BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F23 (971 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 44 2e-04 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 44 2e-04 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 41 0.001 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 41 0.001 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 41 0.002 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 41 0.002 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 41 0.002 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 41 0.002 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 39 0.007 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 39 0.007 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 38 0.009 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 38 0.012 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 38 0.012 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 38 0.016 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 38 0.016 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 37 0.021 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 37 0.028 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 36 0.037 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 36 0.066 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 36 0.066 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 36 0.066 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 36 0.066 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 35 0.087 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 35 0.087 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 34 0.15 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 34 0.15 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 34 0.20 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 33 0.35 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 33 0.35 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 33 0.35 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 33 0.46 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 33 0.46 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 33 0.46 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 33 0.46 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 32 0.61 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 32 0.61 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 32 0.61 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 32 0.61 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 32 0.61 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 32 0.61 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 32 0.61 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 32 0.81 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 32 0.81 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 32 0.81 SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) 32 0.81 SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) 32 0.81 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 32 0.81 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 32 0.81 SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 32 0.81 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 32 0.81 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 31 1.1 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 1.1 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 31 1.4 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 31 1.4 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 31 1.4 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.4 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 31 1.4 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 31 1.9 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 31 1.9 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 31 1.9 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 31 1.9 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) 31 1.9 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 30 2.5 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 30 2.5 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 30 2.5 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 30 3.3 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 30 3.3 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 30 3.3 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 30 3.3 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 30 3.3 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 30 3.3 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 30 3.3 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 30 3.3 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 30 3.3 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 25 3.6 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 29 4.3 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 29 4.3 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 29 4.3 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 4.3 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_12281| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 29 5.7 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 29 5.7 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 29 5.7 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 29 5.7 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 29 5.7 SB_36777| Best HMM Match : VWA (HMM E-Value=0) 29 5.7 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 29 5.7 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 29 5.7 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 28 9.9 SB_35620| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 28 9.9 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 28 9.9 SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 28 9.9 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 28 9.9 SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 28 9.9 SB_16709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P PP PP PPP PP PPPPP Sbjct: 462 QAPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPP 487 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPPP 493 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPPP 494 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P PP PP PPP PP PP PP Sbjct: 462 QAPPPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP P PPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPP 491 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPP 492 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP PP PPP PP PP P Sbjct: 475 PPPPPPPPPPPPPFPPPPPPTP 496 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P PP PP PPP PP PPPPP Sbjct: 394 QPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P PP PP PPP PP PPPPP Sbjct: 388 SPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 42.3 bits (95), Expect = 6e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPP 415 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPP 393 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPP 424 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPPP 425 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPP 428 Score = 41.9 bits (94), Expect = 8e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 410 PPPPPPPPPAPPPPPPPPPPPPP 432 Score = 41.1 bits (92), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP PP PPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPP 386 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP P PPP PP PPPPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPP 409 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP P PPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPP 397 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/24 (66%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPPXPP-PXPPXXPPPPP 966 PS PP PP PP P PP PPPPP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP PP PPPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPP 408 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P PP PP PPP PP PP PP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPP 390 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P PP P PPP PP PPPPP Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P +++ ++ S PP PP PPP P PPPPP Sbjct: 350 PRAIVTDISAGINMSPPPPPPPPPPPPSPPPPPPPP 385 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PP PP PPPPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPP 404 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P P PP PPPPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPP 405 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAP 420 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PP PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPP 421 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP P PPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPP 422 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPP 423 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP P PPPPP Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPPP 426 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP P PPPPP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPP 427 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PP PP PPPPP Sbjct: 407 PPPPPPPPPPPPAPPPPPPPPPP 429 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P P PP PPPPP Sbjct: 408 PPPPPPPPPPPAPPPPPPPPPPP 430 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PP PP PPPPP Sbjct: 409 PPPPPPPPPPAPPPPPPPPPPPP 431 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +1 Query: 871 LSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 +S + P PP PP P P PP PPPP Sbjct: 357 ISAGINMSPPPPPPPPPPPPSPPPPPPPPPP 387 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP PP P PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPP 391 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP PP PPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPP 392 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPP-XXPPPPP 966 P PP PP PPP PP PPP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQP 395 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPPXA 970 P PP P P P P PPPP A Sbjct: 399 PPPPPPPPPPPPPPPPPPPPA 419 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPPXA 970 P PP P P P P PPPP A Sbjct: 413 PPPPPPAPPPPPPPPPPPPPA 433 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 41.1 bits (92), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP PP PPPPP Sbjct: 64 PPTLPPPPPPPPPPLPPPPP 83 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P P PP PPP PP PPPP G Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPPSG 85 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 41.1 bits (92), Expect = 0.001 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP PP PPPPP Sbjct: 288 PPTLPPPPPPPPPPLPPPPP 307 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P P PP PPP PP PPPP G Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPPSG 309 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +1 Query: 865 KVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPPG 969 K L S + PP P PPP PP PPPPPG Sbjct: 60 KKLEEAKSMAAATPPPLCAPPPPPPPPPPPPPPPG 94 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPP 960 PP PP PPP PP P Sbjct: 81 PPPPPPPPPPPPPGAKKP 98 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP P P P Sbjct: 79 PPPPPPPPPPPPPPPGAKKPDDP 101 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +1 Query: 865 KVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPPG 969 K L S + PP P PPP PP PPPPPG Sbjct: 261 KKLEEAKSMAAATPPPLCAPPPPPPPPPPPPPPPG 295 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPP 960 PP PP PPP PP P Sbjct: 282 PPPPPPPPPPPPPGAKKP 299 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP P P P Sbjct: 280 PPPPPPPPPPPPPPPGAKKPDDP 302 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P +S Q + K P P PPP PP PPPPP Sbjct: 1290 PHPNISGQKANNKEQIQPPESPPPPPPPPPPPPPPP 1325 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P PP PP PPP PP PP P Sbjct: 1306 QPPESPPPPPPPPPPPPPPPLPPTP 1330 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 S TS + + PP PP PPP PP PPPP Sbjct: 193 SHPTSPSQITQPPPPPPRPPPSPPPPPPPP 222 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P P PP PPPPP Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPP 234 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P PP PP PPP PP P PP Sbjct: 203 QPPPPPPRPPPSPPPPPPPPSPSPP 227 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPPPXP---PXXPPPPP 966 P PP PP PPP P P PPPPP Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP PP PP PPPPP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPP 220 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +1 Query: 907 PPXXPPXP-PPXPPXXPPPPP 966 PP PP P PP PP PPP P Sbjct: 217 PPPPPPSPSPPRPPPPPPPSP 237 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P PP PPP PP PP P Sbjct: 219 PPPPSPSPPRPPPPPPPSPPRP 240 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PP PP PP PP Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSPP 238 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P PP P PP PP PP P Sbjct: 214 SPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPP-PXPPXXPPPPP 966 S P PP PP PP P P PPP Sbjct: 223 SPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPP 963 +P PP PP PPP PP PPPP Sbjct: 863 RPRRPPPPPPPPPPPPPPPPPPP 885 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 ++P P PP PPP PP PPPPP Sbjct: 858 RRPRPRPRRPPPPPPPPPPPPPPPP 882 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPP 960 ++P PP PP PPP PP PPP Sbjct: 865 RRPPPPPPPPPPPPPPPP--PPP 885 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 914 PPXPXPXPXXPXXPPPPXA 970 PP P P P P PPPP A Sbjct: 868 PPPPPPPPPPPPPPPPPPA 886 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXP--PPPP 966 QT P PP PP PPP PP P PPPP Sbjct: 679 QTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP P PPPPP Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPP 710 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP P PPPPP Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPP 711 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPP 957 P PP P PPP PP PP Sbjct: 696 PPPPPPQPSTPPPPPPSTPP 715 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P PP PP P Sbjct: 692 PPPPPPPPPPQPSTPPPPPPSTP 714 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P PP P PP Sbjct: 693 PPPPPPPPPQPSTPPPPPPSTPP 715 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG GG GG GF Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGGF 366 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG+ G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGG 362 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEG 897 P GG G GG GGG GG GG G Sbjct: 335 PRGGSGRGGGGGGGGGGGGGGGGG 358 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GGG GG GG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGG 359 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGK 903 GGGGG GG GGG G G+ Sbjct: 351 GGGGGGGGGRGGGGGFSSRGR 371 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG GG GG GF Sbjct: 96 GGGGGFGGGGGGGFGGGGGGGGGF 119 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 103 GGGGGGFGGGGGGGGGFGGGGGG 125 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFG 110 Score = 35.1 bits (77), Expect = 0.087 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG G GG GF Sbjct: 104 GGGGGFGGGGGGGGGFGGGGGGGF 127 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGK 903 GGGGG GG GGG GG G + Sbjct: 110 GGGGGGGGGFGGGGGGGFGSR 130 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG GG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGG 106 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGG 114 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GGG GG GG G Sbjct: 102 GGGGGGGFGGGGGGGGGFGGGGG 124 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG GG G Sbjct: 106 GGGFGGGGGGGGGFGGGGGGGFG 128 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG GG GG G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGG 115 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG +G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDG 86 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GGG GG GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGG 81 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GGG GG GG Sbjct: 63 GGGGGGGGGGGGGGGGGGGG 82 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G GG +G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDG 93 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGG 83 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G G Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGG 89 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 93 GGGGGGGGDGGGGGGGGGGGVG 114 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG GG G+ F Sbjct: 95 GGGGGGDGGGGGGGGGGGVGRARF 118 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGG 90 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 88 GGGGDGGGGGGGGDGGGGGGGGG 110 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG G GGG GG GG Sbjct: 79 GGGGGDDGDGGGGDGGGGGG 98 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG G GGG GG GG Sbjct: 93 GGGGGGGGDGGGGGGGGGGG 112 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GGG G GG G Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGG 100 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG G GG G Sbjct: 86 GDGGGGDGGGGGGGGDGGGGGGG 108 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG + G Sbjct: 97 GGGGDGGGGGGGGGGGVGRARFG 119 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 38.3 bits (85), Expect = 0.009 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP PPP PP PPPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 38.3 bits (85), Expect = 0.009 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPP 966 P PP PPP PP PPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP PPP PP PPPPP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPP 115 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPP 960 P PP PP PPP PP PPP Sbjct: 102 PPPPPPPPPPPPPPPP--PPP 120 Score = 27.1 bits (57), Expect(2) = 1.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 919 PPXPPPXPPXXPPP 960 PP PPP P PPP Sbjct: 168 PPGPPPAPMPAPPP 181 Score = 26.2 bits (55), Expect(2) = 5.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPP 957 P PP PPP P PP Sbjct: 136 PAPPPPPPPPPAPCMPP 152 Score = 22.6 bits (46), Expect(2) = 1.4 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPP 945 P+ PP PP P P P Sbjct: 136 PAPPPPPPPPPAPCMP 151 Score = 21.4 bits (43), Expect(2) = 5.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 931 PPXPPXXPPPPP 966 PP PP P P P Sbjct: 168 PPGPPPAPMPAP 179 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG +G Sbjct: 146 GGGGGGGGGGGGGGGGGGGGGDG 168 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGG 154 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGG 155 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGG 156 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGG 157 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGG 158 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGG 159 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGG 160 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGG 161 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGG 162 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGG 163 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGG 164 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGG 165 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGGG 166 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGGGG GG GGG GG G E Sbjct: 149 GGGGGGGGGGGGGGGGGGDGDE 170 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGGGG GG GGG GG G ++ Sbjct: 150 GGGGGGGGGGGGGGGGGDGDED 171 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G +G Sbjct: 152 GGGGGGGGGGGGGGGDGDEDDDG 174 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG +G Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGDG 79 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGG 76 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGG 77 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGGGG GG GGG GG G + Sbjct: 60 GGGGGGGGGGGGGGGGGGDGDD 81 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG +G Sbjct: 62 GGGGGGGGGGGGGGGGDGDDDDG 84 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGGGG GG GGG G G + Sbjct: 65 GGGGGGGGGGGGGDGDDDDGDD 86 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP P PPPPP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPP 1178 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +1 Query: 892 QKPSFPPXXPPXPP--PXPPXXPPPPP 966 Q P PP PP PP P PP PPPPP Sbjct: 1155 QIPPPPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP P PPP PP PPPP Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPPP 1184 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P PP PPPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP PP PPP P Sbjct: 1164 PPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.1 bits (77), Expect = 0.087 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 4/27 (14%) Frame = +1 Query: 898 PSFPPXXPPXP----PPXPPXXPPPPP 966 P PP PP P PP PP PPPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP--PXPPXXPPPPP 966 P +++ + + + PP PP PP P PP PPPPP Sbjct: 13 PDDLINTLSEAEAAANPPEAPPLPPFAPLPPPVPPPPP 50 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +1 Query: 898 PSFPPXXPPX-PPPXPPXXPPPPPG 969 P+ PP PP PP PP PPPPPG Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPG 326 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP PPPPP Sbjct: 316 PPPPPPPPPPGDGGAPPPPP 335 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPP 966 S P PP PP P PPPPP Sbjct: 300 SAPAPPPPPPPGGAPPPPPPPP 321 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P PPPPP Sbjct: 315 PPPPPPPPPPPGDGGAPPPPPPP 337 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PPP PP PPPPP Sbjct: 190 PPSGGPPPPPPPPPPPPPPP 209 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P PP PPP PP PPPP Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPP 209 Score = 35.1 bits (77), Expect = 0.087 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 6/34 (17%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXP------PPPPG 969 S PS P PP PPP PP P PPPPG Sbjct: 187 SPPPPSGGPPPPPPPPPPPPPPPILELAAPPPPG 220 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 9/45 (20%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXX-------PPXPPPXPP--XXPPPPP 966 P + +T Q PS PP PP PPP P PPPPP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 PS P PP PP P PPPPPG Sbjct: 569 PSEDPKPPPPPPEPPEECPPPPPG 592 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPP---XXPPPPP 966 T ++P PP PPP PP PPPPP Sbjct: 549 TPSEEPPPPPPGVDIPPPLPPSEDPKPPPPP 579 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P PP PP PP Sbjct: 564 PPPLPPSEDPKPPPPPPEPP 583 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP PP PPPPP Sbjct: 54 PP--PPPPPPPPPPPPPPPP 71 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPP 960 P PP PP PPP PP P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSP 75 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 36.7 bits (81), Expect = 0.028 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 +P+ PP P PPP P PPPPP Sbjct: 222 EPTPPPPAAPAPPPPPAAAPPPPP 245 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP P PP PPPPP Sbjct: 227 PPAAPAPPPPPAAAPPPPPPPPP 249 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P P PPP PPPPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPP 237 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP----PPXPPXXPPPPP 966 P + + + +P + PP P PP PP PPPP Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPP 244 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 36.7 bits (81), Expect = 0.028 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P +PP PP P P PP P PPP Sbjct: 97 PPYPPYPPPPPYPPPPNPPYPPP 119 Score = 35.1 bits (77), Expect = 0.087 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPP 960 P +PP P PPP PP PPP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPP 120 Score = 35.1 bits (77), Expect = 0.087 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP PP PPP P PPPP Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPP 199 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P PP PP PPP PP PPP P Sbjct: 89 SPNPPYPPPPYPPYPPP-PPYPPPPNP 114 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P PP PP PPP P P PPP Sbjct: 143 SPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPP 963 +F P P PPP PP PPPP Sbjct: 87 NFSPNPPYPPPPYPPYPPPPP 107 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P P PP P PPP Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPP 177 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P+ P PP PPP P PPPP Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPP 191 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P +PP PP PP PP PP PP Sbjct: 177 PPYPP--PPNPPYPPPPNPPYPP 197 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP PP PPP PPPP Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPP 128 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP P PPP P PPPP Sbjct: 115 PYPPPPNAPYPPPPNPPYPPPP 136 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP PP PPP PPPP Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPP 207 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP P PPP P PPPP Sbjct: 194 PYPPPPNAPNPPPPNPPYPPPP 215 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP PP PPP PP PP Sbjct: 202 PNPPPPNPPYPPPPNAPNPPYPP 224 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPP--PXPPXXPPPPP 966 P +PP P PP P PP PPPP Sbjct: 159 PLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 914 PPXPXPXPXXPXXPPPPXA 970 PP P P P P PPPP A Sbjct: 104 PPPPYPPPPNPPYPPPPNA 122 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 904 FPPXXPPXPPPXPPXXPPPPP 966 +PP P PPP PP PPP P Sbjct: 174 YPPPPYP-PPPNPPYPPPPNP 193 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P PP PPP P Sbjct: 220 PPYPPPPNAPNPPYPPPPNP 239 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PPP P PPP P Sbjct: 111 PPNPPYPPPPNAPYPPPPNP 130 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPP--XPPXXPPPPP 966 P+ PP P PPP PP PP PP Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPP 189 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PPP P PPP P Sbjct: 190 PPNPPYPPPPNAPNPPPPNP 209 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPP--PXPPXXPPPPP 966 P PP PP P P PP P PPP Sbjct: 182 PPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPPXA 970 P P P P P P PPPP A Sbjct: 118 PPPNAPYPPPPNPPYPPPPNA 138 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPPXA 970 P P P P P P PPPP A Sbjct: 181 PPPNPPYPPPPNPPYPPPPNA 201 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P +PP P P P PP P PPP Sbjct: 193 PPYPPP-PNAPNPPPPNPPYPPP 214 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPPXA 970 P P P P P P PPPP A Sbjct: 197 PPPNAPNPPPPNPPYPPPPNA 217 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPP--PXPPXXPPPPP 966 P PP PP P P PP P PPP Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P +PP P P P PP P PPP Sbjct: 114 PPYPPP-PNAPYPPPPNPPYPPP 135 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPPXA 970 P PP P P P PPPP A Sbjct: 152 PNPPYPPPLYPPPPNPPPPNA 172 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +1 Query: 898 PSFPPXXPPXPP-PXPPXXPPPP 963 P+ P PP PP P PP P PP Sbjct: 199 PNAPNPPPPNPPYPPPPNAPNPP 221 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP PP PPP PP P Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSP 144 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPPXP-PPXPPXXPPPPP 966 PS PP P PP PP PPPP Sbjct: 142 PSPNAPYPPPPNPPYPPPLYPPPP 165 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPP 960 P PP PP PP PP PPP Sbjct: 151 PPNPPYPPPLYPP-PPNPPPP 170 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +1 Query: 898 PSFPPXXPPXPP-PXPPXXPPPP 963 P+ P PP PP P PP P PP Sbjct: 120 PNAPYPPPPNPPYPPPPNAPYPP 142 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 T+ P PP P PPP P PPPPP Sbjct: 361 TNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 T+ P PP P PPP P PPPPP Sbjct: 371 TNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 T+ P PP P PPP P PPPPP Sbjct: 381 TNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP PPP PP PPPP Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPP 377 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP PPP PPPPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPP 369 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP PPP PPPPP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPP 389 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP PPP PPPPP Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPP 399 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP PPP PPPPP Sbjct: 387 PPPPTNGPPPPPPPTNGPPPPPP 409 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS P PP PPP P PP PP Sbjct: 72 PSTPA--PPPPPPPPSSGPPLPP 92 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PP P PPPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPP 368 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P PP P PP PPPPP Sbjct: 370 PTNKPPPPPPPTNGPP--PPPPP 390 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P PP P PP PPPPP Sbjct: 380 PTNGPPPPPPPTNGPP--PPPPP 400 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P PP P PP PPPPP Sbjct: 390 PTNGPPPPPPPTNGPP--PPPPP 410 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 681 GGGGGGGGGGGGGGGGGGGGGAG 703 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 682 GGGGGGGGGGGGGGGGGGGGAGG 704 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGG 684 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGG 685 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGG 686 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGG 687 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGG 688 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGG 689 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGG 690 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGG 691 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGG 692 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGG 693 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGG 694 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGG 695 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGG 696 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGG 697 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGG 698 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGGG 699 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGG 700 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 679 GGGGGGGGGGGGGGGGGGGGGGG 701 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G G Sbjct: 684 GGGGGGGGGGGGGGGGGGAGGAG 706 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G G Sbjct: 686 GGGGGGGGGGGGGGGGAGGAGAG 708 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGG 682 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G G G Sbjct: 688 GGGGGGGGGGGGGGAGGAGAGAG 710 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG G G +G Sbjct: 692 GGGGGGGGGGAGGAGAGAGDDDG 714 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGGGG GG G G G G + Sbjct: 691 GGGGGGGGGGGAGGAGAGAGDD 712 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGG 801 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 786 GGGGGGGGGGGGGGGGGDGGGYG 808 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGG 869 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGG 870 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGG 871 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 850 GGGGGGGGGGGGGGGGGGGGGGG 872 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 851 GGGGGGGGGGGGGGGGGGGGGGG 873 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 852 GGGGGGGGGGGGGGGGGGGGGGG 874 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 853 GGGGGGGGGGGGGGGGGGGGGGG 875 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 854 GGGGGGGGGGGGGGGGGGGGGGG 876 Score = 35.9 bits (79), Expect = 0.050 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG GG G GF Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGF 836 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G +G Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDG 812 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGG 805 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGG 791 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGG 802 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGG 816 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGG 867 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG GG GGG GG GG Sbjct: 810 GDGGGGGGGGGGGGGGDGGG 829 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGF 894 GGGG GG GGG GG G G+ Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGY 807 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGGGG GG GGG GG +E Sbjct: 861 GGGGGGGGGGGGGGGGVIKNEE 882 Score = 31.9 bits (69), Expect = 0.81 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 965 GGGGGXXG-GXGGGXGGXXGGKEG 897 GGGGG G G GGG GG GG G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGG 793 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G G +G Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDG 839 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GGG GG GG G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGG 799 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GGG GG GG G Sbjct: 802 GDGGGYGDGDGGGGGGGGGGGGG 824 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GGG GG GG G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGG 859 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 5/28 (17%) Frame = -1 Query: 965 GGGGGXXGGXG-----GGXGGXXGGKEG 897 GGGGG GG G GG GG GG G Sbjct: 798 GGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP PP PPP P PPPPP Sbjct: 78 PAAPPAAPPPPPPLP--APPPPP 98 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PP PP P PPP Sbjct: 77 PPAAPPAAPPPPPPLPAPPP 96 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPP 963 S PP PP PP P PPPP Sbjct: 48 SSPPPPPPSPPAAAPAAPPPP 68 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPPXP-PPXPPXXPPPPP 966 P+ PP PP P PP PP P P P Sbjct: 82 PAAPPPPPPLPAPPPPPAQPAPQP 105 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 905 SPXPPXPXPXPXXPXXPPPPXA 970 SP PP P P P PPPP A Sbjct: 49 SPPPPPPSPPAAAPAAPPPPAA 70 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P PP P P PPPPP Sbjct: 68 PAAAPAAPPPPAAPPAAPPPPPP 90 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPP--PPP 966 P F PP PPP PP P PPP Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPP 67 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPP--XPPXXPPPPP 966 P P P PPP PP PPPPP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP P PPP P PPP Sbjct: 86 PPPPPLPAPPPPPAQPAPQPPP 107 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP P PPP Sbjct: 85 PPPPPPLPAPPPPPAQPAPQPPP 107 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPPG 969 T P PP P PP P PPPPPG Sbjct: 784 TKPATPRVPPNIPSRPPGARPTPPPPPPG 812 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P K + + PS PP P PPP PP P P Sbjct: 783 PTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKP 817 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GGG GG GG Sbjct: 85 GGGGGGGGGVGGGGGGGGGG 104 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG GG G Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGG 103 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG ++G Sbjct: 89 GGGGGVGGGGGGGGGGGDDCEDG 111 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGGGG G GGG GG GG + Sbjct: 86 GGGGGGGGVGGGGGGGGGGGDD 107 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGGKEG 897 GGG GG GGG GG GG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGG 100 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG G GG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGG 101 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG G GG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGG 102 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 35.5 bits (78), Expect = 0.066 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 7/30 (23%) Frame = +1 Query: 901 SFPPXXPPXPPPX-------PPXXPPPPPG 969 S PP PP PPP PP PPPPPG Sbjct: 692 SVPPPPPPPPPPLLSGTLPMPPPPPPPPPG 721 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPP 966 P PP PPP PPPPP Sbjct: 712 PPPPPPPPPGCAGLPPPPP 730 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPP 966 P PP PPP PPPPP Sbjct: 740 PPPPPPPPPGCAGLPPPPP 758 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +1 Query: 910 PXXPPXPPPX----PPXXPPPPPG 969 P PP P P PP PPPPPG Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPG 749 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PP PPPPP Sbjct: 740 PPPPPPPPPGCAGLPPPPPP 759 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GGG GG GG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 31.9 bits (69), Expect = 0.81 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G Sbjct: 324 GGGGGGGGGGGGGGGGDXXXXNG 346 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGFCXE 885 GGGGG GG GG GG G G C E Sbjct: 339 GGGGGVTGGGGGATGGGGGPGSGGCGE 365 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG G G Sbjct: 248 GGGGGATGGGGGATGGGGGATGG 270 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG G G Sbjct: 255 GGGGGATGGGGGATGGGGGATGG 277 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG G G Sbjct: 262 GGGGGATGGGGGATGGGGGATGG 284 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG G G Sbjct: 269 GGGGGATGGGGGATGGGGGATGG 291 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG G G Sbjct: 276 GGGGGATGGGGGATGGGGGATGG 298 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG G G Sbjct: 283 GGGGGATGGGGGATGGGGGATGG 305 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXG 909 GGGGG GG GG GG G Sbjct: 290 GGGGGATGGGGGATGGGGG 308 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 297 GGGGGATGG-GGGATGVGGGATG 318 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GG GG G G Sbjct: 242 GGGGATGGGGGATGGGGGATGG 263 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG G GG G Sbjct: 290 GGGGGATGGGGGATGGGGGATG 311 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GG GG G G Sbjct: 304 GGGGGATGVGGGATGGGGGATGG 326 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GG GG G G Sbjct: 311 GVGGGATGGGGGATGGGVGATGG 333 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG G GG G Sbjct: 332 GGGGGATGGGGGVTGGGGGATG 353 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP P P P PP PPPPP Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPP 928 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 TS P P P PPP PP PPPPP Sbjct: 955 TSALPPPIPATQVP-PPPLPPLPPPPPP 981 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +1 Query: 895 KPSFPPXXPPXP--PPXPPXXPPPPP 966 KP+ P PP P P PP PPPPP Sbjct: 902 KPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 Q S +P+ PP PPP P PPPP Sbjct: 943 QASTTRPTPPPPTSALPPPIPATQVPPPP 971 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P P PPP P P PPP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPP 920 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPP 963 T+ P P P PPP PP PPPP Sbjct: 904 TTPAPPPPLPLAPEPPPPLPP--PPPP 928 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP PP P Sbjct: 969 PPPLPPLPPPPPPVQTTTAP 988 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG+ G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 1005 GGGGGGGGGGGGGRRGGRGGARG 1027 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G +G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDG 63 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G +G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDG 65 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G G +G Sbjct: 45 GGGGGGGGGGGGGGGDGDGDGDG 67 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG GG +G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDG 332 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G +G Sbjct: 314 GGGGGGGGGGGGGDGGGDGDGDG 336 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGG 329 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG +G Sbjct: 308 GGGGGDGGGGGGGGGG--GGGDG 328 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G G +G Sbjct: 318 GGGGGGGGGDGGGDGDGDGDGDG 340 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG G G +G Sbjct: 312 GDGGGGGGGGGGGGGDGGGDGDG 334 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG GG +G Sbjct: 456 GGGDGIDGGDGGGDGGGDGGGDG 478 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG GG GGG GG GG Sbjct: 464 GDGGGDGGGDGGGDGGGDGG 483 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXGGXGGGXG--GXXGGKEG 897 GGG G GG GGG G G GG +G Sbjct: 446 GGGDGGGGGDGGGDGIDGGDGGGDG 470 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPP--PP 966 P+ PP PP PPP P PPP PP Sbjct: 1024 PTEPPTDPPTPPPTEPPTPPPTEPP 1048 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPP--PP 966 P+ PP PP PPP P PPP PP Sbjct: 1032 PTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 + P+ PP PP PP PP PP P Sbjct: 1026 EPPTDPPTPPPTEPPTPPPTEPPTP 1050 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP PP PP PP PP P Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTP 1042 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPPXPPPXP-PXXPPPPP 966 P+ PP PP PP P P PP P Sbjct: 1036 PTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 P P PP PP PP PP Sbjct: 1016 PDPLPTDPPTEPPTDPPTPP 1035 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPP 957 + P+ PP PP PPP P P Sbjct: 1038 EPPTPPPTEPPTPPPTDPPTQP 1059 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PPP PP PPPPP Sbjct: 972 PLPPPPGGSAPPPPPPPPPPPPP 994 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PP PPPPP Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPPP 993 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 5/31 (16%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXX-----PPPPPG 969 + PS P PPP PP PPPPPG Sbjct: 908 ESPSASPPGGSVPPPPPPPGGNAPLPPPPPG 938 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPPG 969 PP PPP PP PPPG Sbjct: 947 PPGGNAPPPPPPPGGSAPPPG 967 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 7/29 (24%) Frame = +1 Query: 901 SFPPXX---PPXPPP----XPPXXPPPPP 966 S PP PP PPP PP PPPPP Sbjct: 962 SAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +1 Query: 874 SXQTSXQKPS----FPPXXPPXPPPXPPXXPPPPP 966 S + KPS PP PP PPP P PPPP Sbjct: 180 SAMAAANKPSPMAGMPPPPPPPPPPGFPGGAPPPP 214 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PP P PPPPP Sbjct: 196 PPPPPPPPPGFPGGAPPPPP 215 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P FP P PPP PP PPPP Sbjct: 204 PGFPGGAP--PPPPPPFGAPPPP 224 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 QT K P PP PP PP PP PP Sbjct: 225 QTPPTKAPTDPPVPPTNPPVPPTNPPAPP 253 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXP--PPPPG 969 P PP PP PP PP P PP PG Sbjct: 235 PPVPPTNPPVPPTNPPAPPTNPPKPG 260 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGK 903 GGGGG GG GGG GG G+ Sbjct: 517 GGGGGGGGGGGGGRGGRGRGR 537 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPPG 969 S P P PPP PP PPP PG Sbjct: 369 SSTPCAPFAPPPPPPPPPPPAPG 391 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP PPP PP P P Sbjct: 372 PCAPFAPPPPPPPPPPPAPGSTP 394 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGGKEG 897 GGG GG GGG GG GG+ G Sbjct: 368 GGGRGGGRGGGRGGFRGGRGG 388 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP P PPPPP Sbjct: 424 PPPPPPPAPLPPPPPP 439 Score = 32.3 bits (70), Expect = 0.61 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPP 963 P PP P P PP PPPP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 32.3 bits (70), Expect = 0.61 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP P PPPPP Sbjct: 425 PPPPPPAPLPPPPPPP 440 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP P P PP PP P Sbjct: 425 PPPPPPAPLPPPPPPPPQP 443 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P PP PPP P Sbjct: 424 PPPPPPPAPLPPPPPPPPQP 443 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXP 954 Q P PP P PPP PP P Sbjct: 423 QPPPPPPPAPLPPPPPPPPQP 443 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PP PP PPPPP Sbjct: 162 PPPQPPPPPLPPPPPP 177 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP PPP PP PPPP Sbjct: 162 PPPQPP-PPPLPP--PPPP 177 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 +KPS PP P PPP P PP P Sbjct: 1045 RKPSPPPSAVPIPPPRKPSPPPSEP 1069 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPP--PXPPXXPPPPP 966 P PP P PP P PP PPPP Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPP 1079 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPP----XXPPPPP 966 +KPS PP P PP PP P PPP Sbjct: 1060 RKPSPPPSEPAPPPRQPPPPSTSQPVPPP 1088 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP PP PP PP P PP Sbjct: 286 PTLPPRYPPSPPRYPPSPPRYPP 308 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXP---PXPPPXPPXXPPPPP 966 P PP P P PP PP PP PP Sbjct: 335 PPSPPRYPSSHPRYPPSPPRYPPSPP 360 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PP P P PP Sbjct: 349 PPSPPRYPPSPPRYPSSHPRYPP 371 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG GG GG GG GG GG G Sbjct: 803 GGAGGSSGGASGGAGGSSGGASG 825 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG GG GG GG G GG G Sbjct: 781 GGAGGSSGGANGGAGSSSGGASG 803 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GG GG GG G Sbjct: 792 GGAGSSSGGASGGAGGSSGGASG 814 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG GG GG GG G GG G Sbjct: 814 GGAGGSSGGASGGAGSSSGGASG 836 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GG G GG G Sbjct: 799 GGASGGAGGSSGGASGGAGGSSG 821 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GG GG GG GG GG Sbjct: 807 GSSGGASGGAGGSSGGASGG 826 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P PP PP PP PPPPPG Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPG 1258 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +1 Query: 898 PSFPPXXPPXP---PPXPPXXPPPPPG 969 P PP PP P PP PP PP PPG Sbjct: 1263 PPQPPFMPPPPRMQPPGPPG-PPGPPG 1288 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 5/27 (18%) Frame = +1 Query: 898 PSFPPXXPPXP-----PPXPPXXPPPP 963 P F PP P PP PP PPPP Sbjct: 1247 PKFMGLPPPPPGMRPMPPQPPFMPPPP 1273 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GGG G GG Sbjct: 3702 GGGGGGYGGGGGGYGDGTGG 3721 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP P PPPPP Sbjct: 195 PPPPPPGPGGIPPPPP 210 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP PPP PPPPP Sbjct: 199 PPGPGGIPPPPPPIRGGVPPPPP 221 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP P PPPPP Sbjct: 363 PPPPPPPPVGGPPPPP 378 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P PP PPPPP Sbjct: 363 PPPPPPPPVGGPP--PPPPP 380 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 +P PP PPP PPPPP Sbjct: 286 QPPPPPSRGAAPPPPSRGAPPPPP 309 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P P PPP PPPPP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPP 319 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPP--XPPXXPPPP 963 T+ P+ PP PP PPP PP PPP Sbjct: 427 TATPPPTPPPTPPPTPPPTTLPPTTQPPP 455 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP PP P PPP Sbjct: 431 PPTPPPTPP--PTPPP 444 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 G GGG G GGG GG GG G+ Sbjct: 314 GRGGGYRSGGGGGYGGGRGGGRGY 337 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G GG+ G Sbjct: 322 GGGGGYGGGRGGGR-GYGGGRGG 343 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 G GGG GG GG G GG+ + Sbjct: 119 GRGGGGYGGGRGGGGSYGGGRRDY 142 >SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) Length = 362 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFCXE 885 GGGG GG G G GG GG C E Sbjct: 154 GGGGRGGGRGHGRGGSGGGGNCTCDE 179 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXG--GXGGGXGGXXGGKEG 897 GGGGG G G GGG GG GG G Sbjct: 471 GGGGGPNGAGGGGGGGGGYSGGASG 495 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEGFC 891 P G GG GG GG GG G + C Sbjct: 476 PNGAGGGGGGGGGYSGGASGSRSNSC 501 >SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -1 Query: 965 GGGGGXXGGXG-GGXGGXXGGKEGFCXE 885 GGGGG GG G GG G GG GF + Sbjct: 187 GGGGGTTGGGGSGGEGTTGGGVSGFAKQ 214 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPP 963 Q+P +P P PPP PP P PP Sbjct: 1650 QQPWYPVFHYPAPPPPPPPAPGPP 1673 >SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) Length = 279 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFCXE 885 GGGG GG G G GG GG C E Sbjct: 71 GGGGRGGGRGHGRGGSGGGGNCTCDE 96 >SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) Length = 532 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFCXE 885 GGGG GG G G GG GG C E Sbjct: 324 GGGGRGGGRGRGRGGSGGGGNCTCDE 349 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGG 906 PGG GG G GGG GG GG Sbjct: 486 PGGFGGGGGASGGGGGGGGGG 506 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFCXE 885 GGGG G GGG GG G G C + Sbjct: 490 GGGGGASGGGGGGGGGGGFSGGACGD 515 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG GG GGG GG GG G Sbjct: 492 GGGASGGGGGGGGGGGFSGGACG 514 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 G GGG G GGG GG GG GF Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGF 66 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GGG GG GG G Sbjct: 61 GGGGGFKSPRGGGRGGGRGGGRG 83 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 32.3 bits (70), Expect = 0.61 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPP 960 P PP PPP PP PPP Sbjct: 355 PQLGPPPPPPPPPPTPPP 372 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P P PP PP PPP P Sbjct: 348 PTTPKTHPQLGPPPPPPPPPPTP 370 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P P PPP PP PPP Sbjct: 351 PKTHPQLGPPPPPPPPPPTPPP 372 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GG GG GG+ G Sbjct: 156 GGGEGGWGGRGGNGGGRGGGEGG 178 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 31.9 bits (69), Expect = 0.81 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXG--GXGGGXGGXXGGKEG 897 GGGGG G G GGG GG GG G Sbjct: 229 GGGGGVWGNGGGGGGGGGYSGGGSG 253 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGG 906 PGG GG G G G GG GG Sbjct: 225 PGGFGGGGGVWGNGGGGGGGG 245 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKE 900 GGGG GG GG GG GG++ Sbjct: 192 GGGGDDGGSDGGGGGNDGGRD 212 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG GG GG GG GG GG +G Sbjct: 181 GGDGGDDGGGSGG-GGDDGGSDG 202 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGG GG GG G GG +G Sbjct: 188 GGGSGGGGDDGGSDGGGGGNDG 209 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 31.9 bits (69), Expect = 0.81 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPP-----XXPPPPP 966 + S ++ + P PP PPP PP PPPPP Sbjct: 647 KASTKEAATPEAGPPPPPPPPPGGQAGGAPPPPP 680 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = +1 Query: 880 QTSXQKPSFPPXXP--PXPPPXPPXX----PPPPPG 969 Q P PP P PPP PP PPPPPG Sbjct: 671 QAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 6/30 (20%) Frame = +1 Query: 898 PSFPPXXPPXPPPX------PPXXPPPPPG 969 P P PP PPP PP PPP PG Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPG 685 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG GG GGG GG GG Sbjct: 34 GYGGGPNGGGGGGGGGGGGG 53 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKE 900 GGG GG GGG GG GG E Sbjct: 36 GGGPNGGGGGGGGGGGGGGDE 56 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GK G Sbjct: 41 GGGGGGGGGGGGGGDEDDSGKNG 63 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GG GG GG G Sbjct: 30 GGGHGYGGGPNGGGGGGGGGGGG 52 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGG GG GGG GG G ++ Sbjct: 36 GGGPNGGGGGGGGGGGGGGDED 57 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG G G Sbjct: 63 GGGGGATGGGGGATGGHGGATGG 85 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG G G Sbjct: 98 GGGGGATGGGGGATGGHGGATGG 120 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG G G Sbjct: 105 GGGGGATGGHGGATGGGVGATGG 127 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG G G Sbjct: 147 GGGGGATGGGGGATGGGGGATGG 169 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXG 909 GGGGG GG GG GG G Sbjct: 70 GGGGGATGGHGGATGGGGG 88 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GG GG G G Sbjct: 84 GGGGGATGDGGGATGGGGGATGG 106 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GG GG G G Sbjct: 91 GDGGGATGGGGGATGGGGGATGG 113 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GG GG G G Sbjct: 119 GGGVGATGGHGGATGGHGGATGG 141 >SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) Length = 229 Score = 31.9 bits (69), Expect = 0.81 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFCXE 885 GGGG GG G G GG GG C E Sbjct: 124 GGGGRGGGRGYGRGGSGGGGNCTCDE 149 >SB_55443| Best HMM Match : Homeobox (HMM E-Value=2.3e-26) Length = 245 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P+FPP P PPP P P PG Sbjct: 195 PAFPPIFPSSPPPEYPGLPVSSPG 218 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P+FPP P PPP P P PG Sbjct: 105 PAFPPSFPSSPPPEYPGLPVSSPG 128 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.81 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -1 Query: 965 GGGGGXXGGXG-GGXGGXXGGKEGFC 891 GGGG GG G GG GG GG G C Sbjct: 5 GGGGDGDGGDGDGGGGGDGGGDGGDC 30 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGFC 891 G G G GG GGG GG G G C Sbjct: 13 GDGDGGGGGDGGGDGGDCDGDGGDC 37 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG G + G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSG 145 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG G G Sbjct: 187 GGGGYGGGGYGGGGGGYGGSGYG 209 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GG G GG G G GG GG+ G Sbjct: 204 GGSGYGGGGGYGGGGYGGGRSG 225 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG G GG G Sbjct: 182 GGGGHGGGGYGGGGYGGGGGGYG 204 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G G GGG GG GG G Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYGG 205 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG-XXGGKEGF 894 G GGG GG GGG GG GG G+ Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGGGGY 214 >SB_14695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P+FPP P PPP P P PG Sbjct: 158 PAFPPSFPSSPPPEYPGLPVSSPG 181 >SB_14693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P+FPP P PPP P P PG Sbjct: 195 PAFPPIFPSSPPPEYPGLPVSSPG 218 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP PP PPPPP Sbjct: 211 PPPPPPPPP--PPPPP 224 >SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) Length = 245 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P+FPP P PPP P P PG Sbjct: 195 PAFPPSFPSSPPPEYPGLPVSSPG 218 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFC 891 GGGG GG G G GG GG EG C Sbjct: 154 GGGGRRGGRGRGGGG--GGGEGDC 175 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPP 963 S+P PP PP PP PPP Sbjct: 520 SYPAPQPPSPPAPPPKPAPPP 540 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P PP PPP P P PP Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPP 544 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P P PPPPP Sbjct: 83 PPPPPPPPASNVPAPPPPPP 102 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PP PPPPP Sbjct: 82 PPPPPPPPPASNVPAPPPPP 101 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 31.1 bits (67), Expect = 1.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 928 PPPXPPXXPPPPP 966 PPP PP PPPPP Sbjct: 2 PPPPPPPGPPPPP 14 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXX--PPPPP 966 S + Q P PP P P PP PPPPP Sbjct: 290 SNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPP 322 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG GG G Sbjct: 76 GGGGGFSGGGGGSMGG--GGLGG 96 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P + TS +P PP P PP PPPPP Sbjct: 250 PPPPMRGPTSGGEPP-PPKNAPPPPKRGSSNPPPPP 284 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPPG 969 PP PPP PP P P G Sbjct: 3 PPPPPPGPPPPPSAPSG 19 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PP P PPP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S + P+ PP PP P PP P PP Sbjct: 229 SPKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEGF 894 P GGGG GG GGG G G G+ Sbjct: 208 PRGGGGGSGGYGGGSYGGYGNYGGY 232 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEG 897 P G GG GG GGG GG GG G Sbjct: 202 PRGRGGPRGG-GGGSGGYGGGSYG 224 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPPXPP-PXPPXXPPPPP 966 P P PP PP PP PPPPP Sbjct: 183 PPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPPXPPPX-PPXXPPPPP 966 P P PP PPP P PP PP Sbjct: 171 PFMAPAAPPAPPPPGAPAAPPAPP 194 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP P PP P PP PP Sbjct: 187 PAAPPAPPFGGPPSAPPPPPAPP 209 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPPG 969 P P PPP PP PPP G Sbjct: 74 PPQPTPPPPRPPTPPPPAEG 93 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 PS PP PP P PP PP P Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRP 874 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP P P PPPPP Sbjct: 868 PSLPPRPRTRPLPPKSDTPPPPP 890 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +1 Query: 892 QKPSFPPXX--PPXPPPXPPXXPPPPP 966 Q P PP PP PPP P PPPP Sbjct: 300 QPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 905 SPXPPXPXPXPXXPXXPPPP 964 +P PP P P P PPPP Sbjct: 310 APPPPPPEPTSELPPPPPPP 329 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 7/27 (25%) Frame = +1 Query: 907 PPXXPP---XPPPXPP----XXPPPPP 966 PP PP PPP PP PPPPP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPPPP 327 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPX---PPPXPPXXPPPPP 966 PP PP PPP PP PPPP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPP 201 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P P PP PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 5/33 (15%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXP-----PPXPPXXPPPP 963 +T+ KP P PP P PP PP P PP Sbjct: 166 ETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPP 198 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +1 Query: 883 TSXQKPSFPPXXP-PXPPPXP--PXXPPPPP 966 T+ PS PP P P PP P P PP PP Sbjct: 325 TAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 6/35 (17%) Frame = +1 Query: 880 QTSXQKPSFP-----PXXPPXPPPXP-PXXPPPPP 966 +T KP P P PP PP P P PP PP Sbjct: 173 ETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPP 207 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 868 VLSXQTSXQKPSFPPXXPP-XPPPXPPXXPPPPP 966 V+ + P+ PP PP PP PP PP P Sbjct: 17 VIDVNSQTDPPTDPPTDPPTDPPTDPPTDPPTDP 50 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPP-XPPPXPPXXPPPPP 966 P+ PP PP PP PP PP P Sbjct: 31 PTDPPTDPPTDPPTDPPTDPPTDP 54 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 P PP PP P PPPPP Sbjct: 421 PGYIPPPPPGFPQFQPPPPP 440 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP P PP P PPPP Sbjct: 320 PAPPPSQAPPPPKTIPSTLPPPP 342 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GGG GG GG +G Sbjct: 89 GGGGGDGDGGGGGDGG--GGGDG 109 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG G GG +G Sbjct: 82 GGGGDGDGGGGGDGDGGGGGDG 103 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG G GG G Sbjct: 89 GGGGGDGDGGGGGDGGGGGDGG 110 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 G GGG GG GG GG GG+ + Sbjct: 210 GRGGGGYGGGRGGGGGYGGGRRDY 233 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG +G Sbjct: 217 GGGRGGGGGYGGGRRDYGGGSKG 239 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +1 Query: 904 FPPXXPPXPPPXPPXXP-PPPPG 969 FPP PP P P P PPPPG Sbjct: 662 FPPPPPPPPGGGVPGPPKPPPPG 684 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GGG GG GG +G Sbjct: 104 GGGGGDGDGGGGGDGG--GGGDG 124 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG G GG +G Sbjct: 97 GGGGDGDGGGGGDGDGGGGGDG 118 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG G GG G Sbjct: 104 GGGGGDGDGGGGGDGGGGGDGG 125 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -1 Query: 968 PGG--GGGXXGGXGGGXGGXXGGKEG 897 PGG GG GG GG GG GG G Sbjct: 418 PGGAFGGSSGGGFGGSSGGSFGGSSG 443 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GGG G GG G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGG 1782 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GGG GG GG G Sbjct: 1797 GMGGGGMAGGGGGMGGGGGGMGG 1819 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 1759 GGGGGGGGMGGG-GGMAGGGGG 1779 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGG 906 GGGG GG GGG GG G Sbjct: 1805 GGGGGMGGGGGGMGGGGEG 1823 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGG G GG GG GG GG Sbjct: 1764 GGGMGGGGGMAGGGGGMGGG 1783 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGG 906 GGG GG GGG GG GG Sbjct: 1828 GGGMGAGGEGGGAGGGGGG 1846 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P PP P PP P P PPP Sbjct: 747 SPPAPPLPPKVTPKPPAPPQFAPVPPP 773 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPP 960 KP PP P PPP P P P Sbjct: 760 KPPAPPQFAPVPPPCAPIPPMP 781 >SB_3426| Best HMM Match : Homeobox (HMM E-Value=3.4e-22) Length = 245 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P+FPP P PPP P P PG Sbjct: 195 PAFPPSFPFSPPPEYPGLPVSSPG 218 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPPG 969 PP PP P PP PP P G Sbjct: 29 PPPPPPYEAPPPPPGPPGPDG 49 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P PP P PPP PP P PPG Sbjct: 30 PPPPPYEAPPPPPGPP-GPDGPPG 52 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPPG 969 PP P P P P PP PPG Sbjct: 706 PPGLPGPPGPASPPSPPGPPG 726 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPPG 969 PP P P P P PP PPG Sbjct: 791 PPGLPGPPGPASPPSPPGPPG 811 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPPG 969 PP P P P P PP PPG Sbjct: 876 PPGLPGPPGPASPPSPPGPPG 896 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P P P PP PP PP PPG Sbjct: 707 PGLPGPPGPASPPSPPG-PPGPPG 729 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P P P PP PP PP PPG Sbjct: 792 PGLPGPPGPASPPSPPG-PPGPPG 814 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P P P PP PP PP PPG Sbjct: 877 PGLPGPPGPASPPSPPG-PPGPPG 899 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 6/31 (19%) Frame = +1 Query: 892 QKPSFPPXXPPXPP------PXPPXXPPPPP 966 Q PS+PP P PP P P PPP P Sbjct: 505 QHPSYPPTQPSYPPTPSSYLPTQPYYPPPQP 535 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG G GG G Sbjct: 59 GCGGGNDGGNGGGGAGNGGGGGG 81 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GGG G GG G Sbjct: 67 GNGGGGAGNGGGGGGAGNGGAAG 89 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 4/27 (14%) Frame = -1 Query: 965 GGGGGXXGGXGGGXG----GXXGGKEG 897 GGGGG GG G G G G GG +G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDG 66 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFC 891 GGGG GG G G G G G C Sbjct: 35 GGGGVGGGGGNGGGAGNGVGAGGC 58 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GG GG G GGG GG G Sbjct: 66 GGNGGGGAGNGGGGGGAGNG 85 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXX--PPPPP 966 S + Q P PP P P PP PPPPP Sbjct: 202 SNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPP 234 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P + TS +P PP P PP PPPPP Sbjct: 162 PPPPMRGPTSGGEPP-PPKNAPPPPKRGSSNPPPPP 196 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P PP P P PPPPP Sbjct: 299 PAAAPPPPPLPAGVPAPPPPPPP 321 Score = 28.3 bits (60), Expect = 9.9 Identities = 18/43 (41%), Positives = 21/43 (48%), Gaps = 9/43 (20%) Frame = +1 Query: 865 KVLSXQTSXQKP-SFPPXXPPX-----PPPX---PPXXPPPPP 966 +V T+ Q+P S PP PP PPP P PPPPP Sbjct: 265 RVSRRYTNTQRPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPP 307 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPP 964 P PP P P P PPPP Sbjct: 304 PPPPLPAGVPAPPPPPPPP 322 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPP----PPG 969 PP P PP PP PPP PPG Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPG 120 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPP 964 P PP P P P PPPP Sbjct: 95 PPPPATPPPPTMPPTPPPP 113 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP PPP PP P Sbjct: 103 PPTMPPTPPPPQTPAPPGP 121 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP PP P PP P P Sbjct: 104 PTMPPTPPPPQTPAPPGPDTPAP 126 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPP--XPPPXPPXXPPPP 963 S T + P PP PP PP PP P PP Sbjct: 1251 SIVTVEELPPLPPLPPPDAQPPSLPPQPPQPP 1282 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPPG 969 Q P P PP P PP P PP G Sbjct: 302 QTPPPPQTPPPPQTPAPPQTPAPPSG 327 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGG 906 GGG GG GGG GG GG Sbjct: 121 GGGRGGGGYGGGRGGGYGG 139 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -1 Query: 962 GGGGXXGGXGGGX-GGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 116 GGGGYGGGRGGGGYGGGRGGGYG 138 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG +G Sbjct: 128 GYGGGRGGGYGGGRRDYGGGSKG 150 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GG GG GG G Sbjct: 359 GGGGSEDNGASGGGGGYSGGGSG 381 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +1 Query: 895 KPSFPPXXPPXP-PPXPPXXPPPPP 966 KP+ P P P PP PP PP PP Sbjct: 164 KPTPAPHSSPSPTPPPPPIIPPCPP 188 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +1 Query: 901 SFPPXXPPXPPPXPP--XXPPPPP 966 + PP PPP PP PPPPP Sbjct: 447 TLPPLPSDEPPPLPPDEEKPPPPP 470 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPP 963 S + P PP PPP P PP P Sbjct: 453 SDEPPPLPPDEEKPPPPPAPALPPLP 478 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GGG GG G G Sbjct: 262 GGGGGACGCNGGGAGGGGGYSGG 284 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGK 903 GG GG GG GG GG GG+ Sbjct: 306 GGNGGNAGGNGGMTGGGAGGE 326 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GG GG GG G Sbjct: 302 GGNAGGNGGNAGGNGGMTGGGAG 324 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GG GG GG G Sbjct: 229 GGGGSEDNGASGGGGGYSGGGSG 251 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXP 954 P V + + P+F PP PPP PP P Sbjct: 291 PAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMP 322 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P P PPPPP Sbjct: 297 PPPAPPLPNFTSPSPPPPPP 316 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPPG 969 PP PP PP P PPG Sbjct: 245 PPPPPVPPPTIPSVPPG 261 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Frame = +1 Query: 892 QKPSFPPXXPPXP---PPXPPXXPPPP 963 Q+P P PP P PP P PPPP Sbjct: 73 QQPMMMPFPPPPPIYMPPPPVYMPPPP 99 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 24.6 bits (51), Expect(2) = 3.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXP 942 +T+ + S P PP PPP P Sbjct: 1112 ETAEEVESDEPLPPPPPPPIP 1132 Score = 23.4 bits (48), Expect(2) = 3.6 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 922 PXPPPXPPXXPPPPP 966 P PPP PPPP Sbjct: 1145 PNPPPDMQLPDPPPP 1159 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 865 KVLSXQTSXQKPSFPPXXPPXPPPXPPXXPP 957 K+++ Q P PP PP P P PP P Sbjct: 452 KLVARQDDTPIPPPPPMSPPPPTPPPPATSP 482 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PP PP PPPP Sbjct: 463 PPPPPMSPPPPTPPPP 478 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPP 963 P PP P PP PPPP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P PPPPP Sbjct: 277 PGMPPPMPPGGMPPNMEQPPPPP 299 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 T +P PP PP P P PP P PP Sbjct: 1357 TPRPRPPTPPR-PPTPRPRPPTPRPGPP 1383 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPP 960 P PP P P PP PPP Sbjct: 1575 PITPPPPTPSPPQTPPP 1591 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPP 963 T+ PS P PP PP P P PP Sbjct: 1350 TTSPIPSTPRPRPPTPPRPPTPRPRPP 1376 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGG 906 GGG GG GGG GG GG Sbjct: 145 GGGMSMGGMGGGMGGMMGG 163 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG GG GGG G GG Sbjct: 177 GMGGGMGGGMGGGMEGGMGG 196 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGGKEG 897 GGG GG GGG GG G G Sbjct: 175 GGGMGGGMGGGMGGGMEGGMG 195 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GGG GG G +G Sbjct: 84 GDGGGGGDGGGGGDGGGDGDGDG 106 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG G G +G Sbjct: 88 GGGDGGGGGDGGGDGDGDGDGDG 110 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 KPS P P PPP PPPP Sbjct: 250 KPSVPIPPPTKPPPRVASRRPPPP 273 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGGX-GGXXGGKE 900 GGGGG GG GG GG GG++ Sbjct: 141 GGGGGYRGGYRGGYRGGYRGGRD 163 >SB_12281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 901 SFPPXXPPXPPPXPP 945 S PP PP PPP PP Sbjct: 245 SLPPYLPPAPPPPPP 259 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 928 PPPXPPXXPPPPPG 969 PP PP PPPPPG Sbjct: 247 PPYLPPAPPPPPPG 260 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPP 960 S PP PP P P PP PPP Sbjct: 145 SSPPRTPP-PEPTPPPTPPP 163 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP PP PP PP Sbjct: 31 PP--PPSPPPSPP--PPSPP 46 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP PP PP PP Sbjct: 154 PP--PPSPPPSPP--PPSPP 169 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP PP PP Sbjct: 134 PVTPPPGPETPPPPDTPAPPVPP 156 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS+ P PP PP PPPP Sbjct: 192 PSWNRPPPSGAPPPPPIGAPPPP 214 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP P PPP PPPP Sbjct: 198 PPSGAPPPPPIGAPPPPPP 216 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P P PP P PPPPP Sbjct: 118 PTSVPSGPRAPPGGPGAPPPPPP 140 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP P PPP PP PP Sbjct: 125 PRAPPGGPGAPPPPPPPAVVPP 146 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGGXG-GXXGGKEG 897 GG GG GG GGG G G GG G Sbjct: 193 GGYGGSKGGYGGGSGGGGYGGGRG 216 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/20 (65%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = -1 Query: 962 GGGGXXGGXGGGX-GGXXGG 906 GGGG GG GGG GG GG Sbjct: 207 GGGGYGGGRGGGGYGGGHGG 226 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = -1 Query: 965 GGGGGXXGGXGGGXG----GXXGGKEGFCXEV 882 GGGG GG GGG G GG G C E+ Sbjct: 115 GGGGRSYGGGGGGGGFYQDSYGGGGGGGCYEI 146 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFCXE 885 GGGG GG G GG GG + C E Sbjct: 153 GGGGRRGGGGCCGGGGGGGGDCTCDE 178 >SB_36777| Best HMM Match : VWA (HMM E-Value=0) Length = 1303 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPP 960 Q S PS P P P P P PPP Sbjct: 1253 QVSTPSPSLVPNPVPQPAPAPAPAPPP 1279 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFCXE 885 GGGG GG G GG GG + C E Sbjct: 70 GGGGRRGGGGCCGGGGGGGGDCTCDE 95 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFCXE 885 GGGG GG G GG GG + C E Sbjct: 153 GGGGRRGGGGCCGGGGGGGGDCTCDE 178 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP P PPP PPPP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPP 803 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 898 PSFPPXXPP---XPPPXPPXXPPPPPG 969 P FPP P PPP P PPPG Sbjct: 439 PRFPPPGAPHPRVPPPGAPHPRVPPPG 465 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGG GG GGG GG GG Sbjct: 756 GGGYRGGGGYGGGGGGYRGG 775 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG GG G G GG GG Sbjct: 777 GYGGGHRGGGGYGGGGHRGG 796 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPP------XPPXXPPPPPG 969 P ++ T P PP PPP PP PPPP G Sbjct: 383 PPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIG 425 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 5/29 (17%) Frame = +1 Query: 898 PSFPPXXPPX-----PPPXPPXXPPPPPG 969 P P PP P P PP PPPP G Sbjct: 221 PDAPTPPPPVKTTAAPTPSPPQTPPPPTG 249 >SB_35620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKE 900 GGGG GG GGG G G+E Sbjct: 67 GGGGGGGGGGGGRGCSTCGEE 87 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 +P + P PP P PP P PP Sbjct: 324 RPPYEPGRPPHEPGRPPHEPGRPP 347 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGGXG-GXXGGKEGF 894 G GGG GG GGG G G GG + + Sbjct: 206 GRGGGGRGGYGGGGGYGGYGGYDQY 230 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 P PP PP PP PPP Sbjct: 630 PTTVPPLPPTPPPRQSTPPP 649 >SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G G G G GG G Sbjct: 20 GGGGLGGSGGSGGSGGSGGSSG 41 >SB_51340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4529 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +1 Query: 871 LSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPPG 969 ++ Q + P P PPP PP P P G Sbjct: 2104 INQQVQIPQQGMPVNIQPGPPPAPPPPPVQPVG 2136 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGGGG GG GGG G Sbjct: 164 GGGGGGGGGGGGGRRG 179 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 28.3 bits (60), Expect = 9.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 928 PPPXPPXXPPPP 963 PPP PP PPPP Sbjct: 794 PPPPPPPPPPPP 805 Score = 28.3 bits (60), Expect = 9.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 931 PPXPPXXPPPPP 966 PP PP PPPPP Sbjct: 794 PPPPPPPPPPPP 805 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 28.3 bits (60), Expect = 9.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 928 PPPXPPXXPPPP 963 PPP PP PPPP Sbjct: 511 PPPPPPASPPPP 522 >SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1189 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 859 PXKVLSXQTSXQKPS--FPPXXPPXPPP--XPPXXPPPPP 966 P T+ Q P+ PP P PPP P PP PP Sbjct: 475 PLPTTRLPTTAQTPTTILPPTTTPTPPPTTTEPQRPPDPP 514 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 +P + P PP P PP P PP Sbjct: 90 RPPYEPGRPPHEPGRPPHEPGRPP 113 >SB_16709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 868 VLSXQTSXQKPSFPPXXPPXPPPXPPXXPPP 960 +LS S+PP P PPP PPP Sbjct: 105 ILSWSLEFGVRSYPPPPPGSPPPAYTEMPPP 135 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S Q + PP PP P P PPP P Sbjct: 1155 STQVRNTTQAKPPQPPPVPSVQAPPAPPPAP 1185 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,740,312 Number of Sequences: 59808 Number of extensions: 415302 Number of successful extensions: 6847 Number of sequences better than 10.0: 158 Number of HSP's better than 10.0 without gapping: 1546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4175 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2872045441 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -