BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F24 (976 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 38 0.013 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 38 0.013 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 37 0.018 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 37 0.018 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 37 0.018 At1g61080.1 68414.m06877 proline-rich family protein 36 0.031 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 36 0.031 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 36 0.041 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 36 0.041 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 36 0.041 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 36 0.054 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 36 0.054 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 36 0.054 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 35 0.094 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 34 0.12 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 34 0.16 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 34 0.16 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 34 0.16 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 33 0.22 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 33 0.22 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 33 0.22 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 33 0.22 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 33 0.29 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 33 0.29 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 33 0.29 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 33 0.29 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 33 0.38 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 33 0.38 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 33 0.38 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 33 0.38 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 32 0.50 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 32 0.50 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 32 0.50 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 32 0.50 At1g70990.1 68414.m08190 proline-rich family protein 32 0.66 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 31 0.88 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 31 0.88 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 31 0.88 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 31 0.88 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 31 0.88 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 31 1.2 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 31 1.2 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 31 1.2 At2g41420.1 68415.m05111 proline-rich family protein contains pr... 31 1.2 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 31 1.2 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 31 1.5 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 31 1.5 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 31 1.5 At1g63830.2 68414.m07224 proline-rich family protein contains pr... 31 1.5 At1g63830.1 68414.m07223 proline-rich family protein contains pr... 31 1.5 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 1.5 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 31 1.5 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 30 2.0 At3g50180.1 68416.m05486 hypothetical protein 30 2.0 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 30 2.7 At4g33660.1 68417.m04781 expressed protein 30 2.7 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 30 2.7 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 30 2.7 At1g26150.1 68414.m03192 protein kinase family protein similar t... 30 2.7 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 29 3.5 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 29 3.5 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 29 3.5 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 29 3.5 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 29 3.5 At1g27710.1 68414.m03387 glycine-rich protein 29 3.5 At1g10620.1 68414.m01204 protein kinase family protein contains ... 29 3.5 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 29 4.7 At3g52950.1 68416.m05837 CBS domain-containing protein / octicos... 29 4.7 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 29 4.7 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 29 4.7 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 29 4.7 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 29 4.7 At1g04800.1 68414.m00476 glycine-rich protein 29 4.7 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 29 4.7 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 29 6.2 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 29 6.2 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 29 6.2 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 29 6.2 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 28 8.2 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 8.2 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 28 8.2 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 28 8.2 At4g19200.1 68417.m02833 proline-rich family protein contains pr... 28 8.2 At4g01985.1 68417.m00265 expressed protein 28 8.2 At3g24550.1 68416.m03083 protein kinase family protein contains ... 28 8.2 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 8.2 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 8.2 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 28 8.2 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 28 8.2 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 5/58 (8%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQI-----PPPXXGXPPPRXXXXPGXPP 753 P P P P P +SP PPP PP + PPP PPP P PP Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Score = 37.1 bits (82), Expect = 0.018 Identities = 20/59 (33%), Positives = 22/59 (37%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P + P P P P P + P PPP P PPP PPP P PP Sbjct: 445 PPPVYSPPPPPPPPPP--PPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501 Score = 36.3 bits (80), Expect = 0.031 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P + P P P P P P PPP P PPP PPP P PP Sbjct: 460 PPPVYSPPPPPPPPPP--PPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPP----PXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P P PP P PP PPP PPP P PP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P + P P P P P P PPP PP PP PPP PP Sbjct: 432 PPPVYSPPPPPPPPPPVYSP------PPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PP PPP P PP Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPPPPP 456 Score = 32.3 bits (70), Expect = 0.50 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P P PPP P PPP PPP P PP Sbjct: 453 PPPPPPPPPPVYSPPPPPPPPPPPPPVYSP---PPPSPPPPPPPVYSPPPPPP 502 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP P PP Sbjct: 429 PSPPPPVYSPPPPPPP----PPPVYSPPPPPPP 457 Score = 31.9 bits (69), Expect = 0.66 Identities = 20/59 (33%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQI----PPPXXGXPPPRXXXXP 741 P + P P P P P +SP PPP PP + PPP PPP P Sbjct: 476 PPPVYSPPPPSPPPPP---P--PVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAP 529 Score = 31.9 bits (69), Expect = 0.66 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPG-WXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P + P P P P +SP PPP PP PP PPP Sbjct: 582 PPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPP 631 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P P +S PP PP PPP PPP PP Sbjct: 539 PPPPHSPPPPQFSPPP---PEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPP 594 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPP--XXXPPQIPPPXXGXPPPRXXXXPGXP 750 P + P P P P +SP PPP P PP PPP P Sbjct: 603 PTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPP 662 Query: 751 P 753 P Sbjct: 663 P 663 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P+P P + R PPP P PPP PPP PP Sbjct: 521 PPPPPSPAPTPV---YCTRPPPPPPHSP--PPPQFSPPPPEPYYYSSPPP 565 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PPP PP P P+P PP P Sbjct: 461 PPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPP 498 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PPP PP P P P PP P Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSP 482 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXX--GXPPPRXXXXPGXPP 753 P P P P + PPP P PPP PPP P PP Sbjct: 571 PPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPP 622 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 869 PXXXPPPL--PPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP+ PP P P P P + PP P Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPP 489 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PPP PP P P P PP P Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPP 483 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 G SP PPP PP PPP PPP P P Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP P PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 860 CXXPXXXPPPLPPXXPXXPXXPTPXSTHPP 949 C P PPP PP P P P P PP Sbjct: 374 CSPPSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 33.1 bits (72), Expect = 0.29 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXP---PQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P + SP PPP P P PPP PPP PP Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPP 448 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P PP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 31.5 bits (68), Expect = 0.88 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXPXS 970 P PPP PP P P P P +P P S Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPS 419 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 5/66 (7%) Frame = +1 Query: 568 GXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXP-----PQIPPPXXGXPPPRXX 732 G +P P P P P P P PPP P P PPP PPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPY 432 Query: 733 XXPGXP 750 P P Sbjct: 433 VYPPPP 438 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P+P P P PPP PP PPP P P PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P C PP PP P P P P PP P Sbjct: 366 PIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P + PP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P + PP P Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P PP P Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYP 426 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 37.1 bits (82), Expect = 0.018 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 S R P P PP PPP G PPP P PP Sbjct: 669 SARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPP 702 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 634 PGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 PG G P PPP PP PPP G PPP Sbjct: 675 PG-GGPPPPPPPPGGGPP--PPPGGGPPPP 701 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 461 PKXKPXXPGGGGVXXXXKXPPXPPPXPEKXKXXNXGG 351 P P PGGG PP PPP P GG Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGG 715 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPG 744 PPP P PPP G PP PG Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPPG 706 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PPP PPP P PP Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATPP 106 Score = 31.5 bits (68), Expect = 0.88 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 655 PRXPPPXXXPP-QIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP PP Sbjct: 79 PASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP + P PPP PP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPP 94 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXP 741 PPP PP PP PPP P Sbjct: 94 PPPVASPPPATPPPVATPPPAPLASP 119 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P SP P PP PPP PPP P PP Sbjct: 41 PAATPPPVSAPPPVTTSP-PPVTTAPPPANPPPPVSSPPP-ASPPPATPP 88 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PPP PPP P PP Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATPP 106 Score = 31.5 bits (68), Expect = 0.88 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 655 PRXPPPXXXPP-QIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP PP Sbjct: 79 PASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP + P PPP PP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPP 94 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXP 741 PPP PP PP PPP P Sbjct: 94 PPPVASPPPATPPPVATPPPAPLASP 119 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P SP P PP PPP PPP P PP Sbjct: 41 PAATPPPVSAPPPVTTSP-PPVTTAPPPANPPPPVSSPPP-ASPPPATPP 88 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 36.3 bits (80), Expect = 0.031 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P P K F P P P G +P PPP P I P PPPR Sbjct: 479 PLPPAVMPLKHFAPP----PPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAV 534 Query: 736 XPGXPP 753 P PP Sbjct: 535 APPPPP 540 Score = 35.9 bits (79), Expect = 0.041 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 PT P P P P PG P PPP PPP PPP Sbjct: 517 PTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPP---PPPPMQNR 573 Query: 736 XPGXPP 753 P PP Sbjct: 574 APSPPP 579 Score = 28.7 bits (61), Expect = 6.2 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPP----XXXPPQIPPPXXGXPPP 723 PT P K P P P P P PPP PP PPP PP Sbjct: 495 PTPPAFKPLKGSAPPPPPPPPLP----TTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPP 550 Query: 724 RXXXXPG 744 PG Sbjct: 551 PPPPPPG 557 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP + P PPP P P Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMP 486 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 36.3 bits (80), Expect = 0.031 Identities = 22/63 (34%), Positives = 25/63 (39%), Gaps = 6/63 (9%) Frame = +1 Query: 583 KXFXPXGPXKXPNP*-----KGPGWXGFSP-RXPPPXXXPPQIPPPXXGXPPPRXXXXPG 744 K P GP P+P K P SP PPP P +PPP PP+ P Sbjct: 21 KPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPA 80 Query: 745 XPP 753 PP Sbjct: 81 PPP 83 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +1 Query: 583 KXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 K P GP P GP P P P P P P PPP+ P PP Sbjct: 11 KPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPS-PPPKPQPKPVPPP 66 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P P P P PP PP P P+ P P Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKP 87 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P C P P P PP P P+P P P Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPP 65 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIP-PPXXGXPPPRXXXXPGXPP 753 P P P P P PPP P P PP P P+ G PP Sbjct: 66 PACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPP 119 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/66 (30%), Positives = 23/66 (34%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P + P + P P P P S PPP P +PPP PPP Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSP 1117 Query: 736 XPGXPP 753 P PP Sbjct: 1118 PPSPPP 1123 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +1 Query: 574 TPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQ--IPPPXXGXPPP 723 +P P P P P P F P PPP PP PPP PPP Sbjct: 1078 SPPPPSPPLPPSSLPPP---PPAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +2 Query: 869 PXXXPPPLP--PXXPXXPXXPTPXSTHPP 949 P PPPLP P P P P P S+ PP Sbjct: 1065 PQESPPPLPPLPPSPPPPSPPLPPSSLPP 1093 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P + PP P Sbjct: 1076 PPSPPPPSPPLPPSSLPPPPPAALFPPLPPPP 1107 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 667 PPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 PP PP PPP PPP P P Sbjct: 1101 PPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP-PPRXXXXPGXPP 753 P P+P P P PPP PP PPP P PP P PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPP 96 Score = 35.9 bits (79), Expect = 0.041 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P P P P P PPP PPQ+PPP PP P P Sbjct: 64 PPPPPPCPPPPSPPPCP--PPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +2 Query: 851 PXXCXXPXXXPP-PLPPXXPXXPXXPTPXSTHPPXXXXP 964 P C P PP P PP P P P+P + PP P Sbjct: 58 PADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPP 96 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P P PP P Sbjct: 77 PPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 31.5 bits (68), Expect = 0.88 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP+ P PP Sbjct: 73 PPSPPPCPPPPS-PPP--SPPPPQLPPPPQLPP 102 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P C P PPP PP P P P P PP P Sbjct: 67 PPPCPPPPS-PPPCPP-PPSPPPSPPPPQLPPPPQLPP 102 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +2 Query: 851 PXXCXXPXXXPP-PLPPXXPXXPXXPTPXSTHP 946 P C P PP P PP P P P P P Sbjct: 76 PPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP IPPP PPPR P PP Sbjct: 575 PPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 31.5 bits (68), Expect = 0.88 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP P + PP PPP P PP Sbjct: 574 PPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPP 606 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PPP PP P P+P + PP P Sbjct: 589 PPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 610 KXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP--RXXXXPGXPP 753 K P P P S PPP PP PP PPP R P PP Sbjct: 570 KTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPP 619 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PPP P P PP Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPP 623 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P FSP PPP PP + P + P PP Sbjct: 484 PPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +1 Query: 664 PPPXXXPPQIPPP-XXGXPPPRXXXXPGXPP 753 PPP PP PPP P P P PP Sbjct: 595 PPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 655 PRXPPPXXXPPQ---IPPPXXGXPPP 723 PR PPP PP IP P PPP Sbjct: 597 PRPPPPPPPPPSSRSIPSPSAPPPPP 622 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P G G + PP PP PPP P + P PP Sbjct: 615 PSAPPPPPPPPPSFGSTGNKRQAQPP---PPPPPPPPTRIPAAKCAPPPPPPP 664 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 35.5 bits (78), Expect = 0.054 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P +SP PPP P PPP PPP P PP Sbjct: 520 PAPVNSPPPPVYSPPPPPPPVHSP--PPPVHSPPPPPVYSPPPPPP 563 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P P P P SP PPP PP PPP PPP Sbjct: 533 PPPPPPPVHSPPPPVHSP-PPPPVYSPPPPPPPVHSPPPP 571 Score = 31.9 bits (69), Expect = 0.66 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPP----QIPPPXXGXPPPRXXXXPGXP 750 P P P P FSP PPP PP PPP PPP P P Sbjct: 558 PPPPPPPVHSPPPPVFSP--PPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPP 608 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P + P P P P PPP P PPP PPP P P Sbjct: 576 PPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSP 634 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPP-QIPPP 702 P + P + P P P P + P P PP PP Q PPP Sbjct: 608 PVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPP 657 >At1g63570.1 68414.m07186 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function DUF26; similar to receptor-like protein kinase 4 (GI:13506745) [Arabidopsis thaliana] Length = 284 Score = 35.5 bits (78), Expect = 0.054 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 616 PNP*KGPG-WXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P+P P SP PP PPQ+PPP PPP Sbjct: 245 PSPAPSPSSLPPISPTSSPPLSLPPQLPPPLSQPPPP 281 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 35.5 bits (78), Expect = 0.054 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P GP +P P +P PPP P PPP PPP G PP Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPP----PPPPGKKGAGPPP 423 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P KGP +P PPP PPP PPP P PP Sbjct: 395 PPPPPPPKKGPA----APPPPPPPGKKGAGPPP----PPPMSKKGPPKPP 436 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 34.7 bits (76), Expect = 0.094 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQI--PPPXXGXPPPRXXXXPGXPP 753 P P P +SP PP PP + PPP PPP P PP Sbjct: 574 PPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 +SP PPP PP PPP PPP P P Sbjct: 516 YSPPPPPPVYSPPP-PPPVYSPPPPPPVHSPPPP 548 Score = 33.5 bits (73), Expect = 0.22 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P +SP PPP PP PPP PPP P PP Sbjct: 633 PPPVHSPPPPVYSP--PPPVYSPP--PPPVKSPPPPPVYSPPLLPP 674 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PPP PPP P PP Sbjct: 512 PPPVYSPPP-PPPVYSPPPPPPVYSPPPPP 540 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 SP P P PP PPP PPP P PP Sbjct: 500 SPPPPSPIHSPP--PPPVYSPPPPPPVYSPPPPP 531 Score = 31.5 bits (68), Expect = 0.88 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 2/62 (3%) Frame = +1 Query: 574 TPXKXFXPXGPXKXPNP*K--GPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGX 747 TP P P + P P F PPP P P P PPP P Sbjct: 462 TPSPVHKPQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPP 521 Query: 748 PP 753 PP Sbjct: 522 PP 523 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQI-PPPXXGXPPPRXXXXPGXPP 753 P P P FSP P PP PPP PPP P PP Sbjct: 619 PPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +1 Query: 577 PXKXFXPXGPX-KXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP--PPRXXXXPGX 747 P F P P P P P +SP PPP PP PPP P PP+ P Sbjct: 626 PPPVFSPPPPVHSPPPPVYSPPPPVYSP-PPPPVKSPP--PPPVYSPPLLPPKMSSPPTQ 682 Query: 748 PP 753 P Sbjct: 683 TP 684 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = +1 Query: 577 PXKXFXPXGPX--KXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 P + P P P P P SP PPP PP PPP PPP Sbjct: 581 PPPVYSPPPPPVHSPPPPVHSPPPPVHSP--PPPVYSPPP-PPPVHSPPPP 628 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPP---QIPPPXXGXPPPRXXXXPGX 747 P + P P +P P +SP PPP PP PPP PPP P Sbjct: 512 PPPVYSPPPPPPVYSPPPPP--PVYSPPPPPPVHSPPPPVHSPPPPVHSPPP-PVHSPPP 568 Query: 748 P 750 P Sbjct: 569 P 569 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQ--I-PPPXXGXPPPRXXXXPGXPP 753 P P P +SP PPP PP PPP PPP P PP Sbjct: 603 PPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPP--PP 649 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PP PPP P PP Sbjct: 32 PPPATPPPVATPPPVATPPPAATPAPATPP 61 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP P PPP P P Sbjct: 43 PPPVATPPPAATPAPATPPPAATPAPATTP 72 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP P PP Sbjct: 64 PPPPPPTSPPPPSPPPP--SPPPPSPPPPSPPP 94 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP PP P P P S PP Sbjct: 69 PTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPP 720 P PPP PP PPP PP Sbjct: 74 PPSPPPPSPPPPSPPPPSPPPP 95 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +1 Query: 589 FXPXGPXKXPN-P*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 F P GP P P GPG GF R P P+ P P G PR G P Sbjct: 33 FGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPGGGGGPGP 88 Score = 32.7 bits (71), Expect = 0.38 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 1/82 (1%) Frame = +1 Query: 508 RXGXRXXLPXXGXFGFPTNXGXTPX-KXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXP 684 R G P FG P G P F P GP +GP GF PR P P P Sbjct: 20 RGGGPGFGPGGPGFG-PGGPGFGPGGPGFGPGGPGFGG---RGPRGPGFGPRGPGPWSGP 75 Query: 685 PQIPPPXXGXPPPRXXXXPGXP 750 P G P P P P Sbjct: 76 RGPRPGGGGGPGPGPWSGPRGP 97 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPP--RXXXXPGXPP 753 SP PPP PP PPP PPP G PP Sbjct: 41 SPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPP 76 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPP 723 P+ PPP PP PPP PPP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPP 61 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPPXXGXPPP 723 F PPP PP PPP PPP Sbjct: 38 FPQSPPPPPPPPPPPPPPPPPPPPP 62 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPP 949 PPP PP P P P P PP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPP 64 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +1 Query: 655 PRXPPPXXXPPQIPP----PXXGXPPPRXXXXP 741 P PPP PP PP P PPPR P Sbjct: 93 PPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 622 P*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 P P + FSP PPP PP PP PPP P Sbjct: 158 PPPSPDFPPFSPSIPPP--SPPYFPPEPPSIPPPPPPSPP 195 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 33.5 bits (73), Expect = 0.22 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +1 Query: 595 PXGPXKXP---NP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P K P P K P +P P P PPP PPP P P Sbjct: 92 PPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTP 146 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 664 PPPXXXPPQ-IPPPXXGXPPPRXXXXPGXPP 753 PPP PPQ PPP G PP PG P Sbjct: 38 PPPGGYPPQGYPPPPHGYPPAAYPPPPGAYP 68 Score = 32.7 bits (71), Expect = 0.38 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = +1 Query: 604 PXKXPNP*KG--PGWXGFSPRX--PPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P P +G P G+ P+ PPP PP PP G PP P P Sbjct: 26 PGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGP 78 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PPP PPP PP Sbjct: 62 PSPPPPSPPPPACPPPPALPPPPPKKVSSYCPP 94 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXP 741 PPP PP PPP PPP P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPP 84 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPP 723 P PPP PP PP PPP Sbjct: 61 PPSPPPPSPPPPACPPPPALPPP 83 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 33.1 bits (72), Expect = 0.29 Identities = 23/70 (32%), Positives = 25/70 (35%), Gaps = 4/70 (5%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIP-PPXXGXPPPRXX 732 P+ G P P P P+P P SP P P PP P P G PP Sbjct: 443 PSPGGSPPSPSIVPSPPSTTPSPGSPPT----SPTTPTPGGSPPSSPTTPTPGGSPPSSP 498 Query: 733 XXP---GXPP 753 P G PP Sbjct: 499 TTPTPGGSPP 508 Score = 31.9 bits (69), Expect = 0.66 Identities = 18/66 (27%), Positives = 20/66 (30%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P+ G P P P P+P P G P P P PP PP Sbjct: 514 PSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISP 573 Query: 736 XPGXPP 753 PP Sbjct: 574 GQNSPP 579 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P+ G P P P P+P P G SP P PP P P Sbjct: 417 PSPGGSPPSPSISPSPPITVPSPPTTPS-PGGSPPSPSIVPSPPSTTPSPGSPPTSPTTP 475 Query: 736 XPGXPP 753 PG P Sbjct: 476 TPGGSP 481 Score = 29.9 bits (64), Expect = 2.7 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 7/57 (12%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXP-------PPRXXXXPGXPP 753 P P+P P SP P PP P P P PP PG PP Sbjct: 413 PPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPP 469 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = +1 Query: 550 GFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRX 729 G P + TP P P+P P SP P PP P G PP Sbjct: 492 GSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPS-TPTSPGSPPSPS 550 Query: 730 XXXPGXP 750 P P Sbjct: 551 SPTPSSP 557 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPP-XXXPPQIPPPXXGXPPP 723 P P P P P +SP PP PP P P PPP Sbjct: 738 PPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPP 781 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXP-XXPTPXSTHPPXXXXP 964 P PPLPP P P PTP S+ PP P Sbjct: 592 PSSPSPPLPPVIPSPPIVGPTP-SSPPPSTPTP 623 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P SP PPP PP PPP PPP P PP Sbjct: 714 PPPVHSPPPPVHSP--PPPVQSPP--PPPVFSPPPPAPIYSPPPPP 755 Score = 31.5 bits (68), Expect = 0.88 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +1 Query: 577 PXKXFXPXGPX-KXPNP*KGPGWXGFSPRXPPPXXXPPQI--PPPXXGXPPPRXXXXPGX 747 P F P P P P P SP PP PP + PPP PPP P Sbjct: 657 PPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP-- 714 Query: 748 PP 753 PP Sbjct: 715 PP 716 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPPQI--PPPXXGXPPPRXXXXPGXPP 753 P P P SP PP PP + PPP PPP P PP Sbjct: 753 PPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP--PP 798 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +1 Query: 649 FSPRXPPPXXXPP----QIPPPXXGXPPPRXXXXPGXP 750 FSP P P PP PPP PPP P P Sbjct: 740 FSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPP 723 SP+ PP PP PPP PPP Sbjct: 638 SPQSPPVHSPPP--PPPVHSPPPP 659 Score = 28.3 bits (60), Expect = 8.2 Identities = 21/69 (30%), Positives = 24/69 (34%), Gaps = 3/69 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPX-KXPNP*KGPGWXGFSPRXPPPXXXPPQI--PPPXXGXPPPR 726 P + P P P P P P +SP P PP + PPP PPP Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Query: 727 XXXXPGXPP 753 P PP Sbjct: 703 VHSPP--PP 709 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PR PPP PP+ PP PPP P PP Sbjct: 86 PRLPPPLLPPPEEPPREPPPPPPPPEEPP--PP 116 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/62 (35%), Positives = 25/62 (40%), Gaps = 9/62 (14%) Frame = +1 Query: 595 PXGPXKXPNP*KG--PGWXGFSPRX--PPPXXXP---PQIPPPXXGXP--PPRXXXXPGX 747 P P + P P P PR PPP P P++PPP P PPR P Sbjct: 49 PSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Query: 748 PP 753 PP Sbjct: 109 PP 110 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 P PP PP++PPP PP P Sbjct: 43 PSPPPSPSSPPRLPPPFPALFPPEPPLPP 71 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 33.1 bits (72), Expect = 0.29 Identities = 19/65 (29%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQI---PPPXXGXPPPR 726 P++ + + P P P P P + SP P P PP I PPP PP Sbjct: 516 PSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTT 575 Query: 727 XXXXP 741 P Sbjct: 576 QSPPP 580 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/67 (29%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKX-PNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXX 732 PT P K P + P+P P + ++ PPP Q PPP PPP Sbjct: 573 PTTQSPPPPKYEQTPSPREYYPSP--SPPYYQYTSSPPPPTYYATQSPPP---PPPPTYY 627 Query: 733 XXPGXPP 753 PP Sbjct: 628 AVQSPPP 634 Score = 29.1 bits (62), Expect = 4.7 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 2/61 (3%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPP--XXGXPPPRXXXXPGXP 750 P + P P P+ P + P PPP PP PPP PPP P P Sbjct: 505 PPPEYEPSPPP--PSSEMSPSVRAYPP--PPPLSPPPPSPPPPYIYSSPPP---PSPSPP 557 Query: 751 P 753 P Sbjct: 558 P 558 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 GP + P P PG G P PP P PP G PR P Sbjct: 384 GPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P PP PPP G P P P P Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGP 411 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +1 Query: 601 GPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 GP + P P PG G P PP P PP G PR P Sbjct: 384 GPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P PP PPP G P P P P Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGP 411 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P +P PP P PPP PPP P PP Sbjct: 92 PLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPP 144 Score = 31.9 bits (69), Expect = 0.66 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 3/69 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQI---PPPXXGXPPPR 726 PT P P P P P+ PP PPQ PPP PPP Sbjct: 57 PTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPP 116 Query: 727 XXXXPGXPP 753 P PP Sbjct: 117 AITPPLSPP 125 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 GFS P P PP +PP PPP+ P PP Sbjct: 250 GFSCPGPSPTISPPPLPPQTLKPPPPQTTPPP--PP 283 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P PP PP + PP PPP P PP Sbjct: 138 TPPALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 646 GFSPRXPPPXXXPPQI--PPPXXGXPPPRXXXXPGXPP 753 G SP PP P + PPP PPP P PP Sbjct: 255 GPSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P P + P P P PP PP P PP Sbjct: 44 PPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPP 96 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P P PPP P P P TP + PP P Sbjct: 94 PPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITP 131 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 5/57 (8%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPR--XPPPXXXPPQIPP---PXXGXPPPRXXXXPGXP 750 P P P P P G+ P PP PPQ P P G PPP+ G P Sbjct: 488 PQHPVSAPPPQGYPPKEGYPPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYP 544 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 32.3 bits (70), Expect = 0.50 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = +1 Query: 553 FPTNXGXTPXKXFXPXGPX-KXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 FP +P P P K P P W PR PP PP+ PPP PPP Sbjct: 128 FPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWE--PPR--PPDIFPPESPPPGIDPPPP 181 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 PPPL P P P P S PP P Sbjct: 115 PPPLGPPQTPGPEFPVPPSPSPPMPDTP 142 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXP-----PPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P GP + P P + P SP P P PP + PP P P P PP Sbjct: 117 PLGPPQTPGP-EFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPP 173 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PP PP PP PPP+ P PP Sbjct: 269 PAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 32.3 bits (70), Expect = 0.50 Identities = 17/50 (34%), Positives = 20/50 (40%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P + P +P PPP PP +PPP P P PP Sbjct: 6 PPYPPLP-QPPSQNSLAP-PPPPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 628 KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPP 720 +GP + F+ PP PP PPP PP Sbjct: 59 QGPHYPQFNQLQAPPPPPPPSAPPPLVPDPP 89 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PP LPP P P P S PP P Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +1 Query: 655 PRXPPPXXXPPQIP---PPXXGXPPPRXXXXPGXP 750 P PPP PP IP PP PPP P P Sbjct: 87 PSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPP 121 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PPP PPP P PP Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPPPDAPP 97 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPP 720 SP PP PP PPP PP Sbjct: 76 SPPPPPDLTPPPSSPPPPDAPPP 98 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP PP PPP P PP Sbjct: 79 PPPDLTPPPSSPPPPDAPPPIPIVFP--PP 106 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXP 741 PPP PP PPP PPP P Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSP 117 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTH 943 PPPLPP P P P ST+ Sbjct: 110 PPPLPPSPPKKSYCPPPPSTY 130 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 655 PRXPPPXXXPPQ--IPPPXXGXPPPRXXXXPGXP 750 P PPP PP PPP PP+ P P Sbjct: 94 PSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.5 bits (68), Expect = 0.88 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 R PPP PP PPP PPP P Sbjct: 371 RSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 31.5 bits (68), Expect = 0.88 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P ++P PPP PP PPP PPP PP Sbjct: 121 PPPPPTPYTPPPPTPYTP--PPPTVKPP--PPPVVTPPPPTPTPEAPCPP 166 Score = 29.5 bits (63), Expect = 3.5 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXX-PPQI--PPPXXGXPPPR 726 P P K P P P + P PPP PP + PPP PPP Sbjct: 41 PPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPP 100 Query: 727 XXXXPGXPP 753 P PP Sbjct: 101 PTVKPPPPP 109 Score = 28.7 bits (61), Expect = 6.2 Identities = 22/67 (32%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = +1 Query: 574 TPXKXFXPXGPXKXPNP*--KGPGWXGFSP--RXPPPXXX---PPQIPPPXXGXPPPRXX 732 +P P P K P P K P P + PPP PP P P PPP Sbjct: 35 SPHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPY 94 Query: 733 XXPGXPP 753 P PP Sbjct: 95 VKPPPPP 101 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 PPP PP PPP PPP P P Sbjct: 99 PPPTVKPP--PPPYVKPPPPPTVKPPPPP 125 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PP PP P P PTP + PP P Sbjct: 116 PPTVKPP-PPPTPYTPPPPTPYTPPPPTVKPP 146 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 + PPP P PPP PPP P PP Sbjct: 88 KPPPPPYVKP--PPPPTVKPPPPPYVKPPPPP 117 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 + PPP P PPP PPP P PP Sbjct: 96 KPPPPPTVKP--PPPPYVKPPPPPTVKPPPPP 125 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PP P PPP PP P PP Sbjct: 117 PTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PP PP P PTP + PP P Sbjct: 140 PPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 31.5 bits (68), Expect = 0.88 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +1 Query: 619 NP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 +P P + P PPP PP PPP PPP P P Sbjct: 49 SPAPSPEPEDYLPLPPPPQTPPP--PPPPQSLPPPSPSPEPEHYP 91 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGF-SPRXPPPXXXPPQIPPP 702 P + P P P P + + +P PPP PP PPP Sbjct: 74 PPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP PP P P+P H P Sbjct: 65 PPQTPPPPPPPQSLPPPSPSPEPEHYP 91 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 31.5 bits (68), Expect = 0.88 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PP PP I PP PPP P PP Sbjct: 166 PVTTPPGLLPPIINPPPVTVPPPSSGYPPYGPP 198 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 31.5 bits (68), Expect = 0.88 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +1 Query: 655 PRXPPPXXXPPQIP----PPXXGXPPPRXXXXPGXPP 753 P PPP PP P PP PPP P PP Sbjct: 149 PESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +1 Query: 628 KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXP-GXPP 753 K G+ G+ P PP P P G PPP P G PP Sbjct: 9 KDKGFHGYPPAGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPP 51 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPPXXGXPPPR 726 +SP PPP PP PPP PPP+ Sbjct: 35 YSP-PPPPVYSPPISPPPPPPPPPPQ 59 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/83 (25%), Positives = 26/83 (31%), Gaps = 2/83 (2%) Frame = +1 Query: 508 RXGXRXXLPXXGXFGFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXP--PPXXX 681 + G + +P P+ P P P P+ P SP P PP Sbjct: 109 KNGMKLAVPVLAAAPSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSPP-SPPSPSLPPSSL 167 Query: 682 PPQIPPPXXGXPPPRXXXXPGXP 750 PP PP G P P P Sbjct: 168 PPSASPPTNGTPDSETLTPPPAP 190 >At2g41420.1 68415.m05111 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 98 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/61 (31%), Positives = 24/61 (39%) Frame = +1 Query: 568 GXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGX 747 G P + + P G K P +G G+ + PP P Q P G PPP P Sbjct: 10 GVPPPQGYPPEGYPKDAYPPQGYPPQGYPQQGYPPQGYPQQ-GYPQQGYPPPYAPQYPPP 68 Query: 748 P 750 P Sbjct: 69 P 69 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/71 (29%), Positives = 23/71 (32%) Frame = +1 Query: 541 GXFGFPTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPP 720 G F PTN T F + NP P PPP PP + PP Sbjct: 5 GPFSHPTNLNPTAPAFFPAINQHQNQNPSLIPTRFFLPHPPPPPPPPPPPLYFSYFSLPP 64 Query: 721 PRXXXXPGXPP 753 P P PP Sbjct: 65 P--PPPPHLPP 73 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 SP PP PP PPP PPP P PP Sbjct: 142 SPPPPPVLLSPP--PPPVLFSPPPPTVTRPPPPP 173 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P +P P SP PP PP PP PPP P PP Sbjct: 45 PPPPVNISSP---PPPVNLSPPPPPVNLSPPP-PPVNLSPPPPPVNLSPPPPP 93 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP P PP PPP P PP Sbjct: 73 PPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP P PP PPP P PP Sbjct: 82 PPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP P PP PPP P PP Sbjct: 91 PPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP P PP PPP P PP Sbjct: 100 PPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP P PP PPP P PP Sbjct: 109 PPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP P PP PPP P PP Sbjct: 118 PPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP P PP PPP P PP Sbjct: 127 PPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/66 (31%), Positives = 24/66 (36%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P TP K P K P P + P + +P PP PP PP PP Sbjct: 80 PPTIPVTPVKPPVSTPPIKLP-PVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPP--TT 136 Query: 736 XPGXPP 753 P PP Sbjct: 137 SPVKPP 142 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P+P P +SP PP PP PP PPP PP Sbjct: 412 PPPPPSPPLPP--PVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPP 459 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPP-PRXXXXPGXPP 753 PPP P +PPP PP P P PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P P P FSP PP PP P PPP PP Sbjct: 416 PSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPP 468 >At1g63830.2 68414.m07224 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains 1 predicted transmembrane domain Length = 232 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 F PPP P PPP G PP PG P Sbjct: 198 FDQPVPPPVGYPQSYPPPAQGY-PPASYPPPGYP 230 >At1g63830.1 68414.m07223 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains 1 predicted transmembrane domain Length = 232 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 649 FSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 F PPP P PPP G PP PG P Sbjct: 198 FDQPVPPPVGYPQSYPPPAQGY-PPASYPPPGYP 230 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 3/62 (4%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*---KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGX 747 P + P P P P P +SP P PP PPP PPP P Sbjct: 546 PSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPP-- 603 Query: 748 PP 753 PP Sbjct: 604 PP 605 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P P + P P P P P PPP PP PPP PPP Sbjct: 562 PVYSSPPPPHVYSPPPPVASPPP----------PSPPPPVHSPP--PPPVFSPPPPVFSP 609 Query: 736 XPGXP 750 P P Sbjct: 610 PPPSP 614 Score = 29.1 bits (62), Expect = 4.7 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXP---PPXXXPPQIPPPXXGXPPPR 726 P + P P P P P FSP P PP P PPP PPP Sbjct: 569 PPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 Query: 727 XXXXPGXPP 753 P PP Sbjct: 629 VYSPP--PP 635 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +1 Query: 616 PNP*KGPGWXGFSPRXPPPXXXPP----QIPPPXXGXPPPRXXXXP 741 P P P FSP P P PP PPP PPP P Sbjct: 596 PPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P+ PP P +PPP PPP P P Sbjct: 865 PQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVP 897 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXP 741 P K + P P + P P K P P P P Q PPP PPP P Sbjct: 71 PIKKYPPP-PYEHP-PVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPP 123 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 631 GPGWXGFSPRXPPPXXXPP--QIPPPXXGXPPPRXXXXP 741 GP + P+ PP PP Q PPP PPP P Sbjct: 46 GPKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPP 84 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 658 RXPPPXXXPPQIPPPXXGXPPPR 726 R PPP PP PPP PPPR Sbjct: 23 RAPPPQPPPP--PPPPPPPPPPR 43 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 7/31 (22%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXG-------XPPPR 726 P+ PPP PP PPP G PPPR Sbjct: 27 PQPPPPPPPPPPPPPPRLGPRLRLRLLPPPR 57 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PP++ PPP+ P PP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPP 37 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXX 735 P++ P P P P P P PP PP P P PPP Sbjct: 14 PSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPS-PYPHPHPPPPSPYP 72 Query: 736 XPGXPP 753 P PP Sbjct: 73 HPHQPP 78 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPG 744 P P P P Q PPP PPP PG Sbjct: 65 PPPPSPYPHPHQPPPPPHVLPPPPPTPAPG 94 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 610 KXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 K P PG + PPP PPQ PP PPP Sbjct: 5 KYAYPYPAPG--NYPQGPPPPVGVPPQYYPPPPPPPPP 40 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +1 Query: 640 WXGFSPRXPPPXXXPPQIPPPXXGXPPP 723 W P PPP P +PPP P P Sbjct: 157 WSSDPPLPPPPPPYPSPLPPPPSPSPTP 184 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +1 Query: 595 PXGPXKXPNP*KGPG--WXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P P+P GP P P P PP P P G P P P Sbjct: 173 PLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSP 226 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P P PPP+P P P P P PP Sbjct: 52 PVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPP 84 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 29.9 bits (64), Expect = 2.7 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 2/68 (2%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPP--QIPPPXXGXPPPRX 729 PTN P P NP P S P PP +IPPP P P Sbjct: 144 PTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPA 203 Query: 730 XXXPGXPP 753 P PP Sbjct: 204 SERPSTPP 211 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/62 (30%), Positives = 22/62 (35%), Gaps = 3/62 (4%) Frame = +1 Query: 577 PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIP---PPXXGXPPPRXXXXPGX 747 P P P P+P P PPP PP +P PP PPP+ Sbjct: 128 PPTEAPPTTPITSPSPPTNP---------PPPPESPPSLPAPDPPSNPLPPPKLVPPSHS 178 Query: 748 PP 753 PP Sbjct: 179 PP 180 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PP P PPP PPP P P Sbjct: 105 PTEAPPPANPVSSPPPESSPPPPPPTEAPPTTP 137 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PPP PP PP G PP G PP Sbjct: 46 PPPPPPHGYPPVAYPPHGGY-PPAGYPPAGYPP 77 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 655 PRXPP-PXXXPPQIPPPXXGXPP--PRXXXXPGXPP 753 P PP P PP +PPP P P PG PP Sbjct: 337 PVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPP 372 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPP--PRXXXXPGXPP 753 P PPP PP +PP G P PR PP Sbjct: 33 PYTPPPPQLPPPLPPSSYGLSPTEPRVFTFFNIPP 67 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P PP PP PPP PP + PP Sbjct: 110 PHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPP 142 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 29.5 bits (63), Expect = 3.5 Identities = 20/68 (29%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSP---RXPPPXXXPPQIPPPXXGXPPPR 726 P P + P P K P P P + P + PPP PPP PPP Sbjct: 48 PVKSPPPPYEYKSPPPPVKSPPP---PYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPY 104 Query: 727 XXXXPGXP 750 P P Sbjct: 105 YYHSPPPP 112 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSP---RXPPPXXXPPQIPPPXXGXPPPR 726 P P P P K P P P + P + PPP PPP PPP Sbjct: 96 PVKSPPPPYYYHSPPPPVKSPPP---PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 152 Query: 727 XXXXPGXP 750 P P Sbjct: 153 YYHSPPPP 160 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSP---RXPPPXXXPPQIPPPXXGXPPPR 726 P P P P K P P P + P + PPP PPP PPP Sbjct: 112 PVKSPPPPYYYHSPPPPVKSPPP---PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 168 Query: 727 XXXXPGXP 750 P P Sbjct: 169 YYHSPPPP 176 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSP---RXPPPXXXPPQIPPPXXGXPPPR 726 P P P P K P P P + P + PPP PPP PPP Sbjct: 128 PVKSPPPPYYYHSPPPPVKSPPP---PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 184 Query: 727 XXXXPGXP 750 P P Sbjct: 185 LYSSPPPP 192 Score = 28.3 bits (60), Expect = 8.2 Identities = 20/68 (29%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSP---RXPPPXXXPPQIPPPXXGXPPPR 726 P P P P K P P P + P + PPP PPP PPP Sbjct: 80 PVKSPPPPYVYSSPPPPVKSPPP---PYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 136 Query: 727 XXXXPGXP 750 P P Sbjct: 137 YYHSPPPP 144 Score = 28.3 bits (60), Expect = 8.2 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 3/69 (4%) Frame = +1 Query: 556 PTNXGXTPXKXFXPXGPXKXPNP*KGPGWXGFSP---RXPPPXXXPPQIPPPXXGXPPPR 726 P P P P K P P P + P + PPP PPP PPP Sbjct: 144 PVKSPPPPYYYHSPPPPVKSPPP---PYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPPV 200 Query: 727 XXXXPGXPP 753 PP Sbjct: 201 YIYASPPPP 209 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 722 GGGXPXXGGGIXGGLXXGGGXLG 654 GGG GGGI GG+ GGG G Sbjct: 162 GGGGIGGGGGIGGGVIIGGGGGG 184 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P+P + PPP P PPP PP P PP Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPP 97 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P + P P PR PPP PP PPP P P Sbjct: 670 PARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPP 718 >At3g52950.1 68416.m05837 CBS domain-containing protein / octicosapeptide/Phox/Bemp1 (PB1) domain-containing protein contains Pfam profiles: PF00571 CBS domain, PF00564: PB1 domain Length = 556 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/52 (28%), Positives = 18/52 (34%) Frame = -3 Query: 515 PXRKTGAXNXXTGXRKRXPKXKPXXPGGGGVXXXXKXPPXPPPXPEKXKXXN 360 P +G + T R P KP G V P PPP P+ N Sbjct: 8 PSSTSGRRSNSTVRRGPPPSKKPVQSENGSVNGNTSKPNSPPPQPQSQAPSN 59 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 P PPP PP P P P ST PP P Sbjct: 32 PIDSPPPSPPSPPPLPKLPF-SSTTPPSSSDP 62 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/53 (30%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRX-PPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P P P P +P PPP P +P P PP P P Sbjct: 93 PTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 145 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/53 (30%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRX-PPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P P P P +P PPP P +P P PP P P Sbjct: 111 PTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 163 Score = 28.3 bits (60), Expect = 8.2 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P P P P SP P P P PPP PP P P Sbjct: 147 PTPPVSPPPPTPTPSVP--SPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPP 196 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 851 PXXCXXPXXXPPPLPPXXPXXPXXPTPXSTHPPXXXXPXS 970 P P PP PP P P P PP P S Sbjct: 30 PGFSAIPPVVPPSFPPPMAPIPMMPHPPVARPPTFRPPVS 69 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 869 PXXXPPPLPPXXPXXPXXPTPXSTHPP 949 P PPP P P P P P PP Sbjct: 114 PPVSPPPAPTSPPPTPASPPPAPASPP 140 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPP---PXXGXPPPRXXXXPGXPP 753 SP PPP PPQ PP P PP P PP Sbjct: 92 SPATPPPQ--PPQSPPASAPTVSPPPVSPPPAPTSPP 126 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 881 PPPLPPXXPXXPXXPTPXSTHPPXXXXP 964 PPP P P P P P PP P Sbjct: 132 PPPAPASPPPAPASPPPAPVSPPPVQAP 159 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P P PP PPP PPP P P Sbjct: 105 PASAPTVSPPPVSPPPAPTSPPPTPASPPPAP 136 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 +P PPP P PPP PPP P P Sbjct: 121 APTSPPPT---PASPPPAPASPPPAPASPPPAP 150 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXG 868 G GGW+ VG G G GG GGG G Sbjct: 67 GFGAGGGWIGGSVGGFG-GGIGGGFGGGGFGG 97 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 P PPP P PPP PPP+ P P Sbjct: 52 PPSPPPPSCTPSPPPP--SPPPPKKSSCPPSP 81 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 28.7 bits (61), Expect = 6.2 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 589 FXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQI--PPPXXGXPPPR 726 F P P P P +SP PPP PP I PPP PPP+ Sbjct: 66 FPPPPPIYSPPPPPIYPPPIYSP--PPPPIYPPPIYSPPPTPISPPPK 111 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/69 (28%), Positives = 26/69 (37%), Gaps = 7/69 (10%) Frame = +1 Query: 568 GXTPXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXG-------XPPPR 726 G +P P P + +P + P + PPP PP PPP PPP+ Sbjct: 275 GLSPPSLQLPQLPNQF-SPQQEPYFPPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQ 333 Query: 727 XXXXPGXPP 753 P PP Sbjct: 334 QPQYPQQPP 342 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPP 723 SP PPP PP+ PP PPP Sbjct: 156 SPDLPPPHF-PPEFPPETPTTPPP 178 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 28.7 bits (61), Expect = 6.2 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +1 Query: 589 FXPXGPXKXPN-P*KGPGWXGFSPRXPPP--XXXPPQIPPPXXGXPPPRXXXXPGXPP 753 F P P PN P G G P PPP PP PP PPP G P Sbjct: 210 FKPTKPE--PNKPQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPPPPMANNGFRP 265 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 618 KPVKRARLXGFFPKXPPPXXQXSXNPPPXXGXATP 722 KP G P PPP Q PPP G P Sbjct: 219 KPQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPP 253 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 655 PRXPPPXXXPPQIPPPXXGXPPPR 726 P PPP PP PPP P R Sbjct: 263 PNRPPPPSSPPPPPPPPPTPPTSR 286 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXP 750 SP PP PPP PPP P P Sbjct: 43 SPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPP 75 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P G P P G G R PPP P G PPP+ P PP Sbjct: 161 PPGQMLPPPPFGGQGPP--MGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPP 211 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 28.3 bits (60), Expect = 8.2 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 595 PXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P G P P G G R PPP P G PPP+ P PP Sbjct: 161 PPGQMLPPPPFGGQGPP--MGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPP 211 >At4g19200.1 68417.m02833 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 179 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 637 GWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 G+ G P PPQ PP G PP G PP Sbjct: 18 GFPGGGHYPPAQGGYPPQGYPPQQGYPPAGGYPPAGYPP 56 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 963 GXXXXGGWVEXGVGXXGXXGXXGGSGGGXXXG 868 G GG V GVG G G G+GGG G Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGG 143 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 28.3 bits (60), Expect = 8.2 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = +1 Query: 556 PTNXGXT--PXKXFXPXGPXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPP--PXXGXPPP 723 PTN T P P +P P SP PP PP +PP P PP Sbjct: 19 PTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSP--PPSSPLPPSLPPPSPPGSLTPP 76 Query: 724 RXXXXPGXP 750 P P Sbjct: 77 LPQPSPSAP 85 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 SP PPP PPQ PP P + P PP Sbjct: 58 SPSPPPPP--PPQWGPPSPHYPQGQPYSSPAYPP 89 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 652 SPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 SP PPP PPQ PP P + P PP Sbjct: 58 SPSPPPPP--PPQWGPPSPHYPQGQPYSSPAYPP 89 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 28.3 bits (60), Expect = 8.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 664 PPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 PPP PPP PPP P PP Sbjct: 45 PPPYVYNSPSPPPYVYKPPPYIYSSPPPPP 74 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +1 Query: 604 PXKXPNP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPRXXXXPGXPP 753 P P K P + SP PP P PP PPP PP Sbjct: 53 PSPPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPP 102 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 619 NP*KGPGWXGFSPRXPPPXXXPPQIPPPXXGXPPPR 726 NP P +SP PP P PPP PPPR Sbjct: 7 NPTYDPWNSPYSPHLHPPSAPLPP-PPPLPPPPPPR 41 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,571,227 Number of Sequences: 28952 Number of extensions: 245814 Number of successful extensions: 5972 Number of sequences better than 10.0: 89 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4169 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2363283864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -