BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F24 (976 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 42 0.001 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 38 0.016 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.050 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 35 0.11 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 35 0.11 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 34 0.15 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 34 0.20 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.27 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 33 0.35 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.35 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 33 0.35 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 33 0.46 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 33 0.46 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 33 0.46 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 33 0.46 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.46 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 33 0.46 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 32 0.61 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 32 0.81 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 32 0.81 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 32 0.81 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 31 1.1 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 31 1.1 SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) 31 1.1 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 31 1.4 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 31 1.9 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 30 2.5 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 30 2.5 SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 30 2.5 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 30 2.5 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 29 4.3 SB_31443| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 29 5.7 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 29 5.7 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 29 5.7 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 29 5.7 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 5.7 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 7.5 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 7.5 SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) 29 7.5 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 23 10.0 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 10.0 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 10.0 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 28 10.0 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = +1 Query: 562 NXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 N P P P P P P P+ PPP PP PPP PPP P Sbjct: 362 NMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Query: 742 GXPP 753 PP Sbjct: 422 PPPP 425 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P P PPP PP PPP PPP P PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P+P P P PPP PP PPP PPP P PP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P S PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P + P P P P PPP P PPP PPP PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 G + PPP PP PPP PPP P PP Sbjct: 360 GINMSPPPPPPPPP--PPPSPPPPPPPPPPSPPPPP 393 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PPP PP P P P P PP P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P + PP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P PP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P PP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXPXSXA 976 P PPP PP P P P P PP P A Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P PP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P PP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P PP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P PP P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P PP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P P P P P P P PPP P PPP PPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 PPP PP P P P P PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPP 392 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P PP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P + PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPP 396 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PPP P P P P P PP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P P PP P P P P PP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXPXSXA 976 P PPP PP P P P P PP P A Sbjct: 385 PPPSPPP-PPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PP PP P P P P PP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P P PP P P P P PP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/77 (33%), Positives = 29/77 (37%), Gaps = 3/77 (3%) Frame = +1 Query: 532 PXXGXFGFPTNXGXTPXKXFXPXGPXKX-PNP*KGPGWXGFSPRXPPPXXXPPQIPPPXX 708 P G +G P P P G + P P GP SP P P PP +PPP Sbjct: 2125 PPMGQYGAPARPAMGPP----PMGSSRYGPPPPMGPA--RHSPSGPSPLGAPPSVPPPMG 2178 Query: 709 GXP--PPRXXXXPGXPP 753 P PP P PP Sbjct: 2179 APPSGPPPMGAPPSGPP 2195 Score = 37.1 bits (82), Expect = 0.022 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP---PPRXXXXPGXPP 753 P GP P P G P PPP PP PPP P PP G PP Sbjct: 2161 PSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXG-XPPPR 726 P P GP P GP G P PP PP PPP P PR Sbjct: 2175 PPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSPAPR 2225 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +2 Query: 851 PXXCXXPXXXPPPL--PPXXPXXPXXPTPXSTHPPXXXXP 964 P P PPP+ PP P P TP S HPP P Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGP--PPMGTPPSGHPPMGAPP 2211 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/61 (37%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRX--PPPXXXPPQIPPPXXGXPPP 723 G P + G P P P + P P + G+ G+ R PPP PP PP G PPP Sbjct: 94 GGPPSRGP-PRGPPLPGPPRRGPPPDRDSGYGGYGDRYDRPPPDRRPP--PPDRSGYPPP 150 Query: 724 R 726 R Sbjct: 151 R 151 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P NP P +P PPP PP PPP G PPP PP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 PTN TP P P P GP P PPP PP PPP G PPP Sbjct: 360 PTNN--TPPPPPPTNKPPPPPPPTNGP------PPPPPPTNGPPPPPPPTNGPPPP 407 Score = 36.3 bits (80), Expect = 0.038 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP G PPP PP Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 637 GWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 G G +P PPP PP PPP PPP PP Sbjct: 340 GGGGVNP-PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPP 377 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P + P P + P P G +P PPP + PPP G PPP Sbjct: 300 PSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPP 348 Score = 37.1 bits (82), Expect = 0.022 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP G PP P PP Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 35.5 bits (78), Expect = 0.066 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 2/68 (2%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXX--PPQIPPPXXGXPPPRX 729 P G P + P P +G PPP PP PPP G PPP Sbjct: 319 PARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP 378 Query: 730 XXXPGXPP 753 G PP Sbjct: 379 PPIEGRPP 386 Score = 31.9 bits (69), Expect = 0.81 Identities = 29/101 (28%), Positives = 30/101 (29%), Gaps = 2/101 (1%) Frame = +1 Query: 427 PPPPGXXGFXFGXLFRXPVX*FXAPVXRXGXRXXLPXXGXFGFPTNXGXTPXKXFXPXGP 606 PPPP R P R R P G P + G P P Sbjct: 306 PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP-PPSMGMAPPPVGGAAPP 364 Query: 607 XKXPNP*KGPGWXG--FSPRXPPPXXXPPQIPPPXXGXPPP 723 P P GP R P PP PPP G PPP Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 G P PP P PPP G PPP PP Sbjct: 284 GIQPPPPPSRGAAP--PPPSRGAPPPPPSRGSAPPP 317 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 37.1 bits (82), Expect = 0.022 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +1 Query: 568 GXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGX 747 G P P G P P PG S PP PP PPP PPP P Sbjct: 917 GSVPPPPPPPGGNAPLPPP--PPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLP 974 Query: 748 PP 753 PP Sbjct: 975 PP 976 Score = 36.7 bits (81), Expect = 0.028 Identities = 24/66 (36%), Positives = 26/66 (39%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P G P + P G P P PG G +P PP PP PPP PPP Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPP--PPG--GSAP--PPGGGAPPLPPPPGGSAPPPPPPP 988 Query: 736 XPGXPP 753 P PP Sbjct: 989 PPPPPP 994 Score = 33.1 bits (72), Expect = 0.35 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 5/69 (7%) Frame = +1 Query: 562 NXGXTPXKXFXPXG-PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXG----XPPPR 726 N G P + P P +P P P PPP P PPP G PPP Sbjct: 889 NDGSFPRRNESPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPP 948 Query: 727 XXXXPGXPP 753 P PP Sbjct: 949 GGNAPPPPP 957 Score = 29.1 bits (62), Expect = 5.7 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = -1 Query: 571 PPXLWENRXPPXRXXKXXPPTXKPGXGIXXXGNGKGXQKXNPXXRGGGGXXXPXKXPPXP 392 PP PP PP PG G G P GG P PP P Sbjct: 936 PPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGG---APPLPPPPGGSAPPPPPPPPPPP 992 Query: 391 PXXLK 377 P K Sbjct: 993 PPMRK 997 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 36.3 bits (80), Expect = 0.038 Identities = 19/60 (31%), Positives = 23/60 (38%) Frame = +1 Query: 574 TPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P P P + P+P P PR PPP +PPP P P P PP Sbjct: 1048 SPPPSAVPIPPPRKPSP--PPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP 1105 Score = 32.7 bits (71), Expect = 0.46 Identities = 21/70 (30%), Positives = 23/70 (32%), Gaps = 5/70 (7%) Frame = +1 Query: 559 TNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQ-----IPPPXXGXPPP 723 T P P GP + P P K + PPP P IPPP PPP Sbjct: 1007 TQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPP 1066 Query: 724 RXXXXPGXPP 753 P P Sbjct: 1067 SEPAPPPRQP 1076 Score = 29.9 bits (64), Expect = 3.3 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPP-XXXPPQIPPPXXGXPPPRXX 732 PT P + P P P K P PP PP P P PPP Sbjct: 1022 PTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPST 1081 Query: 733 XXPGXPP 753 P PP Sbjct: 1082 SQPVPPP 1088 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 G PPP PP PPP PPP P PP Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 35.1 bits (77), Expect = 0.087 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 G +P PPP PP PPP PPP P P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 31.9 bits (69), Expect = 0.81 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXPXSXA 976 P PPP PP P P P P PP P A Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPLHLA 500 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP PP P P P P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +1 Query: 628 KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 +G G P PPP PP PPP PPP P P Sbjct: 458 EGVGQAPPPPPPPPPPPPPP--PPPPPPPPPPFPPPPPPTP 496 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 PPP PP P P P P PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIP-PPXXGXPPPR 726 GP + P GP F PR PPP PP+ P P G PP R Sbjct: 404 GPPRPMGP-PGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPPMR 445 Score = 32.3 bits (70), Expect = 0.61 Identities = 25/71 (35%), Positives = 28/71 (39%), Gaps = 3/71 (4%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPP---QIPPPXXGXPP 720 GFP G P + + P GP GPG P PP PP + PPP G P Sbjct: 380 GFPPR-GMPPKEDWGP-GPRGM-----GPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPR 432 Query: 721 PRXXXXPGXPP 753 PG PP Sbjct: 433 GPMGPGPGMPP 443 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 35.1 bits (77), Expect = 0.087 Identities = 22/61 (36%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXP 750 P F P G P+P + P PR PPP P++PPP P PP P P Sbjct: 437 PHPRFPPPGA---PHP-RVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 492 Query: 751 P 753 P Sbjct: 493 P 493 Score = 35.1 bits (77), Expect = 0.087 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 P P+P + P PR PPP P++PPP P PP P PP Sbjct: 523 PPGAPHP-RVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPP 573 Score = 35.1 bits (77), Expect = 0.087 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 P P+P + P PR PPP P++PPP P PP P PP Sbjct: 543 PPGAPHP-RVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPP 593 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 P P+P + P PR PPP P++PPP P PP P PP Sbjct: 423 PPGAPHP-RVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 473 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 PR PPP P++PPP P PP P PP Sbjct: 509 PRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 543 Score = 32.7 bits (71), Expect = 0.46 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P+P + P PR PPP P++PPP G P P+ PG P Sbjct: 563 PPGAPHP-RVPPPGAPHPRVPPPGTPHPRVPPP--GAPHPK-VPPPGAP 607 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/54 (37%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP----PPRXXXXPGXPP 753 P P+P + P PR PPP P++PPP G P PP P PP Sbjct: 463 PPGAPHP-RVPPPGAPHPRVPPPGAPHPRVPPP--GAPHQRVPPPGAPHPRVPP 513 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 R PPP P++PPP P PP P PP Sbjct: 500 RVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 533 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 664 PPPXXXPP-QIPPPXXGXPPPRXXXXPGXPP 753 P P PP +IPPP G PPPR P P Sbjct: 306 PHPRMRPPTRIPPPGMG-PPPRIPPPPIRAP 335 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPP 702 P P + + P +P + P PR PPP P++PPP Sbjct: 367 PYTRALPPGEPYARMPPPGATHP-RVPSPGASHPRVPPPGAPHPRVPPP 414 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 R PPP P++P P P PP P PP Sbjct: 380 RMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPP 413 Score = 28.3 bits (60), Expect = 10.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPR 726 PR P P P++PPP G P PR Sbjct: 389 PRVPSPGASHPRVPPP--GAPHPR 410 Score = 28.3 bits (60), Expect = 10.0 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 P P+P + P R PP P++PPP P PP P PP Sbjct: 403 PPGAPHP-RVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPP 453 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 34.7 bits (76), Expect = 0.11 Identities = 27/86 (31%), Positives = 30/86 (34%), Gaps = 2/86 (2%) Frame = +1 Query: 499 PVXRXGXRXXLPXXGXFGFPTNXGXTPXKXFX--PXGPXKXPNP*KGPGWXGFSPRXPPP 672 P G L G G P N G + P GP + PN GP P PP Sbjct: 220 PKGPPGTNGPLGPPGDVGPPGNPGGPGYQGNHGNPAGP-QGPNGLPGPNGI-LGPPGPPG 277 Query: 673 XXXPPQIPPPXXGXPPPRXXXXPGXP 750 PP +P P PP PG P Sbjct: 278 DMGPPGLPGPPGPQMPPGPPGLPGAP 303 Score = 33.5 bits (73), Expect = 0.27 Identities = 26/85 (30%), Positives = 27/85 (31%), Gaps = 1/85 (1%) Frame = +1 Query: 499 PVXRXGXRXXLPXXGXFGFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXG-FSPRXPPPX 675 P G L G G P N G P P P PG G P PP Sbjct: 135 PAGPPGTNGELGPPGDVGPPGNPGG-PGLQGNHGNPAGIQGPNGLPGPNGPLGPPGPPGD 193 Query: 676 XXPPQIPPPXXGXPPPRXXXXPGXP 750 PP +P P PP PG P Sbjct: 194 MGPPGLPGPQGPQMPPGPPGLPGAP 218 Score = 32.7 bits (71), Expect = 0.46 Identities = 35/108 (32%), Positives = 36/108 (33%), Gaps = 2/108 (1%) Frame = +1 Query: 427 PPPPGXXGFXFGXLFRXPVX*FXAPVXRXGXRXXLPXXGXFGFPTNXGXTPXKXFXPXGP 606 PPPPG G F P P G G GF G P P G Sbjct: 39 PPPPGPPGPDGPPGFPGP----QGPNGPKGPPGLPGPPGPPGFQGPPG-NPAGAIGPPG- 92 Query: 607 XKXPNP*KGP-GWXGFSPRXPPPXXXPPQIPPPXXGXP-PPRXXXXPG 744 PN GP G G PP PQ+PP G P PP PG Sbjct: 93 LPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPPG 140 Score = 31.9 bits (69), Expect = 0.81 Identities = 18/52 (34%), Positives = 20/52 (38%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P GP P P PG+ G P P PP +P P PP G P Sbjct: 62 PKGPPGLPGPPGPPGFQG-PPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPP 112 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P GP P P PG G P P PP +P P PP PG P Sbjct: 342 PQGPNGQPGP---PGING--PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 388 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P GP P P PG G P P PP +P P PP PG P Sbjct: 427 PQGPNGQPGP---PGING--PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 473 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P GP P P PG G P P PP +P P PP PG P Sbjct: 512 PQGPNGQPGP---PGING--PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 558 Score = 29.5 bits (63), Expect = 4.3 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXP-PPXXXPPQIPPPXXGXP-PPRXXXXPGXP 750 P P + P P GP P P P P+ PP G P PP PG P Sbjct: 31 PPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNP 84 Score = 29.1 bits (62), Expect = 5.7 Identities = 25/87 (28%), Positives = 27/87 (31%), Gaps = 3/87 (3%) Frame = +1 Query: 499 PVXRXGXRXXLPXXGXFGFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFS--PRXP-P 669 P+ G G G+ N G P P G P PG G P P P Sbjct: 654 PLGPPGESGPAGNAGGVGYQGNHG-NPAGVQGPNGQPGPPGINGPPGQIGEMGPPGLPGP 712 Query: 670 PXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P PP G P P P P Sbjct: 713 PGPASPPSPPGPPGPPGPNGPPGPNGP 739 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 G P P G P PPP PP PPP PPP P PP Sbjct: 287 GGAPVPPPPPADGSAPAPPPPPPPGGAPP--PPPPPPPPPPGDGGAPPPPP 335 Score = 28.7 bits (61), Expect = 7.5 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P P P P G +P PPP PP PP G PPP Sbjct: 295 PPADGSAPAPPPPPP-PGGAPPPPPP---PPPPPPGDGGAPPP 333 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 34.3 bits (75), Expect = 0.15 Identities = 22/68 (32%), Positives = 24/68 (35%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 G G P P G P P GP +P PP P IPPP G P+ Sbjct: 378 GAGNGPGGPPPPWSKPGGILPGPPP-PGPPMLNMAPSIPPWQTTPGYIPPPPPGF--PQF 434 Query: 730 XXXPGXPP 753 P PP Sbjct: 435 QPPPPPPP 442 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 34.3 bits (75), Expect = 0.15 Identities = 22/61 (36%), Positives = 24/61 (39%) Frame = +1 Query: 541 GXFGFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPP 720 G G P G K P GP P P PG+ G +P PP P P P G P Sbjct: 1677 GPMGLPGPQGPDGPKG--PPGPPGLPGPQGIPGYPG-APAGPPGRDGPMGPPGPSGGQGP 1733 Query: 721 P 723 P Sbjct: 1734 P 1734 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGF--SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 GP P P GW G +P PP PP P P P PG P Sbjct: 1798 GPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P +PP P Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAP 123 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P PPP PP PPP PP P PP Sbjct: 153 NPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPP 186 Score = 33.1 bits (72), Expect = 0.35 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIP-PPXXGXPPPRXX 732 PTN P P P P P P + P P PP P PP P P Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSP 144 Query: 733 XXPGXPP 753 P PP Sbjct: 145 NAPYPPP 151 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P P P + P PP PP PPP PPP P P Sbjct: 159 PLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P +P PPP P PPP PPP P PP Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPP-PNAPNPPPPNPPYPPPPNAPNPPYPP 224 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPP---XXXPPQIPPPXXGXPPPRXXXXPGXP 750 PNP P P PPP PP PPP PPP P P Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 31.5 bits (68), Expect = 1.1 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 3/69 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPX--KXPNP*KGPGWXGFSPRXP-PPXXXPPQIPPPXXGXPPPR 726 P N P P P PNP P +P P PP PP P P PPP Sbjct: 169 PPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY-PPPPN 227 Query: 727 XXXXPGXPP 753 P PP Sbjct: 228 APNPPYPPP 236 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +1 Query: 568 GXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQI---PPPXXGXPPPRXXXX 738 G P F P P P P + P PP PP PPP PPP Sbjct: 81 GGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPY 140 Query: 739 PGXP 750 P P Sbjct: 141 PPSP 144 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P + +PP P Sbjct: 101 PYPPPPPYPPP-PNPPYPPPPNAPYPPPPNPP 131 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 7/66 (10%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXP-------PQIPPPXXGXPPPRXXX 735 P + P P P P +P PPP P P PPP PPP Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPP 163 Query: 736 XPGXPP 753 P PP Sbjct: 164 PPNPPP 169 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P PP PPP PP P PP Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP 181 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PP PP P P P P + +PP P Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP 181 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P P PP P P P P + +PP P Sbjct: 206 PPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PP PP P P P+P + +PP P Sbjct: 119 PPNAPYPPPPNPPYPPP-PNAPYPPSPNAPYPPPPNPP 155 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP P P P P P +PP P Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 881 PPPL--PPXXPXXPXXPTPXSTHPPXXXXP 964 PPPL PP P P P P +PP P Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPPPPNPP 186 Score = 28.3 bits (60), Expect = 10.0 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 PPP P P P P P +PP P Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP P PP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPP---PPPSTPP 715 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PPP PP P P P P + PP P Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 667 PPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PP PP PPP PPP+ P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P PPP P PPP PP + PG P Sbjct: 694 PPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 28.3 bits (60), Expect = 10.0 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP PP P P P + PP Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPP 715 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P PG G P P P +PPP PPP P PP Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPP-PPPPGCAGLPPPPP 758 Score = 29.1 bits (62), Expect = 5.7 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQ---IPPPXXGXPPPRXXXXPGXPP 753 P P P G P PPP PP +PPP P P P PP Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPS-PQPGCAGLPPPPP 744 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 33.5 bits (73), Expect = 0.27 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPR 726 G P P PG+ G +P PPP P PPP PPR Sbjct: 193 GMPPPPPPPPPPGFPGGAPPPPPPPFGAP--PPPALNGGPPR 232 Score = 28.3 bits (60), Expect = 10.0 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 655 PRXPP--PXXXPPQIPPPXXGXPPPRXXXXP 741 P PP P PP PPP PPP P Sbjct: 200 PPPPPGFPGGAPPPPPPPFGAPPPPALNGGP 230 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P + P P P +P PPP P P P G PP P P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 33.5 bits (73), Expect = 0.27 Identities = 21/62 (33%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXG-XPPPRXXXXP--GX 747 P + P P +G G P PPP +PPP G PPPR P G Sbjct: 430 PPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGP 489 Query: 748 PP 753 PP Sbjct: 490 PP 491 Score = 31.5 bits (68), Expect = 1.1 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +1 Query: 595 PXGPXKXPNP*KG--PGWXGFSPRXPPPXXXPPQI---PPPXXGXPPPRXXXXPGXPP 753 P G P P G P GF P PP PP PPP G PPP P P Sbjct: 462 PGGMRGMPPPPMGMYPPPRGFPP---PPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGP 516 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXX---GXPPPRXXXXPGXPP 753 +P PPP PP PPP PPP P PP Sbjct: 71 APAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 +P PPP P PPP P PP P PP Sbjct: 61 APAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 28.3 bits (60), Expect = 10.0 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 634 PGWXGFSPRXPP--PXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 P + SP PP P P PPP P PP P PP Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPP 86 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 33.1 bits (72), Expect = 0.35 Identities = 21/64 (32%), Positives = 25/64 (39%), Gaps = 8/64 (12%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKX-----PNP*KGPGWXGFS---PRXPPPXXXPPQIPPPXXG 711 PT+ G P P P + P P +GP F+ P PP P PPP Sbjct: 257 PTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNA 316 Query: 712 XPPP 723 PPP Sbjct: 317 TPPP 320 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSP----RXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P G + P P +GP G P PPP PPP PP G P Sbjct: 244 PPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPP 299 Score = 29.1 bits (62), Expect = 5.7 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQI---PPPXXGXPPPRXXXXPGXPP 753 P P P S PPP P + PPP G PP P PP Sbjct: 343 PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 391 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPP----QIPPPXXGXPPPRXXXXPGXPP 753 P P + P P G PPP PP PPP G P P PP Sbjct: 320 PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 376 Score = 28.3 bits (60), Expect = 10.0 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP 717 P + T + P P + P P GP R P PP PPP P Sbjct: 345 PISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +1 Query: 637 GWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 G G P PP P +PPP G PPP PG PP Sbjct: 231 GMLGHPPMGAPPP--PHSMPPP--GMPPPGMMPPPGFPP 265 Score = 32.3 bits (70), Expect = 0.61 Identities = 23/72 (31%), Positives = 25/72 (34%), Gaps = 7/72 (9%) Frame = +1 Query: 529 LPXXGXFGFPTNXGXTPXKXFXPXG---PXKXPNP*---KG-PGWXGFSPRXPPPXXXPP 687 +P G G P P P G P P P G PG G P PP P Sbjct: 227 IPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPG 286 Query: 688 QIPPPXXGXPPP 723 +PP PPP Sbjct: 287 GMPPNMEQPPPP 298 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 33.1 bits (72), Expect = 0.35 Identities = 21/64 (32%), Positives = 25/64 (39%), Gaps = 8/64 (12%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKX-----PNP*KGPGWXGFS---PRXPPPXXXPPQIPPPXXG 711 PT+ G P P P + P P +GP F+ P PP P PPP Sbjct: 169 PTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNA 228 Query: 712 XPPP 723 PPP Sbjct: 229 TPPP 232 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSP----RXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P G + P P +GP G P PPP PPP PP G P Sbjct: 156 PPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPP 211 Score = 29.1 bits (62), Expect = 5.7 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQI---PPPXXGXPPPRXXXXPGXPP 753 P P P S PPP P + PPP G PP P PP Sbjct: 255 PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 303 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPP----QIPPPXXGXPPPRXXXXPGXPP 753 P P + P P G PPP PP PPP G P P PP Sbjct: 232 PPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 288 Score = 28.3 bits (60), Expect = 10.0 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP 717 P + T + P P + P P GP R P PP PPP P Sbjct: 257 PISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 PPP PP PPP PPP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 32.7 bits (71), Expect = 0.46 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 GP P P G G G +P PPP PPP PPP P PP Sbjct: 659 GPPPPPPPPPG-GQAGGAPPPPPPPLPGGAAPPP----PPPIGGGAPPPPP 704 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 32.7 bits (71), Expect = 0.46 Identities = 22/68 (32%), Positives = 26/68 (38%), Gaps = 2/68 (2%) Frame = +1 Query: 553 FPTNXGXTPXKX-FXPXGPXKXPNP*KG-PGWXGFSPRXPPPXXXPPQIPPPXXGXPPPR 726 +P P K + P G + P G PG G PPP PP + P G PPP Sbjct: 175 YPQGQEPYPEKGGYPPAGVGQHSGPYPGQPGMWG-----PPPMGGPPPMGGPPGGYPPPP 229 Query: 727 XXXXPGXP 750 G P Sbjct: 230 PPPGAGDP 237 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPP 702 P P P GP G+ P PPP P PPP Sbjct: 211 PMGGPPPMGGPP-GGYPPPPPPPGAGDPAYPPP 242 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 PPP PP PPP PPP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PPP P P P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/65 (29%), Positives = 22/65 (33%) Frame = +1 Query: 559 TNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXX 738 T+ +P + P P P P P SP P P PP PP P Sbjct: 192 TSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPI 251 Query: 739 PGXPP 753 P PP Sbjct: 252 PNMPP 256 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP PP P P P P PP Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PP PP P P P+P PP P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXPXSXA 976 P PPP PP P P P PP P A Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLA 242 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PPP PPP PP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P + P +P PPP P PP PPP G PP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPP----PPPPIAPATGGPP 152 Score = 29.9 bits (64), Expect = 3.3 Identities = 20/54 (37%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXG-XPPPRXXXXPGXPP 753 P P + P+P P + R PPP PP I P G PPP G PP Sbjct: 117 PETPSQAPSPPPPP--TSPATRAPPP---PPPIAPATGGPPPPPPIAPATGGPP 165 Score = 28.3 bits (60), Expect = 10.0 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P G P P P P P +P P PPP G PPP Sbjct: 146 PATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVP----LAAASPPPPSGGPPPPPPP 201 Query: 736 XPGXPP 753 P PP Sbjct: 202 PPPPPP 207 Score = 28.3 bits (60), Expect = 10.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PP PP PPP PPP PP Sbjct: 190 PPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 +P PPP P+ PPP PPP P P Sbjct: 905 TPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVP 937 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 F+P PPP P +PPP PPP+ P Sbjct: 378 FNPHVPPPMIGPVTVPPPPL-IPPPQASIPP 407 Score = 28.7 bits (61), Expect = 7.5 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 8/66 (12%) Frame = +1 Query: 577 PXKXFXPXGPXKXP---NP*KGPGWXGFSPRXPPPXXXPPQ--IPPP--XXGXPPPRXXX 735 P P P P NP P G PPP PPQ IPPP PPP Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPP 421 Query: 736 XP-GXP 750 P G P Sbjct: 422 PPIGVP 427 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPPXXG--XPPPRXXXXPGXP 750 F P+ PPP PPQ+ PP PP PG P Sbjct: 2598 FGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLP 2633 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 31.9 bits (69), Expect = 0.81 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 4/55 (7%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXX--PPQIPPPXXGXPPP--RXXXXPGXPP 753 GP P P W G P PP PP PPP PPP G PP Sbjct: 269 GPFNQAPPGFPPRW-GPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPP 322 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 31.9 bits (69), Expect = 0.81 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PR PPP PP PPP PPP G P Sbjct: 864 PRRPPPPPPPPPPPPP---PPPPPPASSTGSTP 893 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXPPPRXXXXPG 744 R PPP PP PPP P PG Sbjct: 866 RPPPPPPPPPPPPPPPPPPPASSTGSTPG 894 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 PPP PP PP G PPP P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPP 1264 Score = 28.7 bits (61), Expect = 7.5 Identities = 19/52 (36%), Positives = 21/52 (40%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P P P P + G P PPP P +PP PPP PG P Sbjct: 1235 PPPPPAMP-PDGPPKFMGLPP--PPPGMRP--MPPQPPFMPPPPRMQPPGPP 1281 Score = 28.3 bits (60), Expect = 10.0 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +PR PP +PPP PP G PP Sbjct: 1221 APRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPP 1254 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 31.9 bits (69), Expect = 0.81 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQ--IPPPXXGXPPPRXXXXPGXPP 753 G+ P PP PP PPP PPP P PP Sbjct: 119 GYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 31.9 bits (69), Expect = 0.81 Identities = 21/68 (30%), Positives = 25/68 (36%), Gaps = 1/68 (1%) Frame = +1 Query: 553 FPTNXGXTPXKXFXPX-GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 + T G P + F P GP +P G+ P PPP P PP PPP Sbjct: 61 YNTAIGPQPTQGFRPYPGPPPALSPQVYRGYPFQYPGTPPPPMYPA-FPPSFPSSPPPEY 119 Query: 730 XXXPGXPP 753 P P Sbjct: 120 PGLPVSSP 127 >SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 31.9 bits (69), Expect = 0.81 Identities = 21/68 (30%), Positives = 25/68 (36%), Gaps = 1/68 (1%) Frame = +1 Query: 553 FPTNXGXTPXKXFXPX-GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 + T G P + F P GP +P G+ P PPP P PP PPP Sbjct: 114 YNTAIGPQPTQGFRPYPGPLPVLSPQVYRGYPFQYPGTPPPPMYPA-FPPSFPSSPPPEY 172 Query: 730 XXXPGXPP 753 P P Sbjct: 173 PGLPVSSP 180 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 31.9 bits (69), Expect = 0.81 Identities = 21/68 (30%), Positives = 25/68 (36%), Gaps = 1/68 (1%) Frame = +1 Query: 553 FPTNXGXTPXKXFXPX-GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 + T G P + F P GP +P G+ P PPP P PP PPP Sbjct: 151 YNTAIGPQPTQGFRPFPGPPPVLSPQVYRGYPFQYPGTPPPPMYPA-FPPSFPSSPPPEY 209 Query: 730 XXXPGXPP 753 P P Sbjct: 210 PGLPVSSP 217 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 P P P PP PPP PPP P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 SP PPP PP +P PPP P P Sbjct: 510 SPPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 >SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) Length = 346 Score = 31.5 bits (68), Expect = 1.1 Identities = 24/71 (33%), Positives = 28/71 (39%) Frame = +1 Query: 541 GXFGFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPP 720 G G+P G + P GP P P PG+ G P+ PP P I G P Sbjct: 66 GVQGYP---GAPGPRGRSPPGPPGIPGPRGLPGYRG--PKGPPGYQGMPGIA----GAPG 116 Query: 721 PRXXXXPGXPP 753 PR P PP Sbjct: 117 PRGPPGPMGPP 127 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 G PT P F P P P S P P PP PPP P Sbjct: 413 GVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGV 472 Query: 730 XXXPGXPP 753 PP Sbjct: 473 PTPVAAPP 480 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 9/77 (11%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXG--PXKXPNP*KGPGWXGFSPRX--PPPXXXPPQIPP-----P 702 G PT P F P P P P F+P P P PP PP P Sbjct: 489 GVPTPVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAP 548 Query: 703 XXGXPPPRXXXXPGXPP 753 G P P P PP Sbjct: 549 SSGVPTPVTAPPPAPPP 565 Score = 30.3 bits (65), Expect = 2.5 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 5/73 (6%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXP-----PPXXXPPQIPPPXXGX 714 G PT P F P P P S P PP PP + P G Sbjct: 471 GVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGV 530 Query: 715 PPPRXXXXPGXPP 753 P P P PP Sbjct: 531 PTPVTEPPPAPPP 543 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXX--PTPXSTHPPXXXXPXS 970 P PPP PP P PTP + PP P S Sbjct: 395 PVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSS 430 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXX--PTPXSTHPPXXXXPXS 970 P PPP PP P PTP + PP P S Sbjct: 453 PVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSS 488 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 PPP PP P P P+P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 FS R P PP PPP PP P PP Sbjct: 1150 FSVRDQIPPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 P PPP PP P P PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PP PPP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/68 (30%), Positives = 25/68 (36%), Gaps = 1/68 (1%) Frame = +1 Query: 553 FPTNXGXTPXKXFXPX-GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 + T G P + F P GP +P G+ P PPP P PP PPP Sbjct: 151 YNTAIGPQPTQGFRPYPGPSPVLSPQVYRGYPFQYPGTPPPPMYPA-FPPIFPSSPPPEY 209 Query: 730 XXXPGXPP 753 P P Sbjct: 210 PGLPVSSP 217 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PP PP++P P G P PG PP Sbjct: 378 PGLLPPPGMPPRLPIPGLGLPGMPLPGMPGMPP 410 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P PPP PP PPP PP P P Sbjct: 98 PATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXG-FSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P PNP P F P PP PP P P PP P P Sbjct: 285 PSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPP 337 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXG-FSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P F P P PNP P + P PP PP P P PP P P Sbjct: 300 PPNLFIPSAP---PNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 619 NP*KGPGWXGFSPRXPP-PXXXPPQIPPPXXGXPPP 723 +P + W P PP P PP PP G PPP Sbjct: 184 SPTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPP 219 >SB_58050| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP-PPRXXXXPGXP 750 P GP P P PG G + PP P G P PP PG P Sbjct: 83 PPGPPGAPGPPGEPGQVGMAGPPGPPGHVGEDGAPGAPGAPGPPGSPGAPGLP 135 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTH 943 P C P PPP PP P P P P + H Sbjct: 96 PPACCAPPPPPPPPPP--PPPPPPPPPITLH 124 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPP 723 +P PP PP PPP PPP Sbjct: 92 APACPPACCAPPPPPPPPPPPPPP 115 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 P PPP P PPP P PP PG PP Sbjct: 50 PGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPP 84 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 P PPP P PPP P PP PG PP Sbjct: 70 PGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPP 104 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGXPP 753 P PPP P+ PPP P P PG PP Sbjct: 20 PGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPP 54 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P PP P P G PPP PG PP Sbjct: 65 PNTPIPGDPPPNTPIP--GDPPPN-TPIPGNPP 94 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/55 (30%), Positives = 21/55 (38%) Frame = +1 Query: 589 FXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 + P P P+P + P PR PP P +PP PP P PP Sbjct: 257 YLPSPPRYPPSPLRYPP---IPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPP 308 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/53 (35%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPP---PRXXXXPGXPP 753 P P P G+ P PP P Q P P G PP P+ PG PP Sbjct: 138 PMPHPTASVYPPPGGYPPTSYPPQPYPAQ-PYPQQGYPPQPPPQAYPQPGYPP 189 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPP 723 PPP PPQ PPP P P Sbjct: 1579 PPPTPSPPQTPPPVNTPPRP 1598 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHP 946 PPP PP P P P P S+ P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 28.3 bits (60), Expect = 10.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPR 726 P PPP PP PPP P R Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSR 77 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 722 GGGXPXXGGGIXGGLXXGGGXLG 654 GGG GGG+ GG+ GGG G Sbjct: 90 GGGSGGFGGGLFGGMPFGGGMGG 112 >SB_31443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPR 726 PR PP P PP G PPPR Sbjct: 172 PRRLPPQLPPSSSLPPPFGEPPPR 195 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPP 702 PR PPP PP PPP Sbjct: 148 PRTPPPEPTPPPTPPP 163 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 29.1 bits (62), Expect = 5.7 Identities = 23/73 (31%), Positives = 28/73 (38%), Gaps = 7/73 (9%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPP--PXXXPPQI--PPPXXGXPPP 723 P G P + P P + P PG + P PP P P ++ PP G PP Sbjct: 354 PHEPGRPPHEPGRP--PHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPPHEPGRPPH 411 Query: 724 ---RXXXXPGXPP 753 R PG PP Sbjct: 412 EPGRLPHEPGRPP 424 Score = 28.3 bits (60), Expect = 10.0 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +1 Query: 595 PXGPXKXPN-P*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP---RXXXXPGXPP 753 P P + P+ P + P G P P P PP G PP R PG PP Sbjct: 326 PYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 382 Score = 28.3 bits (60), Expect = 10.0 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +1 Query: 595 PXGPXKXPN-P*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP---RXXXXPGXPP 753 P P + P+ P + P G P P P PP G PP R PG PP Sbjct: 333 PHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 389 Score = 28.3 bits (60), Expect = 10.0 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +1 Query: 595 PXGPXKXPN-P*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPP---PRXXXXPGXPP 753 P P + P+ P + P G P P P PP G PP R PG PP Sbjct: 340 PHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 396 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 667 PPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PP PP PPP G PPP PP Sbjct: 212 PPTAAPP--PPPTTGAPPPTPVTNKPPPP 238 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 652 SPRXPP-PXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P PP P P PPP PPP P PP Sbjct: 211 TPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPP 245 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.1 bits (62), Expect = 5.7 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +1 Query: 628 KGPGWXGFSPRXPPPXXXPPQ--IPPPXXGXPPPRXXXXPGXPP 753 KG G P PPP PP IPPP P P+ P PP Sbjct: 420 KGGPPGGGVPSHPPPLPQPPPSIIPPPT--TPLPQTVPTPPRPP 461 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 29.1 bits (62), Expect = 5.7 Identities = 23/73 (31%), Positives = 28/73 (38%), Gaps = 7/73 (9%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPP--PXXXPPQI--PPPXXGXPPP 723 P G P + P P + P PG + P PP P P ++ PP G PP Sbjct: 120 PHEPGRPPHEPGRP--PHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPPHEPGRPPH 177 Query: 724 ---RXXXXPGXPP 753 R PG PP Sbjct: 178 EPGRLPHEPGRPP 190 Score = 28.3 bits (60), Expect = 10.0 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +1 Query: 595 PXGPXKXPN-P*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP---RXXXXPGXPP 753 P P + P+ P + P G P P P PP G PP R PG PP Sbjct: 92 PYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 148 Score = 28.3 bits (60), Expect = 10.0 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +1 Query: 595 PXGPXKXPN-P*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP---RXXXXPGXPP 753 P P + P+ P + P G P P P PP G PP R PG PP Sbjct: 99 PHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 155 Score = 28.3 bits (60), Expect = 10.0 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +1 Query: 595 PXGPXKXPN-P*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPP---PRXXXXPGXPP 753 P P + P+ P + P G P P P PP G PP R PG PP Sbjct: 106 PHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 162 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 SP PPP PP +P PP P PP Sbjct: 308 SPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/55 (29%), Positives = 19/55 (34%) Frame = +1 Query: 589 FXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 F P G P+ G+ +P P P PP P P P P PP Sbjct: 562 FSPYGQTYVPDHRTTGGYPAPTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPP 616 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPP 949 PPP P P PTP T PP Sbjct: 1034 PPPTEPPTPPPTEPPTPPPTDPP 1056 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPP 723 P PPP PP PPP P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 831 LPPPXSXPXSVXPPXXXPPRF 893 LPPP + P ++ PP PP F Sbjct: 197 LPPPPAPPGALIPPPPAPPTF 217 >SB_3546| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-29) Length = 447 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +1 Query: 622 P*KGPGWXGFSPRXPPPXXX-PPQIPPPXXGXPPPRXXXXPGXPP 753 P P + G P PP PP PP G PP G PP Sbjct: 285 PYNNPLFTGQPPYNAPPFTGQPPYNAPPFNGQPPYNTPPFNGQPP 329 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 23.4 bits (48), Expect(2) = 10.0 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPP 702 +P PPP PP P P Sbjct: 1422 APAPPPPMAFPPMPPAP 1438 Score = 23.0 bits (47), Expect(2) = 10.0 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 682 PPQIPPPXXGXPPP 723 PP PPP PPP Sbjct: 1455 PPPPPPPAPPCPPP 1468 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 28.3 bits (60), Expect = 10.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 622 P*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPP 720 P GPG P PP PP +PP G PP Sbjct: 266 PQYGPGRRDMPPPGAPPGMLPPGMPP--HGMPP 296 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 28.3 bits (60), Expect = 10.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPP 723 P P P PP PPP PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPP 81 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.3 bits (60), Expect = 10.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP IPPP PPPR PP Sbjct: 51 PPPPPPRFYDNDIPPP----PPPRRGFYDDYPP 79 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.3 bits (60), Expect = 10.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPP 723 P P P PP PPP PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPP 305 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.3 bits (60), Expect = 10.0 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +1 Query: 634 PGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P + G PPP P +P P PPP Sbjct: 293 PPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 28.3 bits (60), Expect = 10.0 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +1 Query: 628 KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +G G G +P PPP PP PP P PR PP Sbjct: 785 EGEGVGGITPPPPPP---PPPPPPEDLIIPLPRRGSDLFAPP 823 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 28.3 bits (60), Expect = 10.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPR 726 P PPP PP +PP P P+ Sbjct: 1262 PPLPPPDAQPPSLPPQPPQPPQPQ 1285 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,972,935 Number of Sequences: 59808 Number of extensions: 254027 Number of successful extensions: 3920 Number of sequences better than 10.0: 79 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2610 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2883962642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -