPLP P P P P PP P Sbjct: 1181 PPPPPPPLPSGPPPQP-APPPLPIQPPPIPPP 1211 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 32.7 bits (71), Expect = 0.46 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 10/50 (20%) Frame = +1 Query: 634 PGWXGFSPRXPPPXXXPP---------QIPPPXXGXPPPRXXXXP-GXPP 753 PG F P PPP PP +PPP G PP + P G PP Sbjct: 377 PGVPRFPPPPPPPDTRPPFMAPGVNARPLPPPPPGLPPAQMQMAPFGVPP 426 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P P K N PG P PPP P +I P PPP Sbjct: 233 PPPPPKPANIAGAPGLPLPPPPPPPPGPPPREIVPGQTLLPPP 275 >07_01_0479 + 3606663-3607448 Length = 261 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 R PPP PPQ+ P G PPP PG PP Sbjct: 210 RGPPPMG-PPQVRPGMPGGPPP--GMRPGMPP 238 Score = 32.3 bits (70), Expect = 0.60 Identities = 22/68 (32%), Positives = 26/68 (38%), Gaps = 1/68 (1%) Frame = +1 Query: 553 FPTNXGXTPXKXFXPXGPXKXPNP*-KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 +P P + P P + P P + PG P PPP P PP G PP Sbjct: 163 YPQVVRPPPGQMPPPMRPPQMPIPFQRPPGVPPAFPGGPPPPPGPFMRGPPPMG-PPQVR 221 Query: 730 XXXPGXPP 753 PG PP Sbjct: 222 PGMPGGPP 229 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 595 PXGPX-KXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXG--XPPPRXXXXPGXPP 753 P GP + P P P P PPP P PPP PPP PG P Sbjct: 204 PPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPGMPPPPPGPQQPGQNP 259 >07_01_0080 + 587674-588510 Length = 278 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 637 GWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 G G R PPP PP P PPP P PP Sbjct: 83 GGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPP 702 G + P P P SP PPP PP PPP Sbjct: 86 GMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 610 KXPNP*KGPGWXGFSPRXPPPXXXPPQIPPP 702 + P P P G P PPP PP PPP Sbjct: 90 RPPPPPPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 Query: 479 GXRKRXPKXKPXXPGGGGVXXXXKXPPXPPPXP 381 G +R P P P G PP PPP P Sbjct: 86 GMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPP 118 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 32.7 bits (71), Expect = 0.46 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P K P P P P PPP PP PPP P P P Sbjct: 84 PPTPKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTPPPVAAPAEAP 136 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PP P P P PTP PP P Sbjct: 67 PAKAPPVAPAVAPVTPPPPTPKKAPPPPVTPP 98 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXPXS 970 P PPP P P P P P T PP P S Sbjct: 79 PVTPPPPTPKKAPPPPVTPPPV-TPPPVTPPPVS 111 >12_02_1174 - 26696869-26698191 Length = 440 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 655 PRXPPPXXX--PPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP +PPP PPP P P Sbjct: 138 PHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKP 172 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P SP PPP P PP P P P PP Sbjct: 173 PVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPP 222 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 R PP PP P P PPP P PP Sbjct: 134 RVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPP 165 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPP-XXGXPPPRXXXXPGXPP 753 P PPP PP PPP PP P PP Sbjct: 150 PSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPP 183 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P+ PP PP PPP PPR PG P Sbjct: 208 PKPQPPPTLPPPSPPPPPPTVPPR---TPGDTP 237 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P P P PP P P P T PP P Sbjct: 167 PPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPP 204 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 655 PRXPPPXXX-PPQIPPPXXGXPPPRXXXXPGXP 750 P+ PPP PPQ P PPP P P Sbjct: 294 PKPPPPSPPPPPQQPSQRYWTPPPAITPEPAKP 326 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 32.3 bits (70), Expect = 0.60 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P P P P K P P P P PP P +PPP PPP Sbjct: 1180 PVKSPPPPAPVILPPPPVKSPPP-PAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPV 1238 Query: 736 XPGXPP 753 PP Sbjct: 1239 ISPPPP 1244 Score = 31.9 bits (69), Expect = 0.80 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +1 Query: 574 TPXKXFXPXGPXKXPNP*KGPGWXGFSP---RXPPPXXXPPQIPPPXXGXPPPRXXXXPG 744 TP + P P K P+P G SP PPP PP PPP Sbjct: 808 TPAEESSPPTPEKSPSPPSGHEGTPPSPVKSSSPPPEAHVSSPPPEKSSSPPPEAHVSSP 867 Query: 745 XPP 753 PP Sbjct: 868 PPP 870 Score = 31.9 bits (69), Expect = 0.80 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P P P P K P P P P PP P +PPP PPP Sbjct: 1148 PEKSPPPPAPVILPPPPIKSPPP-PAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPV 1206 Query: 736 XPGXPP 753 PP Sbjct: 1207 ISPPPP 1212 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +1 Query: 577 PXKXFXPXGPX-KXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P K P P P P K P PPP PP P P PPP P P Sbjct: 1196 PVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP-PAPVISPPPPEKSPPPAAP 1253 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 PT P P P P P P PP P +PPP PPP Sbjct: 1115 PTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPV 1174 Query: 736 XPGXPP 753 PP Sbjct: 1175 ISPPPP 1180 Score = 29.9 bits (64), Expect = 3.2 Identities = 27/112 (24%), Positives = 31/112 (27%), Gaps = 3/112 (2%) Frame = +1 Query: 424 TPPPPGXXGFXFGXLFRXPVX*FXAPVXRXGXRXXLPXXGXFGFPTNXGXTPXKXFXPXG 603 +PPPP G P P P P+ TP P Sbjct: 660 SPPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPPVEKSPPT 719 Query: 604 PXKXPNP*KGPGWXGFSPRXP---PPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P + P G +P P PP P IPP PP P P Sbjct: 720 PESEASSPPPPAPEGHTPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPP 771 Score = 29.5 bits (63), Expect = 4.2 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = +1 Query: 556 PTNXGXTPX-KXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPP-PRX 729 PT+ P + + P P P K P SP PP P PPP PP P Sbjct: 754 PTSHTSPPTPEEYTPSPPKSSPPEEKSP--PPHSPEKSPPSEAHPTSPPPSEKSPPTPAE 811 Query: 730 XXXPGXP 750 P P Sbjct: 812 ESSPPTP 818 Score = 29.1 bits (62), Expect = 5.6 Identities = 20/63 (31%), Positives = 23/63 (36%), Gaps = 7/63 (11%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPP-------QIPPPXXGX 714 PT+ G P + P P + P P P SP P PP PP G Sbjct: 455 PTSHGPPPPEEESPEEPPEEPTPSPTPS----SPESPAKMAPPPAPAIKGVTSPPAEYGA 510 Query: 715 PPP 723 PPP Sbjct: 511 PPP 513 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +1 Query: 583 KXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 K P P P P P PPP P P P PPP+ P PP Sbjct: 1294 KSLPPPAPVSLPPPAVKPLPPPAPVSLPPPAVKPLPPPVPQVSLPPPKQESLP--PP 1348 >08_01_0059 - 394001-394708 Length = 235 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PP PPPR P PP Sbjct: 2 PPPPPPRRAPP---PPATPPPPPRRAPPPPSPP 31 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPP 949 PPP PP P P P P + PP Sbjct: 26 PPPSPPIRPPPPPTPRPYAPPPP 48 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P + P P PPP PP PP PPP PP Sbjct: 5 PPPRRAPPPPATPP--PPPRRAPPPPSPPIRPPPPPTPRPYAPPPP 48 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +1 Query: 655 PRXPPPXXXPPQI---PPPXXGXPPPRXXXXPGXPP 753 P PP PP PPP PPP P PP Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPP 38 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/62 (29%), Positives = 20/62 (32%), Gaps = 3/62 (4%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPP---XXGXPPPRXXXXPGX 747 P + P P P + P R PPP P PPP PPP Sbjct: 6 PPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPV 65 Query: 748 PP 753 PP Sbjct: 66 PP 67 Score = 28.7 bits (61), Expect = 7.4 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P P + P P P P P P P PP I PP PPP Sbjct: 14 PATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPP 69 >02_02_0663 - 12740733-12741104,12741260-12741326,12741709-12741809, 12741852-12742273,12743678-12743685,12745164-12745396 Length = 400 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 634 PGWX--GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 PGW G++ PP P PPP PPP P P Sbjct: 25 PGWAATGYASAAGPPPKRPRWEPPPYLPPPPPYPIPQPARP 65 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 31.9 bits (69), Expect = 0.80 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIP--------PPXXGXPPPRXXXXPGXP 750 P P P P G FSP PPP PP +P PP PPP P Sbjct: 544 PPPPPPPPPPPSG-NKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSP 602 Query: 751 P 753 P Sbjct: 603 P 603 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/68 (27%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQ--IPPPXXGXPPPRX 729 P G P P P P P + P PPP P +P P PPP Sbjct: 552 PPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPI 611 Query: 730 XXXPGXPP 753 PP Sbjct: 612 LPNRSVPP 619 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +1 Query: 655 PRXPPPXXXPP-----QIPPPXXGXPP-PRXXXXPGXPP 753 P PPP PP +PPP PP P P PP Sbjct: 600 PSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPP 638 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 652 SPRXPPPXXXPPQIP-PPXXGXPPPRXXXXPGXP 750 +P PPP PPQ P PP PPP G P Sbjct: 761 APAPPPP---PPQAPKPPGTVPPPPPLHGASGRP 791 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 P PPP PP +PPP P P P Sbjct: 436 PPPPPPPPLPPNMPPPLPPPPEPELNGAP 464 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PPP PPP P PP Sbjct: 425 PPPPPLPPPPPPP----PPPPPPLPPNMPP 450 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 PPPLPP P P P P + P P Sbjct: 427 PPPLPPPPPPPPPPPPPLPPNMPPPLPP 454 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PPP P P P PP Sbjct: 426 PPPPLPPPPPPPPPPPPPLPPNMPPPLPPP 455 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 P PPP PP PPP PP P Sbjct: 428 PPLPPPPPPPPPPPPPLPPNMPPPLPPPP 456 >07_01_0516 - 3850252-3852870 Length = 872 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 S PPP PPQ PP PPP P P Sbjct: 6 SSAAPPPRLLPPQPPPTSRPLPPPPPPPPPAHGP 39 >06_03_1156 - 28069663-28070393,28070966-28071231,28072023-28072909 Length = 627 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 GF P+ PPP P PPP P G PP Sbjct: 14 GFHPQAPPPPPQYPHHPPPYAAPLPQYAPYARGMPP 49 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 645 GFFPKXPPPXXQXSXNPPP 701 GF P+ PPP Q +PPP Sbjct: 14 GFHPQAPPPPPQYPHHPPP 32 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P P P P+P G P PP P+ P P G PPP Sbjct: 325 PAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPP 373 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPP 949 PPP PP P P P P PP Sbjct: 350 PPPPPPAAPAAPRPPGPGPGPPP 372 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 640 WXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 W S + P PPQ PPP P R P PP Sbjct: 387 WVSTSSQSGPAPPPPPQPPPPPPPPPHQRETPSPSPPP 424 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 31.9 bits (69), Expect = 0.80 Identities = 22/73 (30%), Positives = 25/73 (34%), Gaps = 3/73 (4%) Frame = +1 Query: 541 GXFGFPTNXGXTPXKXFXPXGPXKXPN---P*KGPGWXGFSPRXPPPXXXPPQIPPPXXG 711 G + N G T P P K P P + P SP PPP P + PP Sbjct: 94 GRSWYSWNGGRTAKPYRPPPPPRKKPQFQPPPQPPRAWDPSPPPPPPAPAAPVLVPPPAP 153 Query: 712 XPPPRXXXXPGXP 750 P P P P Sbjct: 154 APRPAPAPAPRVP 166 >11_04_0415 - 17395988-17396161,17397349-17397444,17397489-17398026, 17398106-17398422 Length = 374 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 722 GGGXPXXGGGIXGGLXXGGGXLGEK 648 GGG GGG+ G+ GGG LG++ Sbjct: 79 GGGSDDGGGGLGSGVSGGGGGLGKR 103 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP +PPP P P P PP Sbjct: 67 PLTPPPAIVPPALPPP---PPLPAIVVPPALPP 96 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXST 940 P PPP PP P P PTP +T Sbjct: 80 PSPPPPPPPPPPPPPPLSPTPTTT 103 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXP 741 PPP PP PPP PPP P Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPPPLSP 98 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP P PPP PPP PG PP Sbjct: 140 PPPPHVPKAAPPPP---PPPPPHAPPGPPP 166 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PR P PP +P PPP P PP Sbjct: 133 PRGPGQEPPPPHVPKAAPPPPPPPPPHAPPGPP 165 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 654 PKXPPPXXQXSXNPPPXXGXATP 722 P PPP PPP G ATP Sbjct: 151 PPPPPPPPHAPPGPPPTKGVATP 173 >08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 Length = 145 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIP 696 G+P++ G P P GP P+ PG+ G+ + P PP +P Sbjct: 64 GYPSSHGVYPP----PQGPYPPPHQPPPPGYQGYFNQGQQPYYPPPPLP 108 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 667 PPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PP PPQ PP G PPP PP Sbjct: 58 PPHAPPPQQPPAMWGQPPPPPPQYAPPPP 86 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 P+ PP P PPP PPP+ P Sbjct: 64 PQQPPAMWGQPPPPPPQYAPPPPQQFQLP 92 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXXPP--QIPPPXXGXPPPRXXXXPGXP 750 GP P P + P G P PP PP Q P PP P P Sbjct: 57 GPPHAPPPQQPPAMWGQPPPPPPQYAPPPPQQFQLPHQQYAPPPQHYAPPPP 108 >07_03_0154 + 14509979-14512033 Length = 684 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 470 KRXPKXKPXXPGGGGVXXXXKXPPXPPPXP 381 KR PK +P P G + PP PPP P Sbjct: 31 KREPKSEPASPERGPLPLPAAAPPPPPPPP 60 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 G P PPP P +PPP PPPR PP Sbjct: 352 GQPPAPPPPPPFAPTLPPP----PPPRRKPPSPSPP 383 >08_02_1019 - 23657175-23658047 Length = 290 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 722 GGGXPXXGGGIXGGLXXGGGXLG 654 GGG P GGG+ GG GGG G Sbjct: 36 GGGVPKPGGGVGGGGGGGGGGGG 58 >06_01_0486 - 3455030-3455770 Length = 246 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P PTP PP P Sbjct: 101 PPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSP 132 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXPXS 970 P PPP PP P PTP S PP P S Sbjct: 121 PPYVPPPTPPSPPPYVPPPTPPS--PPPYVPPPS 152 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P PP +PPP PPP P PP Sbjct: 127 PTPPSPPPYVPPPTPPSPPP--YVPPPSPP 154 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +1 Query: 589 FXPXGPXKXPNP*KGPGWXGFSP---RXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 + P P P P P + P P P PP IPPP PP P PP Sbjct: 79 YTPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPPTPPYVPP--PTPPSPPP 134 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPP 723 +P PPP PP P P PPP Sbjct: 128 TPPSPPPYVPPPTPPSPPPYVPPP 151 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPP 702 P K P + P+P P SP PPP P PPP Sbjct: 23 PFKPLSSAAPFRRPSPPPPPPSPVPSPAPPPPPHRPSPSPPP 64 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 R P P PP P P PPP P PP Sbjct: 34 RRPSPPPPPPS-PVPSPAPPPPPHRPSPSPPP 64 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 SP PPP P PPP P P P Sbjct: 37 SPPPPPPSPVPSPAPPPPPHRPSPSPPPNP 66 >04_03_0904 + 20717005-20718087 Length = 360 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 G+ TP P K P K P P PP PP PP PP Sbjct: 26 GYGGGYTPTPTPVKPAPKPEKPPKEHKPPHHHEPKPEKPPKEHKPPAYTPPKPTPTPPTY 85 Query: 730 XXXPGXPP 753 P P Sbjct: 86 TPTPKPTP 93 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP PP P P P P PP Sbjct: 127 PPEDPPPHPPHPPDHPPPPPPCRVPPP 153 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PP P P P P HPP P Sbjct: 117 PRPPPPPPPHPPEDPPPHPPHPPDHPPP 144 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXP 741 PPP PP+ PPP PP P Sbjct: 121 PPPPPHPPEDPPPHPPHPPDHPPPPP 146 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PR PPP PP PP PP P PP Sbjct: 117 PRPPPP---PPPHPPEDPPPHPPHPPDHPPPPP 146 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 30.7 bits (66), Expect = 1.8 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P + P F P P P P F P PPP PP PPP P P Sbjct: 286 PPSPPPPPPPAFPFPFPQLPPLP-HFPPLPSFYPSPPPP---PPPPPPPPPSFPWPFPPL 341 Query: 736 XPGXPP 753 P PP Sbjct: 342 APLFPP 347 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = +1 Query: 649 FSPRXPPPXXXP------PQIPPPXXGXPPPRXXXXPGXPP 753 FSP PPP P PQ+PP P P P PP Sbjct: 284 FSPPSPPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPP 324 >07_03_0560 + 19479597-19480667 Length = 356 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 G GG G+G G G GG GGG G Q G Sbjct: 112 GVGGGGGGEGGGLGGGGGGGLGGGGGGGVGGGGGQGGG 149 >07_03_0559 + 19475893-19476783 Length = 296 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 G G G+G G G GGSGGG G Q G Sbjct: 107 GGVGGGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQGGG 144 >05_01_0380 + 2978256-2979284 Length = 342 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXPXSXA 976 PPP PP P P P P S P P + A Sbjct: 27 PPPPPPPPPPPPPPPRPFSRKPSEPAAPSTRA 58 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 R PPP PP PPP P R P P Sbjct: 24 RMPPPPPPPPPPPPPPPPRPFSRKPSEPAAP 54 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 655 PRXPP-PXXXPPQI--PPPXXGXPPPRXXXXPGXPP 753 P PP P PP PPP PPPR P PP Sbjct: 61 PASPPLPSATPPLAASPPPPPPPPPPRNSPSPPKPP 96 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P P P+P K P SP P P P PPP Sbjct: 83 PPPPRNSPSPPKPPSQAAQSPLPPTTTTTTPPTAPVPAAAPPP 125 >04_04_1125 + 31085106-31085714 Length = 202 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P C P P P P P P P P + PP Sbjct: 41 PPPCQPPPPTPTPATPTTPPTPWTPPPATPTPP 73 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 5/63 (7%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKX-PNP*KGPGWXGFSP----RXPPPXXXPPQIPPPXXGX 714 G N G P G K P+ P W P R P P PP PPP Sbjct: 4 GASANPGDPPSPASARSGQRKHVPDWLNSPIWSAPPPPARHRAPSPPRPPPPPPPPTQPA 63 Query: 715 PPP 723 PPP Sbjct: 64 PPP 66 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 G P P +G G G P PP PP +PP G PPP Sbjct: 1181 GVAPPPPPPRGHGGVG-GPPTPPGAPAPP-MPPGVPGGPPP 1219 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXP-----PPXXXPPQIPPPXXGXPPPRXXXXP 741 PNP P W S R P PP PP PPP PPP P Sbjct: 17 PNPFNLPPWLR-SLRCPFTFLCPPPPPPPPPPPPPPPPPPPLEVVSP 62 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PPP+ P P P P P S P P Sbjct: 24 PPPTPHPATDPPPISPQNPTPPPPPLPASAAAPTTPSP 61 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 1/65 (1%) Frame = +1 Query: 562 NXGXTPXKXFXPXGPXKXPNP*KGPGWX-GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXX 738 N P + P P P P R P P PP P P PP Sbjct: 62 NHSGDPSRPIPSQAPAPPPPPTADPSPPLPHDNRTPQPRAAPPPAPAPDQPAPPSPPPSL 121 Query: 739 PGXPP 753 P PP Sbjct: 122 PPSPP 126 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXG--FSPRXPPPXXXPPQIPPP 702 P P+P P G SP PPP PP +PPP Sbjct: 21 PPPSSSSPSPPVPPDPYGADLSPPPPPPPKPPPTVPPP 58 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 SP P P PP PPP PP PG P Sbjct: 919 SPPPPRPPGAPPPPPPPGKPGGPPPPPPPPGSLP 952 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXPXS 970 PPP PP P P P PP P S Sbjct: 921 PPPRPPGAPPPPPPPGKPGGPPPPPPPPGS 950 >09_04_0506 - 18188785-18190599 Length = 604 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 PPP PP P P P S PP P Sbjct: 50 PPPQPPPPPQQQQQPPPISQQPPPLQAP 77 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP Q PPP PPP P PP Sbjct: 51 PPQPPPPPQQQQQPPPISQQPPP--LQAPPPPP 81 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPP 723 P P P PPQ PP PPP Sbjct: 122 PDRPNPVHLPPQPQPPVAAAPPP 144 >08_02_1256 + 25645085-25645396 Length = 103 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 S + PPP PP +P P PPP+ PP Sbjct: 57 SSQQPPPPPPPPPLPSPPP-PPPPQQQEEQSPPP 89 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 637 GWX-GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 GW PR PP P PPP PPP P P Sbjct: 36 GWRLAKCPRFAPPPPQPTLPPPPPRTLPPPPPPPPPQPP 74 >05_05_0101 - 22398814-22399164 Length = 116 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 722 GGGXPXXGGGIXGGLXXGGGXLGE 651 GGG GGG GGL GGG LGE Sbjct: 13 GGGGAGLGGG--GGLGGGGGGLGE 34 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P G P+ P P P PP P P+ PG P Sbjct: 167 PSPPKPKPGPKPKPPKPGPKPKPPKPGPKPKPKPPKPGPKPKPK-PPKPGPKP 218 >09_03_0145 - 12749288-12751510 Length = 740 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPPXXGXPPPRXXXXP-GXPP 753 F P+ P PP PPP PPP P G PP Sbjct: 21 FKPKPTNPSPPPPP-PPPGIQPPPPALPGMPHGRPP 55 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPP---PXXGXPPPRXXXXPGXPP 753 SP P P P PP P G PPP P PP Sbjct: 12 SPAPPRPTPAPQATPPPAIPESGPPPPPAPDMPPPPP 48 >09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415, 2439856-2440214 Length = 398 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +1 Query: 634 PGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P GF+ PPP P +P PPP PG PP Sbjct: 236 PPGQGFNS--PPPPGQGPVLPRDAPPMPPPPSPPNPGAPP 273 >03_05_1081 + 30235677-30236474 Length = 265 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 619 NP*KGPGWXGFSPRXPPPXXXPPQIPPPXX-G---XPPPRXXXXPGXPP 753 +P G G P PPP P PPP G PPP P PP Sbjct: 25 SPSSGAGGYAKIPTYPPPPSAYPAAPPPPVMGQPVPPPPAQLHDPTAPP 73 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +1 Query: 655 PRXPPPXXXPP-----QIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP IPPP PP P PP Sbjct: 966 PPPPPPNVAPPPFTRQDIPPPPPSPPPLPITQPPSVPP 1003 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P+P SPR P P PP +PPP PPP+ P Sbjct: 20 PSPAPSPSSSSAPAPASPRSPVP--PPPGVPPPP--PPPPQTLAAAASP 64 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +1 Query: 655 PRXPP-PXXXPPQIPPPXXGXPPPRXXXXP 741 P PP P PP +PPP PP + P Sbjct: 988 PSPPPLPITQPPSVPPPPNSPPPLQPATDP 1017 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 722 GGGXPXXGGGIXGGLXXGGGXLG 654 GGG GGG+ GG GGG G Sbjct: 57 GGGGGYGGGGVGGGYGGGGGGYG 79 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPP-PXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P PP P PP PPP PP PG P Sbjct: 594 PRVPRPPPAPSATANTASALPPPPPRPPGAPPPPPPPGKPGGPPPPPPRPGSLP 647 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXPXS 970 PPP PP P P P PP P S Sbjct: 616 PPPRPPGAPPPPPPPGKPGGPPPPPPRPGS 645 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P+ PP PP +P P PPP PP Sbjct: 217 TPQPPPSSLIPPVLPLPLLNPPPPPPPPPSLLPP 250 >09_04_0365 - 16962608-16963174,16963301-16963486,16963824-16963896, 16964307-16964497,16964982-16965198,16965394-16965797, 16966593-16966658,16966668-16966721,16966945-16967079, 16967194-16967391,16967734-16967918,16968990-16969527 Length = 937 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTH 943 PPP PP P P P P S H Sbjct: 28 PPPPPPTPPRPPQKPEPVSIH 48 >09_02_0495 + 9880714-9881196 Length = 160 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 390 GGXGGXFXGXXNPPPPRXXGFXFWXPFPXPXXXIPXP 500 GG GG F G PPPP F PF P P Sbjct: 69 GGAGGLFGGTYPPPPPGVMPGAFAPPFGGGFPYGPAP 105 >07_03_1433 + 26513728-26514135,26525534-26526280 Length = 384 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXPXSXA 976 P PPP P P+P +T+PP P + A Sbjct: 45 PPTYPPPSSTPPSPAPVSPSPPTTYPPPSTTPPNPA 80 >07_03_1067 + 23728642-23728690,23728832-23729010 Length = 75 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 Query: 634 PGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PG G+ P PP PP P G PP + P P Sbjct: 19 PGKDGYPPPGYPPAGYPPAQGYPPAGYPPQQGYPPPYAQP 58 >07_03_0177 - 14770777-14772045 Length = 422 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXG 868 G GG GVG G G GG GGG G Sbjct: 388 GGFGKGGGFGFGVGGGGFGGGGGGGGGGGGIG 419 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 722 GGGXPXXGGGIXGGLXXGGGXLG 654 GGG GGG+ GG+ GGG G Sbjct: 197 GGGGLGGGGGLGGGIGKGGGLGG 219 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 722 GGGXPXXGGGIXGGLXXGGGXLG 654 GGG GGG+ GG+ GGG G Sbjct: 229 GGGGLGGGGGLGGGIGKGGGLGG 251 >05_06_0078 - 25412770-25413852 Length = 360 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 948 GGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 GG E G G G G GG GGG G G Sbjct: 250 GGGDEGGTGFTGFDGITGGGGGGDGVGRGATGG 282 >04_04_0675 + 27183826-27184443 Length = 205 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 SP PPP PP PP PPP+ P Sbjct: 106 SPSPPPPASPPPL--PPAPSSPPPKKRRLP 133 >03_06_0471 + 34169562-34169892,34170121-34170347 Length = 185 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/68 (29%), Positives = 24/68 (35%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 G+P + G P P P P G+ G + PP P Q P PP Sbjct: 34 GYPNSPGQYPTPGGYPSAPPGQYPP--AGGYPG--AQYPPSGYPPSQGGYPPGAYPPSGY 89 Query: 730 XXXPGXPP 753 PG PP Sbjct: 90 PQQPGYPP 97 Score = 29.1 bits (62), Expect = 5.6 Identities = 20/68 (29%), Positives = 24/68 (35%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 G+P G P P P + P P G+ P PP P P G PP + Sbjct: 24 GYP---GAYPLMQGYPNSPGQYPTP---GGYPSAPPGQYPPAGGYPGAQYPPSGYPPSQG 77 Query: 730 XXXPGXPP 753 PG P Sbjct: 78 GYPPGAYP 85 >03_02_0765 + 11000724-11002496 Length = 590 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 G GG + G G G G GG+GGG G G Sbjct: 314 GGAGAGGGLGGGAGAGGGGGLGGGAGGGGGLGGGAGGG 351 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 G GG + G G G G GG+GGG G G Sbjct: 354 GGAGAGGGLGGGAGAGGGGGLGGGAGGGGGLGGGAGGG 391 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 G GG + G G G G GG+GGG G G Sbjct: 394 GGAGAGGGLGGGAGTGGGGGLGGGAGGGGGLGGGAGGG 431 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 Query: 948 GGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 GG + G G G G GG+GGG G G Sbjct: 269 GGGLGGGAGAGGGGGLGGGTGGGGGLGGGTGGG 301 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 Query: 948 GGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 GG G+G G G GG+GGG G G Sbjct: 79 GGGKGGGLGGGGGLGGGGGAGGGFGGGLGHGGG 111 >03_02_0738 - 10824121-10825572 Length = 483 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 PPP P PPP PPP P P Sbjct: 78 PPPPSPPSSSPPPLSFPPPPPPPSSPPPP 106 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P P P P PP PP PPP PPP Sbjct: 66 PGSLPPPPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPP 105 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P PP PPP PPP P P Sbjct: 77 PSFAPENALPPSSPPPPSPPPPPPSSPPPVPP 108 >02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089, 5271153-5271263,5271363-5271434,5271533-5271604, 5272126-5272197,5272281-5272346,5272426-5272491, 5272601-5272971,5273203-5273456,5273886-5274157, 5274333-5274474,5275174-5275313,5275381-5275537, 5275797-5275965,5276048-5276088 Length = 772 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPP 723 S PP PP PPP PPP Sbjct: 278 SAHSPPTPHPPPSSPPPPMSPPPP 301 >12_02_0118 - 13869237-13869307,13869375-13869465,13870321-13870440, 13870668-13870795,13871159-13871270,13871719-13871817, 13871918-13871992,13872099-13872320,13873177-13874034 Length = 591 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +1 Query: 652 SPRXPPPXXXP-PQIPPPXXGXPPP 723 +P+ PPP P P PPP PPP Sbjct: 58 APQAPPPGARPFPGSPPPPSQPPPP 82 >12_01_0135 + 1042889-1044255,1045368-1045809 Length = 602 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP P + PP PPP PP Sbjct: 134 PAPPPPPPSHPALLPPDATAPPPPPTSVAALPP 166 >12_01_0085 - 689489-689935 Length = 148 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 667 PPXXXPPQIPPPXXGXPPP 723 PP PP PPP PPP Sbjct: 121 PPASSPPPAPPPHHASPPP 139 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P PPP P +PP PPP PP Sbjct: 133 APPPPPPPSHPALLPPDATAPPPPPTSVAALPPP 166 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 631 GPGWXGFSP---RXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 GPG SP PP PP PPP PPP P P Sbjct: 6 GPGAELLSPGEAEWPPELRLPPP-PPPHPPPPPPLEPAPPSTP 47 >10_08_0173 + 15414628-15414890,15415001-15415074,15416322-15416401, 15417186-15417231,15417334-15417368,15417751-15417771, 15418418-15419133,15419292-15419324,15419517-15419813, 15420213-15420659,15420738-15420886,15421408-15421697, 15421774-15421898,15422006-15422156 Length = 908 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 667 PPXXXPPQIPPPXXGXPP 720 PP PP PPP G PP Sbjct: 42 PPVRLPPSAPPPLVGVPP 59 >07_03_1751 - 29215074-29216270 Length = 398 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 G GG G G G G GG+GGG G G Sbjct: 249 GGAGVGGGAGGGAGAGGGLGAGGGAGGGGGIGGGAGGG 286 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 948 GGWVEXGVGXXGXXGXXGGSGGGXXXG 868 GG GVG G G GG+GGG G Sbjct: 54 GGGKGGGVGVGGGGGFGGGAGGGLGHG 80 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 948 GGWVEXGVGXXGXXGXXGGSGGGXXXG 868 GG + GVG G G GG GGG G Sbjct: 92 GGGLGGGVGVGGGIGHGGGVGGGFGGG 118 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -2 Query: 975 AXEXGXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 A G GG + G G G GGSGGG G G Sbjct: 157 AGAGGGAGGGGGLGGGAGGGAGGGLGGGSGGGGGLGGGAGGG 198 >07_03_1573 + 27829967-27830338,27830821-27831510,27831594-27831781, 27832286-27832318,27832364-27832605,27833178-27833320, 27833649-27833825,27834104-27834256,27834639-27834694, 27834998-27835157,27835301-27835348 Length = 753 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPR 726 P P P + P +P PPP P PPP G P R Sbjct: 24 PKPKPTPIRNP-----TPPPPPPRRRTPPPPPPGSGPGPQR 59 >06_03_1310 + 29238644-29240260 Length = 538 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P P + P P P PR PP PP P P PPP Sbjct: 377 PLAPHRSPLPHHMP------PRRTPPTPPPPSSPTPSHLPPPP 413 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/65 (24%), Positives = 18/65 (27%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P +P P + P P P PP PPP PP Sbjct: 413 PPTYSESPKSSMPPSTSPPSSHGASPPSSSSSPPTEHPGYVLPPLTPPPPTTTPPGHHAP 472 Query: 736 XPGXP 750 PG P Sbjct: 473 VPGTP 477 >05_04_0419 + 21103418-21103597,21103768-21103931,21104420-21104846 Length = 256 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 GF P PP PQ+P P PPP P P Sbjct: 199 GFRPPMPPN----PQVPEPLPNYPPPPYSPAPAPAP 230 >03_03_0278 - 16126803-16129049 Length = 748 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 631 GPGWXGFSPRXPPPXXXPPQIPPPXXGXPP 720 GP R PPP P Q P P PP Sbjct: 176 GPATSSVRQRPPPPPPPPRQAPAPPPAKPP 205 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPG 744 F P PP PP PPP PPP+ PG Sbjct: 419 FQPCGPPYAPPPPPPPPP----PPPQALPLPG 446 >02_02_0240 + 8196140-8198248,8198381-8198650 Length = 792 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP P P P P P S PP Sbjct: 616 PTNIPPPPPGQNPYMPGPPRPYSMPPP 642 >02_01_0381 - 2764331-2764342,2768966-2769907 Length = 317 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/42 (28%), Positives = 15/42 (35%) Frame = -3 Query: 470 KRXPKXKPXXPGGGGVXXXXKXPPXPPPXPEKXKXXNXGGXM 345 +R KP P PP PPP P + GG + Sbjct: 41 RRLRLSKPAPPSSSAAEAASDLPPPPPPPPNQPSAGGGGGGL 82 >01_06_0175 + 27229878-27230056,27231102-27231159,27231230-27231274, 27232711-27232791,27232884-27232922 Length = 133 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +3 Query: 600 RAXKGPKPVKRARLXGFFPKXPPPXXQXSXNPPPXXGXATP 722 R+ PKP+K RL P+ PP Q PPP P Sbjct: 4 RSQTAPKPLKTVRLPPVKPRPKPPPPQ--PQPPPSRKKGQP 42 >01_05_0024 - 17262504-17263308,17264251-17264399,17264879-17264978, 17265829-17265953,17267565-17267743,17269648-17270698 Length = 802 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 637 GWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 G G SP PPP P PP PPP Sbjct: 195 GSVGSSPVTPPPPPRPNPSPPATRTTPPP 223 >01_01_0570 - 4231100-4232560 Length = 486 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 969 EXGXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXG 868 E G GG V G G G GG GGG G Sbjct: 65 EGGGVGVGGGVGGGTGGGAAGGLGGGGGGGGGLG 98 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 719 GGXPXXGGGIXGGLXXGGGXLG 654 GG GGGI GGL GGG G Sbjct: 377 GGGLGGGGGIGGGLGVGGGTGG 398 >12_01_0841 - 7873458-7874225 Length = 255 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 G GG G G G G GGSG G G Q G Sbjct: 61 GGGASGGGYGQGGGGGGGGGQGGGSGSGYGSGYGQGGG 98 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPR 726 +P PP PP PPP PPP+ Sbjct: 93 APPSPPLLALPPPPPPPPPPPPPPQ 117 >08_02_0329 - 15833124-15833825 Length = 233 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 948 GGWVEXGVGXXGXXGXXGGSGGGXXXGXXQ 859 GG E GVG G GG+GGG G Q Sbjct: 95 GGSGEGGVGGVGDRESGGGAGGGGGVGGGQ 124 >08_01_1010 - 10215625-10216335,10216372-10216473 Length = 270 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/60 (26%), Positives = 20/60 (33%) Frame = +1 Query: 574 TPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 TP + P P P + ++P PPP P P PPR P P Sbjct: 94 TPRRAASPDYTPSTPTPPRRAASPDYTPSTPPPRAASPDYTPST--PTPPRRAASPNYTP 151 >07_03_0558 + 19461369-19462448 Length = 359 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 719 GGXPXXGGGIXGGLXXGGGXLG 654 GG GGG GGL GGG LG Sbjct: 53 GGGGGFGGGGGGGLGGGGGGLG 74 >07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089, 4287286-4287350,4288346-4288451,4288529-4288750, 4289619-4289852,4289948-4290037,4290605-4291507 Length = 650 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 PPP PP P P P ++ PP P Sbjct: 57 PPPPPPTPAVEPTLPIPPASTPPTPPQP 84 >06_03_1450 + 30246702-30247346,30248603-30248689,30248789-30248920, 30249016-30249162,30250375-30250440,30250519-30250629, 30251551-30251584,30251667-30251743,30251829-30251906 Length = 458 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 655 PRXPPPXXXPPQ-IPPPXXGXPPPRXXXXPGXPP 753 P PPP PPQ PPP P P P PP Sbjct: 48 PTYPPPPADPPQYAPPPAAPQPQPYYPYEP--PP 79 >05_04_0303 - 20010761-20011756 Length = 331 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXG 868 G GG V G G G G GG GGG G Sbjct: 48 GGGGVGGGVVGGDGVGGGGGGGGGGGGGVGAG 79 >03_05_0576 + 25765137-25766420 Length = 427 Score = 28.7 bits (61), Expect = 7.4 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPP-PXXXPPQIPPPXXGXPPPR 726 GFPT+ K G K P+ P PP P P PPP PPP Sbjct: 33 GFPTSLADLVVKNH---GRLKKPSASASRRKKRGGPEAPPSPSPSPSPSPPPQPSSPPP- 88 Query: 727 XXXXPGXPP 753 P PP Sbjct: 89 --PPPSPPP 95 >02_04_0413 + 22681957-22682035,22682253-22682788 Length = 204 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 860 CXXPXXXPPPLPPXXPXXPXXPTPXSTHPP 949 C PPP PP P PTP HPP Sbjct: 151 CSGGECPPPPSPPCQHECP--PTPPCEHPP 178 >02_02_0369 - 9505330-9505652,9507262-9507532,9507649-9507690, 9508416-9508458,9508853-9508860 Length = 228 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PP LPP P P P S PP Sbjct: 158 PLPRPPTLPPPTSGAPGAPIPNSGAPP 184 Score = 28.3 bits (60), Expect = 9.8 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = +1 Query: 568 GXTPXKXFXPXGPXKXPNP*KG-PGWXGFSPRXPPPXXX--PPQIPPPXXGXPPPRXXXX 738 G P + P P P G PG + PP PPQ P G PPP Sbjct: 150 GSMPMQMAPLPRPPTLPPPTSGAPGAPIPNSGAPPAMYQTNPPQPAGPTSGAPPPVSAPP 209 Query: 739 PGXPP 753 P PP Sbjct: 210 PAAPP 214 >02_01_0062 - 448105-448145,448780-448866,449664-449790 Length = 84 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPP 723 SP PPP PPQ PP G P Sbjct: 17 SPPPPPPPFFPPQWAPPVPGGGGP 40 >01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871 Length = 177 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P C PPP PP P P P PP Sbjct: 121 PIGCHDRGICPPPCPPPCPLPCPPPCPLPCPPP 153 >01_01_0082 + 625198-625719 Length = 173 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PPP PPP PP Sbjct: 68 PPPVYYPPPSPPP-VAYPPPTTPSTNCPPP 96 >04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 Length = 268 Score = 23.8 bits (49), Expect(2) = 8.9 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPP 702 P P P G W P P P PP+ P P Sbjct: 168 PYPVPYPYAGQ-WCCPKPEPPKPPPEPPKEPEP 199 Score = 23.0 bits (47), Expect(2) = 8.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 682 PPQIPPPXXGXPPP 723 PPQ+ PP PPP Sbjct: 240 PPQVWPPPPVCPPP 253 >09_06_0172 + 21329904-21331512,21331595-21331740,21332333-21332556, 21333689-21334448 Length = 912 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 682 PPQIPPPXXGXPPPRXXXXPGXPP 753 PP PPP G PPP PP Sbjct: 157 PPVAPPPQMGPPPPYGSGYAPPPP 180 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXPPP 723 R PPP P PPP PPP Sbjct: 255 RAPPPQSVRPPPPPPPPPPPPP 276 >09_02_0369 - 8012470-8013120 Length = 216 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPP 702 P P P K P F PPP PP PPP Sbjct: 40 PPPPPHDDPPLKPPPQQQFITAQPPPPDEPPLKPPP 75 >08_01_0600 - 5262573-5262773,5262850-5262952,5263050-5263180, 5263263-5263312,5265266-5265725,5266349-5266708 Length = 434 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 640 WXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 W P P P P P G PPP G PP Sbjct: 44 WGQAPPPPPQMWGQAPPPPQPAYGQPPPAQAGYYGAPP 81 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 637 GWXGFSPRXPPPXXXPPQIPPP---XXGXPPPRXXXXPGXPP 753 G+ G + + P P PP +PPP PP P PP Sbjct: 1146 GYAGHANQMPLPPPPPPPLPPPPPVAPFHPPGPHFSGPSVPP 1187 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P+ P P +PPP PP P PP Sbjct: 571 APQAPMPPLKASPVPPPEPSPPPAPKAAPPPPPP 604 >05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 Length = 574 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P PPP PP + P PPP P P Sbjct: 390 APYGPPPQSYPPNVRLPSPYVPPPSGPAPPFYGP 423 >04_04_1704 - 35481041-35481461,35481682-35481810,35482291-35482397, 35482515-35482583,35482825-35482936,35483013-35483131, 35483211-35483291,35483629-35483700,35484039-35484239, 35484442-35484528,35485284-35485523,35485991-35486455, 35487434-35487556,35487643-35487769,35487851-35487919, 35488061-35488189,35488628-35488722,35488808-35488876, 35489332-35489443,35489545-35489663,35489753-35489833, 35490898-35490969,35491052-35491267,35491524-35491601, 35491694-35491831,35492403-35492414,35492639-35492872, 35493076-35493130,35493222-35493352,35493813-35494546, 35494613-35494820 Length = 1634 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPP 702 GP + PNP P +P+ PPP PPQ P P Sbjct: 47 GPSQNPNPNPNP-----NPKPPPPP--PPQEPEP 73 >04_01_0034 - 401208-402923 Length = 571 Score = 28.3 bits (60), Expect = 9.8 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPG 744 P P P P P P PPP PP PPP PP + G Sbjct: 300 PLQPRPAPPP-PPPQQQRAKPSRPPPPP-PPLDPPPRAAAPPAKCKRPDG 347 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXGN 847 G GG G G G G GGSGGG G G+ Sbjct: 43 GGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGS 81 >03_02_0553 - 9420960-9421164,9421634-9421812,9421902-9421970, 9422452-9422607,9422756-9422968 Length = 273 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 740 GXXKXRGGGXPXXGGGIXGGLXXGGGXLGEK 648 G + RGGG GGG GG GG G++ Sbjct: 218 GRPRPRGGGRRRGGGGGSGGPGGSGGRRGKE 248 >03_01_0023 + 198414-198968 Length = 184 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXGXXQXXG 850 G GG G G G G GGSGGG G G Sbjct: 44 GGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGG 81 >02_03_0120 + 15463163-15465250 Length = 695 Score = 28.3 bits (60), Expect = 9.8 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +1 Query: 547 FGFP-TNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIP 696 FGFP ++ P K P P P P P SP PPP PP P Sbjct: 275 FGFPNSSYAPPPTKYIGPMPPNNQPLP---PP-PSPSPSPPPPSPPPPPHP 321 >01_05_0224 + 19485296-19485493,19485584-19487817,19487903-19488154, 19488235-19488345,19488435-19488516,19488791-19488982 Length = 1022 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P+P K P SPR PP PP PP PPP P P Sbjct: 571 PSPPKPP-----SPRHPPSP--PPLRSPPRQPTPPPSPSQQPPLP 608 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,215,281 Number of Sequences: 37544 Number of extensions: 429941 Number of successful extensions: 9747 Number of sequences better than 10.0: 120 Number of HSP's better than 10.0 without gapping: 2056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7437 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2834967080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -