BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F23 (971 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 44 2e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 44 2e-04 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 41 0.001 At3g51290.1 68416.m05614 proline-rich family protein 33 0.002 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 40 0.003 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 38 0.006 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 29 0.006 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 38 0.010 At3g50180.1 68416.m05486 hypothetical protein 38 0.010 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 38 0.013 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 38 0.013 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 37 0.018 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 37 0.018 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 37 0.018 At1g75550.1 68414.m08780 glycine-rich protein 37 0.023 At5g56140.1 68418.m07003 KH domain-containing protein 36 0.031 At4g16240.1 68417.m02464 hypothetical protein 36 0.031 At4g01985.1 68417.m00265 expressed protein 36 0.031 At3g24550.1 68416.m03083 protein kinase family protein contains ... 36 0.031 At2g30560.1 68415.m03722 glycine-rich protein 36 0.031 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 36 0.031 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 36 0.031 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 36 0.041 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 36 0.041 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 36 0.041 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 30 0.047 At4g08230.1 68417.m01358 glycine-rich protein 36 0.054 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 35 0.071 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 35 0.071 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 35 0.071 At1g62240.1 68414.m07021 expressed protein 35 0.094 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 35 0.094 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 34 0.12 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 34 0.12 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 34 0.12 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 34 0.16 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 34 0.16 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 34 0.16 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 34 0.16 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 34 0.16 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 34 0.16 At4g30460.1 68417.m04325 glycine-rich protein 34 0.16 At3g46740.1 68416.m05074 chloroplast outer envelope protein, put... 34 0.16 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 34 0.16 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 34 0.16 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 34 0.16 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 29 0.18 At5g46730.1 68418.m05757 glycine-rich protein 33 0.22 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 33 0.22 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 33 0.22 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 33 0.22 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 33 0.22 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 33 0.22 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 33 0.22 At3g16350.1 68416.m02068 myb family transcription factor ; conta... 33 0.22 At2g05440.1 68415.m00574 glycine-rich protein 33 0.22 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 33 0.22 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 33 0.22 At1g26150.1 68414.m03192 protein kinase family protein similar t... 33 0.22 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 33 0.22 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 33 0.29 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 33 0.29 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 33 0.29 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 33 0.29 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 33 0.29 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 33 0.29 At1g15830.1 68414.m01900 expressed protein 33 0.29 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 33 0.29 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 33 0.38 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 33 0.38 At4g33660.1 68417.m04781 expressed protein 33 0.38 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 33 0.38 At4g18570.1 68417.m02749 proline-rich family protein common fami... 33 0.38 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 33 0.38 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 33 0.38 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 33 0.38 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 33 0.38 At2g05530.1 68415.m00585 glycine-rich protein 33 0.38 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 33 0.38 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 33 0.38 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 33 0.38 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 32 0.50 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 32 0.50 At4g21720.1 68417.m03145 expressed protein 32 0.50 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 32 0.50 At3g55950.1 68416.m06217 protein kinase family protein contains ... 32 0.50 At2g05440.2 68415.m00575 glycine-rich protein 32 0.50 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 32 0.50 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 32 0.50 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 32 0.66 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 32 0.66 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 32 0.66 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 32 0.66 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 32 0.66 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 32 0.66 At1g61080.1 68414.m06877 proline-rich family protein 32 0.66 At1g53640.1 68414.m06100 hypothetical protein ; expression suppo... 32 0.66 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 32 0.66 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 32 0.66 At5g62440.1 68418.m07837 expressed protein 31 0.87 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 31 0.87 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 31 0.87 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 31 0.87 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 31 0.87 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 31 0.87 At3g43583.1 68416.m04636 hypothetical protein 31 0.87 At3g10720.2 68416.m01291 pectinesterase, putative contains simil... 31 0.87 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 31 0.87 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 31 0.87 At1g11850.2 68414.m01364 expressed protein 31 0.87 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 27 1.1 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 31 1.2 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 31 1.2 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 31 1.2 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 31 1.2 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 31 1.2 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 31 1.2 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 31 1.2 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 31 1.2 At4g15830.1 68417.m02408 expressed protein 31 1.2 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 31 1.2 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 31 1.2 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 31 1.2 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 31 1.2 At2g30505.1 68415.m03716 Expressed protein 31 1.2 At1g77030.1 68414.m08970 glycine-rich protein 31 1.2 At1g70990.1 68414.m08190 proline-rich family protein 31 1.2 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 31 1.2 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 31 1.5 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 31 1.5 At3g08640.1 68416.m01003 alphavirus core protein family contains... 31 1.5 At3g08630.1 68416.m01002 expressed protein 31 1.5 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 31 1.5 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 31 1.5 At1g29380.1 68414.m03592 hypothetical protein 31 1.5 At1g10620.1 68414.m01204 protein kinase family protein contains ... 31 1.5 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 30 2.0 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 30 2.0 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 30 2.0 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 30 2.0 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 30 2.0 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 30 2.0 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 30 2.0 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 30 2.0 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 30 2.0 At2g41260.2 68415.m05096 glycine-rich protein / late embryogenes... 30 2.0 At2g41260.1 68415.m05095 glycine-rich protein / late embryogenes... 30 2.0 At2g05510.1 68415.m00583 glycine-rich protein 30 2.0 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 30 2.0 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 30 2.0 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 30 2.0 At1g53620.1 68414.m06094 glycine-rich protein 30 2.0 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 30 2.0 At5g11550.1 68418.m01347 expressed protein 28 2.6 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 30 2.7 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 30 2.7 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 30 2.7 At4g21620.1 68417.m03134 glycine-rich protein 30 2.7 At2g27660.1 68415.m03352 DC1 domain-containing protein contains ... 30 2.7 At1g53625.1 68414.m06096 expressed protein 30 2.7 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 30 2.7 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 30 2.7 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 30 2.7 At5g51300.2 68418.m06360 splicing factor-related contains simila... 29 3.5 At5g51300.1 68418.m06359 splicing factor-related contains simila... 29 3.5 At5g38560.1 68418.m04662 protein kinase family protein contains ... 29 3.5 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 29 3.5 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 29 3.5 At5g17760.2 68418.m02083 AAA-type ATPase family protein contains... 29 3.5 At5g17760.1 68418.m02082 AAA-type ATPase family protein contains... 29 3.5 At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEA... 29 3.5 At5g12370.1 68418.m01455 exocyst complex component Sec10-related... 29 3.5 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 29 3.5 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 29 3.5 At1g27710.1 68414.m03387 glycine-rich protein 29 3.5 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 29 3.5 At1g04660.1 68414.m00463 glycine-rich protein 29 3.5 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 29 4.7 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 29 4.7 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 29 4.7 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 29 4.7 At5g11700.1 68418.m01367 glycine-rich protein predicted protein,... 29 4.7 At4g34440.1 68417.m04894 protein kinase family protein contains ... 29 4.7 At4g33520.3 68417.m04762 metal-transporting P-type ATPase, putat... 29 4.7 At4g33520.2 68417.m04761 metal-transporting P-type ATPase, putat... 29 4.7 At4g33520.1 68417.m04760 metal-transporting P-type ATPase, putat... 29 4.7 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 29 4.7 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 29 4.7 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 29 4.7 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 29 4.7 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 4.7 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 4.7 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 29 4.7 At2g22800.1 68415.m02706 homeobox-leucine zipper protein 9 (HAT9... 29 4.7 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 29 4.7 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 29 4.7 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 29 4.7 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 29 4.7 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 29 4.7 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 29 4.7 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 29 4.7 At1g11850.1 68414.m01363 expressed protein 29 4.7 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 29 4.7 At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) 29 6.2 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 29 6.2 At3g43520.1 68416.m04614 expressed protein contains Pfam profile... 29 6.2 At2g28500.1 68415.m03463 LOB domain protein 11 / lateral organ b... 29 6.2 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 29 6.2 At1g47660.1 68414.m05295 hypothetical protein 29 6.2 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 29 6.2 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 24 6.5 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 28 8.1 At5g58540.1 68418.m07330 protein kinase family protein contains ... 28 8.1 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 28 8.1 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 28 8.1 At5g20130.1 68418.m02396 expressed protein 28 8.1 At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; g... 28 8.1 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 28 8.1 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 28 8.1 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 28 8.1 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 28 8.1 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 28 8.1 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 28 8.1 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 28 8.1 At4g12880.1 68417.m02016 plastocyanin-like domain-containing pro... 28 8.1 At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar... 28 8.1 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 28 8.1 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 28 8.1 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 28 8.1 At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar... 28 8.1 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 28 8.1 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 28 8.1 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 28 8.1 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 28 8.1 At2g11005.1 68415.m01177 glycine-rich protein 28 8.1 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 28 8.1 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 8.1 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 8.1 At1g54060.1 68414.m06160 expressed protein similar to 6b-interac... 28 8.1 At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kin... 28 8.1 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 28 8.1 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 28 8.1 At1g15840.1 68414.m01901 expressed protein 28 8.1 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 28 8.1 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 24 9.7 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 24 9.7 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P S S P PP PP PPP PP PPPPP Sbjct: 366 PIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P PP PP PPP PP PPPPP Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 41.9 bits (94), Expect = 6e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPP 405 Score = 41.9 bits (94), Expect = 6e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPP 406 Score = 41.9 bits (94), Expect = 6e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPP 407 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPP---XXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PP P PPPPP Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPP 418 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPX--PPPXPPXXPPPPP 966 P PP PP PPP PP PPPP Sbjct: 414 PPPPPSPPPYVYPPPPPPYVYPPPP 438 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = +1 Query: 904 FPPXXPPX---PPPXPPXXPPPPP 966 +PP PP PPP PP PPPP Sbjct: 425 YPPPPPPYVYPPPPSPPYVYPPPP 448 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPP---PPP 966 P PP P PPP PP PP PPP Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 31.9 bits (69), Expect = 0.66 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 904 FPPXXPPXPPPXPPXXPPPPP 966 +P PP P P P PPPPP Sbjct: 410 YPSPPPPPPSPPPYVYPPPPP 430 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP PP PP PPPP Sbjct: 407 PYVYPSPPPPPPSPPPYVYPPPP 429 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 5/28 (17%) Frame = +1 Query: 898 PSFPPXXPPXPPPX-----PPXXPPPPP 966 P PP PP PPP PP P PPP Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPX---XPPPPP 966 P + PP PPP PP PPPPP Sbjct: 406 PPYVYPSPPPPPPSPPPYVYPPPPPP 431 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 44.0 bits (99), Expect = 2e-04 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P PP PP PPP PP PPPPP Sbjct: 40 QSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P FP PP PPP PP PPPPP Sbjct: 32 SQDPPLFPQSPPPPPPPPPPPPPPPPP 58 Score = 43.2 bits (97), Expect = 3e-04 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPP 61 Score = 35.1 bits (77), Expect = 0.071 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPP 963 S P PP PP PPP PP PPPP Sbjct: 41 SPPPPPPPPPPPPPPPPPPP--PPPP 64 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 871 LSXQTSXQKPSFPPXXPPXPPPXPPXXPPP 960 L Q+ P PP PP PPP PP PPP Sbjct: 37 LFPQSPPPPPPPPPPPPPPPPPPPP--PPP 64 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPPXA 970 P PP P P P P PPPP A Sbjct: 45 PPPPPPPPPPPPPPPPPPPPA 65 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 8/31 (25%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXX--------PPPPP 966 P PP PP PPP PP PPPPP Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP PP PP PP PPPPP Sbjct: 169 PSIPPPSPPYFPPEPPSIPPPPP 191 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P FPP P PPP PP PP PP Sbjct: 162 PDFPPFSPSIPPPSPPYFPPEPP 184 Score = 36.3 bits (80), Expect = 0.031 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PP PP PP PP Sbjct: 173 PPSPPYFPPEPPSIPPPPPPSPP 195 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P FPP P PPP PP P G Sbjct: 177 PYFPPEPPSIPPPPPPSPPSAASG 200 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 33.5 bits (73), Expect = 0.22 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 922 PXPPPXPPXXPPPPP 966 P PPP PP PPPPP Sbjct: 71 PSPPPPPPPRPPPPP 85 Score = 32.3 bits (70), Expect = 0.50 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPP 963 P P PPP PP PPPP Sbjct: 68 PPSPSPPPPPPPRPPPPP 85 Score = 31.1 bits (67), Expect(2) = 0.002 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 928 PPPXPPXXPPPPP 966 PPP PP PPPPP Sbjct: 105 PPPPPPPPPPPPP 117 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 +S + P PP P P PP P PPP Sbjct: 56 SSKETPLHLHHNPPSPSPPPPPPPRPPP 83 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPPG 969 P PP PPP P PP PG Sbjct: 69 PSPSPPPPPPPRPPPPPLSPG 89 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 919 PPXPPPXPPXXPPPP 963 PP PPP PP PPPP Sbjct: 105 PPPPPPPPP--PPPP 117 Score = 28.7 bits (61), Expect(2) = 0.002 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXP 954 PS PP PP PPP PP P Sbjct: 71 PSPPPPPPPRPPP-PPLSP 88 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPP 945 T+ PP PP PPP PP Sbjct: 97 TTTTSSVLPPPPPPPPPPPPP 117 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPPG 969 +P P PP PPP P PPPPPG Sbjct: 671 RPPLPGGGPPPPPPPPGGGPPPPPG 695 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPPG 969 P P PP PP P PPPPPG Sbjct: 683 PPPPGGGPPPPPGGGPPPPPPPPG 706 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +1 Query: 907 PPXXPPX--PPPXPPXXPPPPP 966 PP PP PPP P PPPPP Sbjct: 681 PPPPPPGGGPPPPPGGGPPPPP 702 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPXP---PPXPPXXPPPPP 966 PP PP P PP PP PPPP Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPP 701 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPPG 969 + P PP P PP PPPP G Sbjct: 666 NLPSARPPLPGGGPPPPPPPPGG 688 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = +1 Query: 865 KVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 K + T KPS PP PP PP PP PPPP Sbjct: 230 KEIQIDTFVVKPSSPPQQPPATPPPPP--PPPP 260 Score = 33.1 bits (72), Expect = 0.29 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPP 963 + P + PP PP PP PPPP Sbjct: 372 EPPQYQSLIPPPSPPPPPPPPPPP 395 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PPP PP P P Sbjct: 245 PQQPPATPPPPPPPPPVEVPQKP 267 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP PP PPPPP Sbjct: 382 PPSPPPPPP--PPPPP 395 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXP 954 +T ++ PP PP PPP PP P Sbjct: 287 ETKFKRTFQPPPSPPPPPPPPPPQP 311 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPP 963 Q P PP PP PPP P PP Sbjct: 295 QPPPSPPPPPPPPPPQPLIAATPP 318 Score = 31.1 bits (67), Expect(2) = 0.006 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 928 PPPXPPXXPPPPP 966 PPP PP PPPPP Sbjct: 296 PPPSPPPPPPPPP 308 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 928 PPPXPPXXPPPPP 966 PPP PP PPPPP Sbjct: 381 PPPSPPPPPPPPP 393 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 K +F P PP PPP PP PPP P Sbjct: 291 KRTFQP--PPSPPP-PPPPPPPQP 311 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +1 Query: 871 LSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 L + F P P P PP PPPP Sbjct: 279 LQENAKRSETKFKRTFQPPPSPPPPPPPPPP 309 Score = 26.6 bits (56), Expect(2) = 0.006 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXP 954 Q P+ PP PP PP P P Sbjct: 247 QPPATPPPPPPPPPVEVPQKP 267 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 29.5 bits (63), Expect(2) = 0.006 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPP 957 PP PP PPP P PP Sbjct: 120 PPPPPPPPPPPPTITPP 136 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPP 960 P PP PPP PP PP Sbjct: 120 PPPPPPPPPPPPTITPP 136 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPP 957 PP PP PPP P PP Sbjct: 151 PPPPPPPPPPPPTITPP 167 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPP 960 P PP PPP PP PP Sbjct: 151 PPPPPPPPPPPPTITPP 167 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 928 PPPXPPXXPPPP 963 PPP PP PPPP Sbjct: 120 PPPPPPPPPPPP 131 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 931 PPXPPXXPPPPP 966 PP PP PPPPP Sbjct: 120 PPPPPPPPPPPP 131 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 928 PPPXPPXXPPPP 963 PPP PP PPPP Sbjct: 151 PPPPPPPPPPPP 162 Score = 28.3 bits (60), Expect(2) = 0.006 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 931 PPXPPXXPPPPP 966 PP PP PPPPP Sbjct: 151 PPPPPPPPPPPP 162 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 37.9 bits (84), Expect = 0.010 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P + P PP PPP PP PPPP Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPP 469 Score = 37.9 bits (84), Expect = 0.010 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP PP PPPP Sbjct: 466 PPPPPPPPPPPPPVYSPPPP 485 Score = 37.9 bits (84), Expect = 0.010 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P + P PP PPP PP PPPP Sbjct: 493 PVYSPPPPPPPPPPPPVYSPPPP 515 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP P PPPPP Sbjct: 451 PPPPPPPPPPPPVYSPPPPP 470 Score = 37.5 bits (83), Expect = 0.013 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP P PPPPP Sbjct: 497 PPPPPPPPPPPPVYSPPPPP 516 Score = 37.1 bits (82), Expect = 0.018 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S PS PP PP P PP PPPPP Sbjct: 481 SPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 36.3 bits (80), Expect = 0.031 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P V S P PP P PPP PP PPPPP Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPP--PPPPP 478 Score = 35.9 bits (79), Expect = 0.041 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +1 Query: 883 TSXQKPSFPPXX----PPXPPPXPPXXPPPPP 966 TS PS PP PP PPP P PPPPP Sbjct: 424 TSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPP 455 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPPPX---PPXXPPPPP 966 P PP PP PPP PP PPPPP Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPP 491 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPP---PXPPXXPPPPP 966 P PP PP PP P PP PPPPP Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 35.5 bits (78), Expect = 0.054 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPP---XPPXXPPPPP 966 S P + P PP PPP PP PPPPP Sbjct: 430 SPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Score = 35.1 bits (77), Expect = 0.071 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPXPPPX---PPXXPPPPP 966 PP PP PPP PP PPPPP Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPP 460 Score = 35.1 bits (77), Expect = 0.071 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPXPP---PXPPXXPPPPP 966 PP PP PP P PP PPPPP Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPP 461 Score = 35.1 bits (77), Expect = 0.071 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPXP---PPXPPXXPPPPP 966 PP PP P PP PP PPPPP Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPP 462 Score = 34.7 bits (76), Expect = 0.094 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPP---PPP 966 P V S P PP P PPP PP PP PPP Sbjct: 476 PPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P + S + P PP PP P PP PPPPP Sbjct: 413 PAPIFSTPPTLTSP--PPPSPPPPVYSPPPPPPPPP 446 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +1 Query: 898 PSFPPXXPPX--PPPXPPXXPPPP 963 P PP PP PPP PP PPPP Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P + P PP PPP PP PPP Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPP 484 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXP---PPXPPXXPPPPP 966 P PP PP P PP P PPPPP Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P V S P+ P PPP PP PPPP Sbjct: 514 PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Score = 31.9 bits (69), Expect = 0.66 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP PP P PPPP Sbjct: 537 PPPPPPHSPPPPQFSPPPP 555 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PPP P PPPPP Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPP 613 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PPP P PPP P Sbjct: 396 PPVVTPLPPPSLPSPPPPAP 415 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P V S P PP P PPP PPPP Sbjct: 491 PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 5/28 (17%) Frame = +1 Query: 898 PSFPPXXPPXP---PPXPPX--XPPPPP 966 P PP PP P PP PP PPPPP Sbjct: 498 PPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +1 Query: 901 SFPPXXPPX-PPPXPPXXPPPPP 966 S PP P PPP PP PPPP Sbjct: 599 SSPPPTPVYSPPPPPPCIEPPPP 621 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP PPP PPPPP Sbjct: 611 PPPPCIEPPPPPPCIEYSPPPPP 633 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PP P PPPPP Sbjct: 576 PPPHSPPPPIYPYLSPPPPP 595 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P +P PP PPP P PPP P Sbjct: 580 SPPPPIYPYLSPP-PPPTPVSSPPPTP 605 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P PP PPP P PPPP Sbjct: 568 SSPPPHSPPPPHSPPPPIYPYLSPPPP 594 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P PP PPP PPPP Sbjct: 602 PPTPVYSPPPPPPCIEPPPPPP 623 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 6/26 (23%) Frame = +1 Query: 907 PPXXPPX--PPPXPP----XXPPPPP 966 PP PP PPP PP PPPPP Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPP--PXPPXXPPPPP 966 P + PP PP P PP PPPP Sbjct: 531 PVYCTRPPPPPPHSPPPPQFSPPPP 555 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P PP P PP PPPP Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPP 584 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPP----XXPPPPP 966 + P PP PPP PP PPPPP Sbjct: 617 EPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P L + ++ PP PP PPP PP PPPPP Sbjct: 9 PPPPLPPRLELRRQRAPPPQPPPPPPPPP--PPPPP 42 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPP 957 P PP PP PPP PP P Sbjct: 27 PQPPPPPPPPPPPPPPRLGP 46 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 PS PP P PPP PP PPPP Sbjct: 1107 PSQPPPPPLSPPPSPPPPPPPP 1128 Score = 37.1 bits (82), Expect = 0.018 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PP PP PPPPP Sbjct: 1106 PPSQPPPPPLSPPPSPPPPP 1125 Score = 36.3 bits (80), Expect = 0.031 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PP PP PPPP Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPP 1095 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PP PP PP PP Sbjct: 1069 PPPLPPLPPSPPPPSPPLPP 1088 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP PP PP PPP P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSP 1084 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 FPPXXPPXPPPXPPXXPPPP 963 FPP PP P PP PPP Sbjct: 1100 FPPLPPPPSQPPPPPLSPPP 1119 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 4/27 (14%) Frame = +1 Query: 898 PSFPPXXPPX---PP-PXPPXXPPPPP 966 PS P PP PP P PP PPPPP Sbjct: 1088 PSSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPP 960 +P PP PP PP PP PPP Sbjct: 1109 QPPPPPLSPPPSPPPPP--PPP 1128 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPP 960 TS PS PP PP P P PP PPP Sbjct: 70 TSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 35.9 bits (79), Expect = 0.041 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 + P PP PP P P PP PPP P Sbjct: 63 EPPPPPPTSPPPPSPPPPSPPPPSP 87 Score = 34.7 bits (76), Expect = 0.094 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P P PP PPP P Sbjct: 73 PPPSPPPPSPPPPSPPPPSP 92 Score = 34.3 bits (75), Expect = 0.12 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P+ PP P PP PP PPPP Sbjct: 69 PTSPPPPSPPPPSPPPPSPPPP 90 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 37.1 bits (82), Expect = 0.018 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 P PP PPP PP PPPPP Sbjct: 375 PLQTPPPPPPPPPLAPPPPP 394 Score = 34.7 bits (76), Expect = 0.094 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PPP PP PPPP Sbjct: 374 PPLQTPPPPPPPPPLAPPPP 393 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 T + P PP P P PP PPPPP Sbjct: 360 TQEKSPVPPPRRSPPPLQTPPPPPPPPP 387 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P + + +K PP PP P PPPPP Sbjct: 351 PNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPP 386 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P PP PPP P PPPP Sbjct: 375 PLQTPPPPPPPPPLAP--PPPP 394 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPP 957 Q P PP PP PP PP P Sbjct: 377 QTPPPPPPPPPLAPPPPPQKRP 398 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 37.1 bits (82), Expect = 0.018 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P PP PPP PP PPPP Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPP 1147 Score = 34.7 bits (76), Expect = 0.094 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PSFP PP P PP PP PP Sbjct: 1119 PSFPAGSPPLPHESPPSPPPQPP 1141 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 871 LSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 L ++ P PP PP P P P PPP Sbjct: 1128 LPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPP 960 +S PS PP P PPP PPP Sbjct: 1142 SSPPPPSSPPQLAPAPPPSDHCLPPP 1167 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 37.1 bits (82), Expect = 0.018 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPP-XPPPXPPXXPPPPP 966 S Q Q PS PP PP PP PP PP PP Sbjct: 40 SSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPP 71 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 880 QTSXQKPSFPPXXPP-XPPPXPPXXPPPPP 966 Q S Q P+ PP PP PP PP PP P Sbjct: 38 QPSSQPPTQPPSQPPTQPPTQPPSHPPTQP 67 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPP 960 Q Q P+ PP PP PP P PPP Sbjct: 46 QPPSQPPTQPPTQPPSHPPTQPPTPPP 72 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPP-XPPXXPPPPP 966 Q Q PS PP PP PPP P P P P Sbjct: 54 QPPTQPPSHPPTQPPTPPPSQSPSQPSPLP 83 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPP 960 Q Q P+ PP PP PP PP P Sbjct: 50 QPPTQPPTQPPSHPPTQPPTPPPSQSP 76 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +1 Query: 892 QKPSFPPXXP-PXPPPXPPXXPPPPP 966 Q PS PP P PP PP PP P Sbjct: 30 QPPSHPPIQPSSQPPTQPPSQPPTQP 55 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG GG GG G+ Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGW 93 Score = 36.3 bits (80), Expect = 0.031 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG GG GG G+ Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGW 95 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGG 90 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G G Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGG 99 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 78 GGGGGGGGGGGGGGGWGWGGGGG 100 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGG 101 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGG 102 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGG 97 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GGG GG K G Sbjct: 86 GGGGGGGWGWGGGGGGGGWYKWG 108 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG G G GGG GG GG G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGG 82 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 36.3 bits (80), Expect = 0.031 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGK 903 GGGGG GG GGG GG GG+ Sbjct: 8 GGGGGGGGGSGGGIGGGGGGR 28 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 960 GGGXXGXXGXGXGXGGXGERRFLXRS 883 GGG G G G G GG G RF+ S Sbjct: 8 GGGGGGGGGSGGGIGGGGGGRFMTYS 33 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 36.3 bits (80), Expect = 0.031 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 15 GGGGGHGGGAGGGFGGGAGGGGG 37 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GGG GG GG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAG 33 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG GG G GG GG GG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGG 34 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 36.3 bits (80), Expect = 0.031 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 487 GGGGGIGGGAGGGVGGGVGGGVG 509 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 269 GAGGGLGGGVGGGVGGGVGGSVG 291 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 423 GAGGGVGGGVGGGVGGGVGGAVG 445 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 337 GAGGGVGGGVGGGVGGGVGGGVG 359 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 341 GVGGGVGGGVGGGVGGGVGGAVG 363 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 345 GVGGGVGGGVGGGVGGAVGGAVG 367 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 427 GVGGGVGGGVGGGVGGAVGGAVG 449 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 273 GLGGGVGGGVGGGVGGSVGGAVG 295 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG GG GGG GG GG Sbjct: 491 GIGGGAGGGVGGGVGGGVGG 510 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = -1 Query: 965 GGGGGXXGGXG---GGXGGXXGGKEG 897 GGGGG GG G GG GG GG G Sbjct: 454 GGGGGSVGGGGRGSGGAGGGTGGSVG 479 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG G G Sbjct: 495 GAGGGVGGGVGGGVGGGVRGAVG 517 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GG GG GG G Sbjct: 277 GVGGGVGGGVGGSVGGAVGGAVG 299 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GG GG GG G Sbjct: 349 GVGGGVGGGVGGAVGGAVGGAVG 371 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GG GG GG G Sbjct: 431 GVGGGVGGGVGGAVGGAVGGAVG 453 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG G G Sbjct: 461 GGGGRGSGGAGGGTGGSVGAGGG 483 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG G GG G Sbjct: 64 GGGGGGGGGIGGSGGVGAGGGVG 86 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G G GGG GG GG G Sbjct: 127 GGGAGGSVGAGGGIGGGAGGAIG 149 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GGG GG GG G Sbjct: 265 GGNVGAGGGLGGGVGGGVGGGVG 287 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GGG GG GG G Sbjct: 333 GGSVGAGGGVGGGVGGGVGGGVG 355 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GGG GG GG G Sbjct: 419 GGSVGAGGGVGGGVGGGVGGGVG 441 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GGG GG GG G Sbjct: 479 GAGGGVGVGGGGGIGGGAGGGVG 501 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G G GGG GG GG G Sbjct: 158 GGGKGRGGKSGGGAGGGVGGGVG 180 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG G GG G Sbjct: 499 GVGGGVGGGVGGGVRGAVGGAVG 521 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 4/27 (14%) Frame = -1 Query: 965 GGGGGXXG----GXGGGXGGXXGGKEG 897 GGGGG G G GGG GG GG G Sbjct: 68 GGGGGIGGSGGVGAGGGVGGGAGGAIG 94 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGG 906 GG G GG GGG GG GG Sbjct: 77 GGVGAGGGVGGGAGGAIGG 95 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GG GG G G Sbjct: 80 GAGGGVGGGAGGAIGGGASGGAG 102 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -1 Query: 962 GGGGXXGGXGGGXG--GXXGGKEG 897 GGGG GG GGG G G GG G Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVG 135 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GG G GG GGG GG GG Sbjct: 131 GGSVGAGGGIGGGAGGAIGG 150 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G G GG GG GG G Sbjct: 380 GGGRGSGGASGGASGGASGGASG 402 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GG GG G G Sbjct: 135 GAGGGIGGGAGGAIGGGASGGVG 157 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GG G GGG GG GG G Sbjct: 56 GASGGIGVGGGGGGGGGIGGSGG 78 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G G GG GG GG G Sbjct: 312 GGGRGSGGASGGASGGASGGAGG 334 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXG--GXGGGXGGXXGGKEG 897 GG GG G G GGG GG GG G Sbjct: 413 GGAGGAGGSVGAGGGVGGGVGGGVG 437 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G G GGG G GG G Sbjct: 182 GGGAGGSVGAGGGIGSGGGGTVG 204 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GG GG GG G Sbjct: 281 GVGGGVGGSVGGAVGGAVGGAVG 303 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 36.3 bits (80), Expect = 0.031 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPP 963 S PP PP PP PP PPPP Sbjct: 215 SLPPPKPPSPPRKPPPPPPPP 235 Score = 33.1 bits (72), Expect = 0.29 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PP PP PPPPP Sbjct: 217 PPPKPPSPPRKPPPPP 232 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPP-PPG 969 P + + PS PP P PP PPP PPG Sbjct: 34 PPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPG 71 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PP P PPPPP Sbjct: 218 PPKPPSPPRKPPPPPP 233 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 14/39 (35%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXP--------------PXXPPPPPG 969 KP PP PP PPP P P PPP PG Sbjct: 220 KPPSPPRKPPPPPPPPAFMSSSGGSDYSDLPVLPPPSPG 258 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 36.3 bits (80), Expect = 0.031 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG GGK G Sbjct: 109 GGGGGKNGGGCGGGGGGKGGKSG 131 Score = 35.1 bits (77), Expect = 0.071 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG G GGK G Sbjct: 85 GGGGGISGGGAGGKSGCGGGKSG 107 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG GG GG G Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGG 30 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG GG GGK G Sbjct: 107 GGGGGGGKNGGGCGGGGGGKGG 128 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GGG GG GG+ G Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGG 27 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 962 GGGGXXGGXGGG-XGGXXGGKEG 897 GGGG GG GGG GG GGK G Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSG 100 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGFC 891 GGGGG GG GGG G GG +G C Sbjct: 16 GGGGGSGGGRGGGGG---GGAKGGC 37 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGG--GGXXGGXGGGXGGXXGGKEG 897 GGG GG GG GGG GG GG G Sbjct: 111 GGGKNGGGCGGGGGGKGGKSGGGSG 135 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GG GG GG G Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGG 31 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G Sbjct: 28 GGGGGAKGGCGGGGKSGGGGGGG 50 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEG 897 P GG G G GGG GG GG G Sbjct: 73 PKGGSGGGGKGGGGGGGISGGGAG 96 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXGGXGGG--XGGXXGGKEG 897 GGG G G GGG GG GGK G Sbjct: 92 GGGAGGKSGCGGGKSGGGGGGGKNG 116 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GG G G GGG GG GG G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGG 23 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXG 909 GGGGG GG GG G G Sbjct: 120 GGGGGGKGGKSGGGSGGGG 138 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 36.3 bits (80), Expect = 0.031 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPP 966 S PP PPP PP PPPPP Sbjct: 586 SIPPPLAQPPPPRPPPPPPPPP 607 Score = 32.7 bits (71), Expect = 0.38 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 9/45 (20%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP---------PXPPXXPPPPP 966 P L T+ PS PP PP PP P P PPPPP Sbjct: 488 PPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPP 532 Score = 31.9 bits (69), Expect = 0.66 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP------PXPPXXPPPPP 966 P L T+ PS PP PP PP P PPPPP Sbjct: 509 PPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPP 550 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 7/30 (23%) Frame = +1 Query: 898 PSFPPXXPPXPP-------PXPPXXPPPPP 966 PS PP PP PP P PP PP PP Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPP 706 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP PPP P PPP Sbjct: 572 PPPPPPPPPPLPSRSIPPP 590 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 7/43 (16%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP-------PXPPXXPPPPP 966 P + + + P PP PP PP P P PPPPP Sbjct: 583 PSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 7/35 (20%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPX-------PPXXPPPPP 966 T ++ + PP PP PPP P PPPPP Sbjct: 631 TGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 11/38 (28%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPX-----------PPXXPPPPP 966 S PS PP PP PP PP PPPPP Sbjct: 611 SIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 905 SPXPPXPXPXPXXPXXPPPP 964 +P PP P P P PPPP Sbjct: 713 APPPPPPPPLSKTPAPPPPP 732 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 7/27 (25%) Frame = +1 Query: 907 PPXXPPXPPPX-------PPXXPPPPP 966 PP PP PPP P PPPPP Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPP 508 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 7/27 (25%) Frame = +1 Query: 907 PPXXPPXPPPXPP-------XXPPPPP 966 PP PP PPP PP PP PP Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPP 702 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 5/21 (23%) Frame = +1 Query: 919 PPXPPPXPPXX-----PPPPP 966 PP PPP PP PPPPP Sbjct: 698 PPAPPPLPPSSTRLGAPPPPP 718 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 7/44 (15%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXP----PXPPPXP---PXXPPPPPG 969 P + T P PP P P PPP P PPPPPG Sbjct: 701 PPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPG 744 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 36.3 bits (80), Expect = 0.031 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPPXPP-PXPPXXPPPPP 966 PS PP PP P P PP PPPPP Sbjct: 62 PSPPPPSPPPPACPPPPALPPPPP 85 Score = 35.1 bits (77), Expect = 0.071 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP P P PP PPPP Sbjct: 60 PPPSPPPPSPPPPACPPPP 78 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PP PP PPPP Sbjct: 59 PPPPSPPPPSPPPPACPPPP 78 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 7/27 (25%) Frame = +1 Query: 907 PPXXPPXP--PPXPPXX-----PPPPP 966 PP PP P PP PP PPPPP Sbjct: 71 PPACPPPPALPPPPPKKVSSYCPPPPP 97 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG GG G GF Sbjct: 130 GGGGGGYGGGGGGYGGGGDGGGGF 153 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGG 145 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG GG G GF Sbjct: 135 GGGGGGYGGGGGGYGGGGDGGGGF 158 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGG 150 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG GG GG G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGG 143 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP PP PPP PP PPPP Sbjct: 96 PEEPPREPPPPPP-PPEEPPPP 116 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +1 Query: 907 PPXXPP--XPPPXPPXXPPPPP 966 PP PP PPP PP PPPP Sbjct: 95 PPEEPPREPPPPPPPPEEPPPP 116 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXX--PPXPPPXPPXXPPPPP 966 P PP PP PP P PPPPP Sbjct: 86 PRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P PP PPP P Sbjct: 38 PLSPPPSPPPSPSSPPRLPPPFP 60 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P P PPP P PP PP Sbjct: 46 PPSPSSPPRLPPPFPALFPPEPP 68 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 7/43 (16%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPP-------XPPPXPPXXPPPPP 966 P L + P FPP P PP PP PPPPP Sbjct: 65 PEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPP 107 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP PP P P PP PP Sbjct: 49 PSSPPRLPPPFPALFPPEPPLPP 71 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 T P P P PPP PP P PP Sbjct: 26 TCCPPPLVFPLLPLSPPPSPPPSPSSPP 53 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P FP PP PP PP PPP Sbjct: 57 PPFPALFPPEPP-LPPRFELPPP 78 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 P VL S +K P P PP PP PPPPP Sbjct: 39 PPPVLPHIRSRKKMDIKEVHLPLPRHYPPPPPPLPPPPP 77 Score = 29.5 bits (63), Expect(2) = 0.047 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 928 PPPXPPXXPPPPPG 969 PPP PP PPPP G Sbjct: 66 PPPPPPLPPPPPYG 79 Score = 25.0 bits (52), Expect(2) = 0.047 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 919 PPXPPPXPPXXP 954 PP PPP PP P Sbjct: 33 PPPPPPPPPVLP 44 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GGG GG GG Sbjct: 63 GGGGGGGGGSGGGGGGRGGG 82 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG GG+ G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGG 81 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 35.1 bits (77), Expect = 0.071 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP PPP P PPPP Sbjct: 273 PPPQPPPPPPPKPQPPPPP 291 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P K+ +++ P P PPP PP PPPP Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPPXP-PPXPPXXPPPPP 966 P PP PP P PP PP PPP Sbjct: 275 PQPPPPPPPKPQPPPPPKIARPPP 298 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P PP P PPP PPP P Sbjct: 276 QPPPPPPPKPQPPPPPKIARPPPAP 300 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 35.1 bits (77), Expect = 0.071 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP PP PP P PPPP Sbjct: 27 PSLPPPVPPPPPSHQPYSYPPPP 49 Score = 34.7 bits (76), Expect = 0.094 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPX-PPXXPPPPP 966 Q PS PP PPP PP PPPPP Sbjct: 13 QPPSQNSLAPPPPPPSLPPPVPPPPP 38 Score = 33.1 bits (72), Expect = 0.29 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPP-----XXPPPPP 966 Q S P PP PP PP PP PPPPP Sbjct: 17 QNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPP 50 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 6/30 (20%) Frame = +1 Query: 895 KPSFPPXXPPX------PPPXPPXXPPPPP 966 +P +PP P PPP PP PPP P Sbjct: 5 RPPYPPLPQPPSQNSLAPPPPPPSLPPPVP 34 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 35.1 bits (77), Expect = 0.071 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP P PPP PP PPPP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPP 83 Score = 34.7 bits (76), Expect = 0.094 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP P PPPP Sbjct: 73 PPSPPPCPPPPSPPPSPPPP 92 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S + + PP PP P P PP PP PP Sbjct: 51 SPEPEPEPADCPPPPPPPPCPPPPSPPPCPP 81 Score = 33.5 bits (73), Expect = 0.22 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP P P P PP PPPP Sbjct: 77 PPCPPPPSPPPSPPPPQLPPPP 98 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP PP P PP PPP P Sbjct: 83 PSPPPSPPPPQLPPPPQLPPPAP 105 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P P P PP PP PP Sbjct: 68 PPCPPPPSPPPCPPPPSPPPSPP 90 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP PP PP PP PPPP Sbjct: 73 PPSPPPCPP--PPSPPPSPPPP 92 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPP-XPPPXPPXXPPPPP 966 PS PP PP PPP PP PPP Sbjct: 74 PSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 31.5 bits (68), Expect = 0.87 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P P P P PPPPP Sbjct: 47 PPSPSPEPEPEPADCPPPPP 66 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +1 Query: 898 PSFPPXXPP-XPPPXPPXXPPPP 963 P PP PP PPP PP PPP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPP 87 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP PP P P PPP Sbjct: 69 PCPPPPSPPPCPPPPSPPPSPPP 91 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S S P PP P PPP PP P PP Sbjct: 84 SPPPSPPPPQLPPP-PQLPPPAPPKPQPSPP 113 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP PP P PP P Sbjct: 97 PPQLPPPAPPKPQPSPPTP 115 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 PS P P P PP PPPP Sbjct: 48 PSPSPEPEPEPADCPPPPPPPP 69 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 34.7 bits (76), Expect = 0.094 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = -1 Query: 968 PGG---GGGXXGGXGGGXGGXXGGKEG 897 PGG GGG GG GGG GG GG G Sbjct: 89 PGGIVVGGGGGGGGGGGGGGGSGGSNG 115 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSG 213 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGF 894 GGGG GG GGG GG G F Sbjct: 95 GGGGGGGGGGGGGGGSGGSNGSF 117 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G G G G GG G Sbjct: 201 GGGGGGVDGSGSGSGSGSGGGSG 223 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GG G G Sbjct: 101 GGGGGGGGGSGGSNGSFFNG 120 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G G Sbjct: 193 GGGGGGGGGGGGGGVDGSGSGSG 215 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 34.7 bits (76), Expect = 0.094 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPP 966 S PP PP PPP P PPPP Sbjct: 520 SSPPPPPPSPPPPCPESSPPPP 541 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +1 Query: 901 SFPPXXPPXPPPXPP--XXPPPPP 966 ++PP PP P P PP PPPP Sbjct: 455 AYPPPPPPSPSPPPPYVYSSPPPP 478 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PPP PP PPP P Sbjct: 515 PPYVYSSPPPPPPSPPPPCP 534 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP P PP P PPP P Sbjct: 625 PSPPPPSPVYYPPVTPSPPPPSP 647 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP P PP P PPP P Sbjct: 640 PSPPPPSPVYYPPVTPSPPPPSP 662 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP P PP P PPP P Sbjct: 610 PSPPPPSPLYYPPVTPSPPPPSP 632 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = +1 Query: 904 FPPXXPPXPPP----XPPXXPPPPP 966 +PP P PPP PP P PPP Sbjct: 620 YPPVTPSPPPPSPVYYPPVTPSPPP 644 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = +1 Query: 904 FPPXXPPXPPP----XPPXXPPPPP 966 +PP P PPP PP P PPP Sbjct: 635 YPPVTPSPPPPSPVYYPPVTPSPPP 659 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPP 966 P PPP PP PPPP Sbjct: 451 PSVRAYPPPPPPSPSPPPP 469 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP P PPP PPPP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPP 478 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP PP PP P PPPP Sbjct: 522 PPPPPPSPP--PPCPESSPPPP 541 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P V S P PP P PPP P PPPP Sbjct: 537 PPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 Q+ K PP P PP P PPPPP Sbjct: 509 QSPVTKRRSPPPAPVNSPPPPVYSPPPPP 537 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +1 Query: 886 SXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 S P + P PP P PP P PPPPP Sbjct: 525 SPPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P PP PPPP Sbjct: 559 PPPPPPVHSPPPPVFSPPPP 578 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PPP PPPPP Sbjct: 545 PPVHSPPPPPVYSPPPPPPP 564 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PP P PPPPP Sbjct: 597 PPPAPVHSPPPPVHSPPPPP 616 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PPP PP PPPP Sbjct: 605 PPPPVHSPPPPPPVYSPPPP 624 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 886 SXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 S P P PP P PP PP PPPP Sbjct: 532 SPPPPPPPVHSPPPPVHSPPPPPVYSPPPP 561 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPP---PXPPXXPPPPP 966 P PP P PP P PP PPPP Sbjct: 560 PPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPP 963 S P F P P PP P PPPP Sbjct: 567 SPPPPVFSPPPPVYSPPPPVHSPPPP 592 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 S T + P P P PP P PPPP Sbjct: 510 SPVTKRRSPPPAPVNSPPPPVYSPPPPPPP 539 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPP 963 S P + P P PP P PPPP Sbjct: 574 SPPPPVYSPPPPVHSPPPPVHSPPPP 599 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P V S P PP P PPP P PPPP Sbjct: 576 PPPVYSPPPPVHSPP-PPVHSP-PPPAPVHSPPPP 608 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +1 Query: 886 SXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 S ++P PP PP PP PP PPPPP Sbjct: 5 SKRRPPPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 5/28 (17%) Frame = +1 Query: 898 PSFPPXXPPXPPP-----XPPXXPPPPP 966 PS PP PPP PP PPPPP Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPP 31 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/28 (57%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG-XXGGKEGFCXE 885 GGGGG GG GGG GG GG + C E Sbjct: 73 GGGGGRGGGRGGGDGGRGRGGSDLKCYE 100 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PP PP PPPPP Sbjct: 262 PPNRPP-PPSSPPPPPPPPP 280 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 865 KVLSXQTSXQKPSFPPXXPPXPPPXPP 945 K+L PS PP PP PPP PP Sbjct: 258 KILDPPNRPPPPSSPPP-PPPPPPTPP 283 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P+ PP P PPP PP P PP Sbjct: 263 PNRPPP-PSSPPPPPPPPPTPP 283 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG G GG++G Sbjct: 64 GGGGGYQGGDRGGRGSGGGGRDG 86 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG GG GG G Sbjct: 54 GGGGGRGNRGGGGGGYQGGDRG 75 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGG GG G GG GG+ G+ Sbjct: 30 GGGDAGYGGRGASGGGSYGGRGGY 53 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGG-XGGXXGGK 903 GGG G GG GGG GG GG+ Sbjct: 56 GGGRGNRGGGGGGYQGGDRGGR 77 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG G GG++G Sbjct: 64 GGGGGYQGGDRGGRGSGGGGRDG 86 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG GG GG G Sbjct: 54 GGGGGRGNRGGGGGGYQGGDRG 75 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGG GG G GG GG+ G+ Sbjct: 30 GGGDAGYGGRGASGGGSYGGRGGY 53 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGG-XGGXXGGK 903 GGG G GG GGG GG GG+ Sbjct: 56 GGGRGNRGGGGGGYQGGDRGGR 77 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 8/44 (18%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP--------PXPPXXPPPPP 966 P + T + P PP PP PP P PP PPPPP Sbjct: 694 PPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 9/36 (25%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPP---------XPPXXPPPPP 966 S +KP+ P PP PPP PP PP PP Sbjct: 680 SDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPP 715 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 919 PPXPPPXPPXXPPPP 963 PP PPP PP PP P Sbjct: 728 PPPPPPPPPPAPPTP 742 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 868 VLSXQTSXQKPSFPPXXPPXPP-PXPPXXPPPPP 966 + + ++S P PP P P PP PPPPP Sbjct: 747 ISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPP 780 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP PP PP P Sbjct: 727 PPPPPPPPPPPAPPTP 742 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PPP PP PPP P Sbjct: 717 PPTPIVHTSSPPPPPPPPPPPAP 739 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P ++ + S P+ PP P P PPPPP Sbjct: 760 PPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 9/45 (20%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP---------PPXPPXXPPPPP 966 P + + P PP PP P PP PP PP PP Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPP 718 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 127 GGGGQGGGGQGGGGGGAEGGTTG 149 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 904 FPPXXPPXPPPXPPXXPPPPP 966 + P P PPP P PPPPP Sbjct: 59 YSPYGNP-PPPSPQYSPPPPP 78 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEG 897 PGGGGG G G GG GGK G Sbjct: 326 PGGGGGNMGNQNQGGGGKNGGKGG 349 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGGGG GG GGG GG Sbjct: 123 GGGGGGGGGGGGGGGG 138 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGGGG GG GGG GG Sbjct: 124 GGGGGGGGGGGGGGGG 139 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 4/27 (14%) Frame = -1 Query: 965 GGGGGXXGGXGGG----XGGXXGGKEG 897 GGGGG G GGG GG GGK+G Sbjct: 360 GGGGGPNGNKGGGGVQMNGGPNGGKKG 386 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG GG G Sbjct: 313 GGGGGGPGGKKGGPGGG-GGNMG 334 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 120 GGGGGHGGGGGGGGGRGGGGGSG 142 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG G G Sbjct: 122 GGGHGGGGGGGGGRGGGGGSGNG 144 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 G GGG GG G G GG G EG+ Sbjct: 124 GHGGGGGGGGGRGGGGGSGNGEGY 147 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GGG GG GG G Sbjct: 118 GSGGGGGHGGGGGGGGGRGGGGG 140 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GGG G G EG Sbjct: 128 GGGGGGGRGGGGGSGNGEGYGEG 150 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG G G G G G+ Sbjct: 130 GGGGGRGGGGGSGNGEGYGEGGGY 153 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G G G G GGG GG GG G Sbjct: 112 GSGRGRGSGGGGGHGGGGGGGGG 134 >At3g46740.1 68416.m05074 chloroplast outer envelope protein, putative similar to chloroplastic outer envelope membrane protein (OEP75) [Pisum sativum] GI:633607; contains Pfam profile PF01103: outer membrane protein, OMP85 family Length = 818 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGG G GG GGG GG G GF Sbjct: 105 GGGDGNFGGFGGGGGGGDGNDGGF 128 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG G G GG GG G Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGGG 233 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GG G GG GGG GG G Sbjct: 218 GGNGSGGGGGGGGGGGRISG 237 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 Q + P PP PPP PP PPPP Sbjct: 188 QVNSSLPYSAVAIPPQPPPHPPPPPPPP 215 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPP 966 S P PP PP PPPPP Sbjct: 192 SLPYSAVAIPPQPPPHPPPPPP 213 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXP---PXXPPPPP 966 QTS P P P PPP P P PPPPP Sbjct: 381 QTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPP 412 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP PPP PPPPP Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPP 400 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPPG 969 PP PPP PP PPG Sbjct: 421 PPPPPPMSKKGPPKPPG 437 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPP 964 P PP P P P PPPP Sbjct: 396 PPPPPPKKGPAAPPPPPPP 414 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP PP PP PPPPP Sbjct: 405 PAAPP--PPPPPGKKGAGPPPPP 425 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 29.5 bits (63), Expect(2) = 0.18 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P S + S P+ P PPP PP PP P Sbjct: 259 PSSFSSPRKSNPIPNLASEFHPSPPPPPPPPPPLP 293 Score = 23.0 bits (47), Expect(2) = 0.18 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 940 PPXXPPPPP 966 PP PPPPP Sbjct: 329 PPPPPPPPP 337 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GG GG GG EG Sbjct: 238 GEGGGYGGGAAGGYGGGGGGGEG 260 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGGKEGF 894 GGG GG G G GG GG EG+ Sbjct: 58 GGGYGGGSGEGAGGGYGGAEGY 79 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG G G G+ Sbjct: 166 GGGGGHGGGGGGGSAGGAHGGSGY 189 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG GG GGG GG GG Sbjct: 242 GYGGGAAGGYGGGGGGGEGG 261 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GG GG GG G Sbjct: 107 GGGGGYGGAAGGHAGGGGGGSGG 129 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG G GG G Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGG 256 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GG GG GG G Sbjct: 252 GGGGGGGEGGGGSYGGEHGGGSG 274 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GG GG GG G Sbjct: 198 GGGGSHGGAGGYGGGGGGGSGG 219 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GG GG GG G Sbjct: 159 GYGGGAYGGGGGHGGGGGGGSAG 181 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG GG GG G Sbjct: 260 GGGGSYGGEHGGGSGGGHGGGGG 282 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GG GG GG G Sbjct: 40 GGGGGSGGVSSGGYGGESGGGYG 62 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = -1 Query: 965 GGGG--GXXGGXGGGXGGXXGG 906 GGGG G GG GGG GG GG Sbjct: 198 GGGGSHGGAGGYGGGGGGGSGG 219 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG G G Sbjct: 230 GGGYGSGGGEGGGYGGGAAGGYG 252 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GG GG GGG GG G G Sbjct: 114 GAAGGHAGGGGGGSGGGGGSAYG 136 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GG G GG+ G Sbjct: 36 GGGHGGGGGSGGVSSGGYGGESG 58 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXGGX--GGGXGGXXGGKEG 897 GGGGG GG G G GG GG G Sbjct: 174 GGGGGSAGGAHGGSGYGGGEGGGAG 198 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GG GG GG G Sbjct: 196 GAGGGGSHGGAGGYGGGGGGGSG 218 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GG G GG G G GG GG+ G Sbjct: 249 GGYGGGGGGGEGGGGSYGGEHG 270 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GGG GG GG G Sbjct: 185 GGSGYGGGEGGGAGG--GGSHG 204 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXGGXGG--GXGGXXGGKEG 897 GGGGG G GG G GG GG G Sbjct: 210 GGGGGGGSGGGGAYGGGGAHGGGYG 234 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G G G GG GG GG GG G Sbjct: 103 GAGEGGGGGYGGAAGGHAGGGGG 125 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSF-PPXXPPXPPPXPPXXPPPPP 966 P K + Q P++ PP P PP PP PP PP Sbjct: 172 PVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPP 208 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +1 Query: 892 QKPSFPPXXPPXPPP--XPPXXPPPP 963 Q+P FPP PPP PP PPPP Sbjct: 294 QEPYFPPSGQSQPPPTIQPPYQPPPP 319 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 7/33 (21%) Frame = +1 Query: 892 QKPS-FPPXXPPXP----PPXPPXXPP--PPPG 969 Q PS + P PP P PP PP PP PPPG Sbjct: 346 QHPSGYNPEEPPYPQQSYPPNPPRQPPSHPPPG 378 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 33.5 bits (73), Expect = 0.22 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PP P PPPPP Sbjct: 161 PPHFPPEFPPETPTTPPPPP 180 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P FPP PP P PP PP P Sbjct: 162 PHFPPEFPPETPTTPPPPPPRP 183 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 3/27 (11%) Frame = +1 Query: 895 KPSFPPXXPP-XPPPXPPXXP--PPPP 966 +PS P PP PP PP P PPPP Sbjct: 153 RPSSPDLPPPHFPPEFPPETPTTPPPP 179 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG GG G Sbjct: 155 GGGYGGGGGYGGGGGGYGGGGRG 177 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 G GG GG GGG GG GG G Sbjct: 106 GSGGGYGGGGGGYGGRGGGGRG 127 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 152 GGGGGGYGG-GGGYGGGGGGYGG 173 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG+ G Sbjct: 159 GGGGGYGGGGGGYGG--GGRGG 178 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG GG+ G Sbjct: 102 GGGRGSGGGYGGGGGG-YGGRGG 123 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GG G GG GGG GG G G+ Sbjct: 88 GGSSGGRGGFGGGRGGGRGSGGGY 111 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G G GGG GG GG G Sbjct: 98 GGGRGGGRGSGGGYGGGGGGYGG 120 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGFC 891 GGG G GG GG G GG G C Sbjct: 161 GGGYGGGGGGYGGGGRGGGGGGGSC 185 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGGGG G GGG GG Sbjct: 113 GGGGGYGGRGGGGRGG 128 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXG 909 GGG GG GGG GG G Sbjct: 147 GGGGYGGGGGGYGGGGG 163 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 KP PP P PPP P PPP P Sbjct: 112 KPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PP P PPPPP Sbjct: 127 PYTPPPPTPYTPPPPTVKPPPPP 149 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPX--PPPXPPXXPPPPP 966 P+ P PP PPP P PPPPP Sbjct: 85 PTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 31.9 bits (69), Expect = 0.66 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P + P P PP PP PPPP Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPPP 100 Score = 31.5 bits (68), Expect = 0.87 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PP PP PPPP Sbjct: 97 PPPPPTVKPPPPPYVKPPPP 116 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP P PPP P PPPP Sbjct: 123 PPPTPYTPPPPTPYTPPPP 141 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 KP PP P PPP PPP P Sbjct: 104 KPPPPPYVKPPPPPTVKPPPPPTP 127 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P + P PP P PP PPPP Sbjct: 70 PPYIPCPPPPYTPKPPTVKPPPP 92 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PPP P PPPPP Sbjct: 98 PPPPTVKPPPPPYVKPPPPP 117 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 KP PP P PP P P PPP Sbjct: 144 KPPPPPVVTPPPPTPTPEAPCPPP 167 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P P PPP P PPPP Sbjct: 155 PPTPTPEAPCPPPPPTPYPPPP 176 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +1 Query: 895 KPSFPPXX-PPXPPPXPPXXPPPPP 966 KP PP PP P PP PPPP Sbjct: 47 KPPKPPTVKPPTHTPKPPTVKPPPP 71 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 T P P PP P PP PP PPPP Sbjct: 126 TPYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP P P PPPPP Sbjct: 71 PYIPCPPPPYTPKPPTVKPPPPP 93 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 914 PPXPXPXPXXPXXPPPP 964 PP P P P P PPPP Sbjct: 153 PPPPTPTPEAPCPPPPP 169 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXP--PPXPPXXPPPPP 966 P+ P PP P PP P PPPP Sbjct: 117 PTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P P PPP P PPP P Sbjct: 156 PTPTPEAPCPPPPPTPYPPPPKP 178 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXX--PPPPP 966 P+ P PP P PP PPPPP Sbjct: 101 PTVKPPPPPYVKPPPPPTVKPPPPP 125 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = +1 Query: 871 LSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 +S Q S Q F PP PPP PP PPPPP Sbjct: 412 ISRQES-QDIDFSMLMPPPPPPPPP--PPPPP 440 >At3g16350.1 68416.m02068 myb family transcription factor ; contains Pfam profile: PF00249 Myb-like DNA-binding domain Length = 387 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEG 897 P GGG GG GGG GG GG G Sbjct: 19 PTRGGGTCGGSGGGGGGGGGGGSG 42 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 90 GGGGGHYGGGGGGYGG-GGGHHG 111 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG G GG G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNG 66 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 33.5 bits (73), Expect = 0.22 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 919 PPXPPPXPPXXPPPP 963 PP PPP PP PPPP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 33.5 bits (73), Expect = 0.22 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 922 PXPPPXPPXXPPPPP 966 P PPP PP PPPPP Sbjct: 247 PPPPPPPPPPPPPPP 261 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXG 909 PGGGGG GG G G GG G Sbjct: 839 PGGGGGGFGGLGSGTGGFGG 858 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXP-----PPPPG 969 P + L + ++PS PP P P PP P PPPPG Sbjct: 194 PPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPG 235 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 T PS PP PP PP PP P P P Sbjct: 136 TPITSPS-PPTNPPPPPESPPSLPAPDP 162 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPP----PXPPXXPPPPP 966 TS P+ PP P PP P PP P PPP Sbjct: 139 TSPSPPTNPPPPPESPPSLPAPDPPSNPLPPP 170 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPP 960 P PP P PPP P PPP Sbjct: 91 PVSPPPEPSPPPPLPTEAPPP 111 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P P P PP PPPPP Sbjct: 129 PTEAPPTTPITSPSPPTNPPPPP 151 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P P P PPP PP PPPPP Sbjct: 15 SPYSPHLHPPSAPLPPP-PPLPPPPPP 40 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GGG G GG Sbjct: 104 GGGGGYSGGGGGGYSGGGGG 123 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGG-XGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSG 111 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG G GGG G GG Sbjct: 96 GSGGGYRSGGGGGYSGGGGG 115 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GGG G GG Sbjct: 104 GGGGGYSGGGGGGYSGGGGG 123 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGG-XGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSG 111 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG GG GGG GG GG G Sbjct: 145 GGGRREGGGYGGGDGGSYGGGGG 167 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GGG GG Sbjct: 112 GGGGGYSGGGGGGYERRSGG 131 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXGGXGGG--XGGXXGGKEG 897 GGGGG G GGG GG GG +G Sbjct: 135 GGGGGGRGYGGGGRREGGGYGGGDG 159 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG G GGG G GG Sbjct: 96 GSGGGYRSGGGGGYSGGGGG 115 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGG 906 GGG GG GG GG GG Sbjct: 151 GGGYGGGDGGSYGGGGGG 168 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P P PPP P PPPPP Sbjct: 139 PKKSPSTPSLPPPTPKKSPPPPP 161 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 871 LSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 +S S PS P P PPP P PPPP Sbjct: 73 ISISPSTPIPS-TPSTPSPPPPAPKKSPPPP 102 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P K T + PS P P P P P P PPP Sbjct: 95 PKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPP 130 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFP-PXXP--PXPPPXPPXXPPPPP 966 PS P P P P PPP P PPPP Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPP 102 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +1 Query: 883 TSXQKPSF--PPXXPPXPPPXPPXXPPPPP 966 TS Q P PP PP P PP PPPP Sbjct: 637 TSPQSPPVHSPPPPPPVHSPPPPVFSPPPP 666 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P + +T P PP P PPP P PPPP Sbjct: 626 PPSPSTEETKTTSPQSPPVHSP-PPPPPVHSPPPP 659 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 P V S P P PP P PP PP PPPP Sbjct: 657 PPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP---PXPPXXPPPPP 966 P V S P PP P PP P PP PPPP Sbjct: 671 PPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 709 Score = 31.5 bits (68), Expect = 0.87 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP---PXPPXXPPPPP 966 P V S P PP P PP P PP PPPP Sbjct: 753 PPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 791 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 P V S P P PP P PP PP PPPP Sbjct: 707 PPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPP 745 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP------PXPPXXPPPPP 966 P V S Q P PP P PP P PP PPPP Sbjct: 721 PPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPP 762 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P + P PP P PP PPPP Sbjct: 747 PIYSPPPPPVHSPPPPVHSPPPP 769 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 P V S P P PP P PP P PPPPP Sbjct: 700 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PP P PPPPP Sbjct: 751 PPPPPVHSPPPPVHSPPPPP 770 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPP---PXPPXXPPPPP 966 P PP P PP P PP PPPP Sbjct: 648 PPPPPVHSPPPPVFSPPPPMHSPPPP 673 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 P V S P P PP P PP P PPPPP Sbjct: 650 PPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP--PPXPPXXPPPPP 966 P V S P P PP P P PP PPPP Sbjct: 686 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP--PPXPPXXPPPPP 966 P V S P P PP P P PP PPPP Sbjct: 693 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 730 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 600 PLWNPPXX*ALLXXXPXXXXXPPPPSXXPTPP 695 P+++PP + P PPPP P PP Sbjct: 738 PVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPP 769 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPXPP---PXPPXXPPPPP 966 PP P PP P PP PPPP Sbjct: 776 PPVHSPPPPVHSPPPPVHSPPPP 798 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPXPP---PXPPXXPPPPP 966 PP P PP P PP PPPP Sbjct: 783 PPVHSPPPPVHSPPPPVHSPPPP 805 Score = 28.3 bits (60), Expect = 8.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP---PXPP---XXPPPPP 966 P V S P P PP PP P PP PPPPP Sbjct: 714 PPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGG 906 GGGG GG GGG GG GG Sbjct: 138 GGGGYGGGEGGGYGGSGGG 156 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG G GG GG+ G Sbjct: 126 GGGGSYGGGRREGGGGYGGGEGG 148 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGG 906 GGGG GG GGG GG GG Sbjct: 155 GGGGYGGGEGGGYGGSGGG 173 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGG-XGGXXGGKEG 897 GGGGG GG GGG G GG G Sbjct: 90 GGGGGHRGGGGGGYRSGGGGGYSG 113 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GG GG G +EG Sbjct: 106 GGGGGYSGGGGSYGGGGGRREG 127 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GGG G G G Sbjct: 98 GGGGGYRSGGGGGYSGGGGSYGG 120 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG G GG GG+ G Sbjct: 143 GGGGSYGGGRREGGGGYGGGEGG 165 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG G G GG GG++G Sbjct: 403 GGGGDGGGGQGTGIGGGGGGEQG 425 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GG GGG G GG Sbjct: 186 GGGGGSFGGGGGGGAGSYGG 205 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG G GG G Sbjct: 187 GGGGSFGGGGGGGAGSYGGGGAG 209 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GGG G GG GF Sbjct: 195 GGGGGAGSYGGGGAGAGSGGGGGF 218 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 32.7 bits (71), Expect = 0.38 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP P PPPPP Sbjct: 150 PPPPPPMPRRSPPPPP 165 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPP 964 P PP P P P PPPP Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = -1 Query: 968 PGG--GGGXXGGXGGGXGGXXGGKEG 897 PGG GGG G GGG GG GG G Sbjct: 180 PGGASGGGPGGASGGGPGGASGGASG 205 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = -1 Query: 968 PGG--GGGXXGGXGGGXGGXXGGKEG 897 PGG GGG G GG GG GG G Sbjct: 144 PGGASGGGPGGASGGASGGASGGASG 169 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGGKEG 897 GGG G GGG GG GG G Sbjct: 177 GGGPGGASGGGPGGASGGGPG 197 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GG GG GG GG GG G Sbjct: 179 GPGGASGGGPGGASGGGPGGASG 201 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GGG GG GG G Sbjct: 139 GGGDKPGGASGGGPGGASGGASG 161 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PPP PP PPPPP Sbjct: 27 PPQYYPPPPPPPP--PPPPP 44 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P P PP P PP PPPPP Sbjct: 18 QGPPPPVGVPPQYYPPPPPPPPPPP 42 Score = 29.1 bits (62), Expect = 4.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 904 FPPXXPPXPPPXPP 945 +PP PP PPP PP Sbjct: 31 YPPPPPPPPPPPPP 44 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P PPPPP Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPP 39 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPP 963 S P PP PPP P PPPP Sbjct: 158 SSDPPLPPPPPPYPSPLPPPP 178 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXX-PPPPPG 969 P PP PP P P PP P P PG Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPG 185 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 32.7 bits (71), Expect = 0.38 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 6/42 (14%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXX----PPXPPPXPP--XXPPPPP 966 P + +S S + + PP PP PPP PP PPPPP Sbjct: 287 PKRSISLGDSTENRADPPPQKSIPPPPPPPPPPLLQQPPPPP 328 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPP 963 Q+P PP PPP PP PPPP Sbjct: 322 QQPPPPPSVSKAPPPPPP--PPPP 343 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +1 Query: 880 QTSXQKPSFPPXXP----PXPPPXPPXXPPPPP 966 Q S P PP P P PPP PPPPP Sbjct: 306 QKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPP 338 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPPG 969 S +K P P PPP PP PP G Sbjct: 17 STKKTKDMPSPLPLPPPPPPPLKPPSSG 44 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 8/31 (25%) Frame = +1 Query: 898 PSFPPXXPPX---PPPXP-----PXXPPPPP 966 P PP PP PPP P P PPPPP Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +1 Query: 907 PPXXPPX--PPPXPPXXPPPPP 966 PP PP PPP PP PPPP Sbjct: 427 PPPSPPVFSPPPSPPVYSPPPP 448 Score = 31.5 bits (68), Expect = 0.87 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPP 963 + PP PP PP PP PPP Sbjct: 409 ALPPPPPPSPPLPPPVYSPPP 429 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 5/28 (17%) Frame = +1 Query: 898 PSFPPXXPPXPPP--XPPXXPP---PPP 966 P PP PP PPP PP PP PPP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPP 438 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPX--PPPXPP-XXPPPPP 966 P PP PP PPP PP PPP P Sbjct: 415 PPSPPLPPPVYSPPPSPPVFSPPPSP 440 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPP 960 S KPS P P PPP P PPP Sbjct: 399 SVVKPSPPIVALPPPPPPSPPLPPP 423 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPP----XXPPPPP 966 P V S S S PP P PP PP PPPPP Sbjct: 421 PPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 32.7 bits (71), Expect = 0.38 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 922 PXPPPXPPXXPPPPPG 969 P PPP P PPPPPG Sbjct: 107 PPPPPPPSPSPPPPPG 122 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXP 954 PS PP PP PPP PP P Sbjct: 76 PSPPPTLPPSPPPPPPFSP 94 Score = 32.3 bits (70), Expect = 0.50 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP P PPPPP Sbjct: 75 PPSPPPTLPPSPPPPP 90 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP PP PP PPPP Sbjct: 75 PPSPPPTLPPSPP--PPPP 91 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +1 Query: 907 PPXXPPX--PPPXPPXXPPPPP 966 PP PP PPP PP PPPP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPP 548 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 P V S P P PP P PP PP PPPP Sbjct: 626 PPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPX---PPPXPPXXPPPPP 966 PP PP PPP P PPPPP Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPP 540 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P + P PP P PP PPPP Sbjct: 579 SPPPPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 + P PP P PPP P PPPPP Sbjct: 491 RSPPPPPVHSP-PPPSPIHSPPPPP 514 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPX--PPPXPPXXPPPPP 966 P P PP PPP PP PPPP Sbjct: 506 PIHSPPPPPVYSPPPPPPVYSPPPP 530 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP P PPPPP Sbjct: 510 PPPPPVYSP-PPPPPVYSPPPPP 531 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P PP PPPP Sbjct: 536 PPPPPPVHSPPPPVHSPPPP 555 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 P V S P P PP P PP PP PPPP Sbjct: 560 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP---PXPPXXPPPPP 966 P V S P PP P PP P PP PPPP Sbjct: 574 PPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P PP PPPP Sbjct: 616 PPPPPPVHSPPPPVFSPPPP 635 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PP PP PPPP Sbjct: 502 PPPSPIHSPPPPPVYSPPPP 521 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 P V S P P PP P PP P PPPPP Sbjct: 553 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PPP PP PPPP Sbjct: 609 PPPPVYSPPPPPPVHSPPPP 628 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PPP P PPPPP Sbjct: 503 PPSPIHSPPPPPVYSPPPPP 522 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPP---PXPPXXPPPPP 966 P PP P PP P PP PPPP Sbjct: 537 PPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P P P PP P PPPPP Sbjct: 594 SPPPPVHSPPPPVHSPPPPVYSPPPPP 620 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPP---PXPPXXPPPPP 966 P PP P PP P PP PPPP Sbjct: 617 PPPPPVHSPPPPVFSPPPPVHSPPPP 642 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP---PPXPPXXPPPPP 966 P V S P P PP P PP P PPPPP Sbjct: 619 PPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP--PPXPPXXPPPPP 966 P V S P P PP P P PP PPPP Sbjct: 539 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP--PPXPPXXPPPPP 966 P V S P P PP P P PP PPPP Sbjct: 546 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P PP PPP PPPP Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPP 532 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P PP PPP PPPP Sbjct: 520 PPPPVYSPPPPPPVYSPPPPPP 541 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P V S S PP P PP P PPPP Sbjct: 521 PPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -1 Query: 965 GGG--GGXXGGXGGGXGGXXGGKEGFCXEVWXXRTFXG 858 GGG GG G GG GG GG+ G+C R + G Sbjct: 60 GGGHNGGGYNGGGGYNGGGHGGRHGYCRYGCCYRGYHG 97 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP--PPXPPXXPPPPP 966 P KV + +P P PP P P PP PPPP Sbjct: 525 PPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPP 562 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP P P PP PPPP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPP 597 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = +1 Query: 886 SXQKPSFPPXX--PPXPP---PXPPXXPPPPP 966 S PS PP PP PP P PP PPPP Sbjct: 581 SPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPP 612 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPP---XXPPPPP 966 P V S S PP PPP PP PPPPP Sbjct: 560 PPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPX--PPPXPPXXPPPP 963 P V S P P PP PPP P PPPP Sbjct: 569 PPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPP 605 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPP 964 P PP P P P P PPP Sbjct: 536 PQPPMPSPSPPSPIYSPPP 554 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S P + P P PP P PPPP Sbjct: 544 SPPSPIYSPPPPVHSPPPPVYSSPPPP 570 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP P PP P PPPP Sbjct: 610 PPPSPVYSPPPPSHSPPPP 628 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P + P P PP P PPPP Sbjct: 614 PVYSPPPPSHSPPPPVYSPPPP 635 >At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative similar to SP|O94761 ATP-dependent DNA helicase Q4 (RecQ4) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 911 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S ++ + P+ PP P P P PPPPP Sbjct: 46 SSRSKPKAPTHPPPNPSQEAPVPSPYPPPPP 76 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +1 Query: 895 KPSFPPXXPPXPP-PXPPXXPPPPP 966 KP PP PP PP P P PPP P Sbjct: 61 KPVPPPACPPTPPKPQPKPAPPPEP 85 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 KP PP P P P P P PPP Sbjct: 21 KPVAPPGPSPCPSPPPKPQPKPPP 44 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 KP P PP P P PP P P P Sbjct: 74 KPQPKPAPPPEPKPAPPPAPKPVP 97 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 KP+ PP P PPP P P P P Sbjct: 78 KPAPPPEPKPAPPPAPKPVPCPSP 101 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 KP+ PP P P P PP P P P Sbjct: 86 KPAPPPAPKPVPCPSPPKPPAPTP 109 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS P P P P PP PPP P Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKP 121 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS P PP P P PP P P P Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSP 50 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP P PPP P P P P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSP 54 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS PP P P P PP PP PP Sbjct: 52 PSPPPKPQPKPVP-PPACPPTPP 73 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P P P P P PPP Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPP 91 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPPXA 970 P PP P P P P PPP A Sbjct: 102 PKPPAPTPKPVPPHGPPPKPA 122 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 +P PP P P P PP P P P Sbjct: 39 QPKPPPAPSPSPCPSPPPKPQPKP 62 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 PS P PP P P P P P P Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQP 40 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP P P P PPP P Sbjct: 36 PKPQPKPPPAPSPSPCPSPPPKP 58 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ P P PPP P P PPP Sbjct: 44 PAPSPSPCPSPPPKPQPKPVPPP 66 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP P P P PP PP Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPP 105 >At5g02600.2 68418.m00195 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P F PP PPP PP PP P Sbjct: 219 PDFKFSPPPPPPPSPPQSSPPSP 241 >At5g02600.1 68418.m00196 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P F PP PPP PP PP P Sbjct: 219 PDFKFSPPPPPPPSPPQSSPPSP 241 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 32.3 bits (70), Expect = 0.50 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPP 963 P PP PPP P PPPP Sbjct: 104 PKRPPPPPPKPQPPPPPP 121 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 KP PP PP P P PPPPP Sbjct: 103 KPKRPPPPPPKPQP-----PPPPP 121 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 868 VLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 V + T S PP PP P P PPPPP Sbjct: 312 VSTFNTKSSLRSQPPPPPPSPEHKAPAPPPPPP 344 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P+ PP P PPP PP PPP P Sbjct: 359 QFPASPPSQFPLPPPPPP--PPPSP 381 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 104 GGGGGHYGGGGGGHGG--GGHYG 124 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG G GG G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNG 66 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG GG GG G Sbjct: 118 GGGGHYGGGGGGYGG-GGGHHG 138 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = -1 Query: 965 GGGGGXXGGX--GGGXGGXXGG 906 GGGGG GG GGG GG GG Sbjct: 112 GGGGGHGGGGHYGGGGGGYGGG 133 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEG 897 PGGGGG G G G GG G+ G Sbjct: 99 PGGGGGPGSGCGSGTGGGNQGQGG 122 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGG 906 PG GG GG GGG G GG Sbjct: 10 PGRGGRGFGGRGGGPGFGPGG 30 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 5/28 (17%) Frame = +1 Query: 898 PSFPPXXPPXP-----PPXPPXXPPPPP 966 PS PP PP P PP P PPPPP Sbjct: 62 PSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P P PP P PP PPPP Sbjct: 48 QPPPPPSPPPPSCTPSPPPPSPPPP 72 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 8/35 (22%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXP--------PXXPPPPP 966 S PS P PP PP P P PPPPP Sbjct: 54 SPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPP 88 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPXPPP---XPPXXPPPPP 966 PP PP PPP P PPPPP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPP 46 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 5/38 (13%) Frame = +1 Query: 868 VLSXQTSXQKPSFPPXXPPXPP-----PXPPXXPPPPP 966 V+S + P PP PP PP P PP PPPPP Sbjct: 12 VVSPPMRGRVPLPPPPPPPPPPMRRRAPLPP--PPPPP 47 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 3/22 (13%) Frame = +1 Query: 910 PXXPPXPPPX---PPXXPPPPP 966 P PP PPP P PPPPP Sbjct: 39 PLPPPPPPPMRRRAPLPPPPPP 60 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXX--PPPPP 966 KP PP PP P PP PPPPP Sbjct: 91 KPLPPPLSPPQTTPPPPPAITPPPPP 116 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP P P P PPPPP Sbjct: 86 PALPPKPLPPPLSPPQTTPPPPP 108 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P + QT+ P P PP PP P PPPP Sbjct: 94 PPPLSPPQTTPPPP--PAITPPPPPAITPPLSPPPP 127 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP P P P PPPPP Sbjct: 140 PALPPKPLPPPLSPPQTTPPPPP 162 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PP PP P PP Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPP 64 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P P PP PP P PPPP Sbjct: 113 PPPPAITPPLSPPPPAITPPPP 134 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPP--PPP 966 P K L S + + PP PPP P PP PPP Sbjct: 89 PPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPP 126 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPXP-PP--XPPXXPPPPP 966 PP PP P PP PP PPPP Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPP 107 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +1 Query: 907 PPXXPPXP-PP--XPPXXPPPPP 966 PP PP P PP PP PPPP Sbjct: 139 PPALPPKPLPPPLSPPQTTPPPP 161 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 31.9 bits (69), Expect = 0.66 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP P P P PP PPPP Sbjct: 84 PPPTPSVPSPTPPVSPPPP 102 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPP 963 S P+ P P P P PP PPPP Sbjct: 161 SVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P + T P P P P P PP PPPP Sbjct: 86 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 120 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P + T P P P P P PP PPPP Sbjct: 104 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 138 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P + T P P P P P PP PPPP Sbjct: 122 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 156 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP----PPXPPXXPPPPP 966 P +S PS P PP P P PP PPPP Sbjct: 147 PTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P P P P PP Sbjct: 95 PPVSPPPPTPTPSVPSPTPP 114 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P P P P PP Sbjct: 113 PPVSPPPPTPTPSVPSPTPP 132 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P P P P PP Sbjct: 131 PPVSPPPPTPTPSVPSPTPP 150 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 PS PP P PP P P PP Sbjct: 175 PSPPPPVSPPPPTPTPSVPSPP 196 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP P PPP P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSP 83 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P + P PPP P PPPPP Sbjct: 93 PPYHHYITPSPPPPRPLPPPPPP 115 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 P PPP P PPPPP Sbjct: 101 PSPPPPRPLPPPPPPP 116 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 QT P PP P P P PPPP Sbjct: 67 QTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/22 (63%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGG-XGGXXGGK 903 GGGGG GG GGG GG GG+ Sbjct: 103 GGGGGRGGGRGGGSYGGGYGGR 124 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG G GGG GG GG Sbjct: 160 GGGGGGRYGSGGGGGGGGGG 179 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/24 (58%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -1 Query: 962 GGGGXXGGXGG--GXGGXXGGKEG 897 GGGG GG GG G GG GG+ G Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGG 114 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GG GGG G GG G Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGG 175 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GG GG GG G Sbjct: 97 GGRGGFGGGGGRGGGRGGGSYG 118 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 Q Q PS P P P PP PPPPP Sbjct: 26 QHQNQNPSLIPTRFFLPHPPPPPPPPPPP 54 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 K S PP PP P P PPPPP Sbjct: 504 KGSAPPPPPPPPLPTTIAAPPPPP 527 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 5/22 (22%) Frame = +1 Query: 919 PPXPPPXP-----PXXPPPPPG 969 PP PPP P P PPPPPG Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPG 544 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 5/22 (22%) Frame = +1 Query: 919 PPXPPPXP-----PXXPPPPPG 969 PP PPP P P PPPPPG Sbjct: 536 PPPPPPPPGTAAAPPPPPPPPG 557 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP PPPPP Sbjct: 549 PP--PPPPPPGTQAAPPPPP 566 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 7/29 (24%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXX-------PPPPP 966 S PP PP PPP PP PPPPP Sbjct: 452 SMPP--PPPPPPPPPAVMPLKHFAPPPPP 478 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 5/21 (23%) Frame = +1 Query: 919 PPXPPPXP-----PXXPPPPP 966 PP PPP P P PPPPP Sbjct: 549 PPPPPPPPGTQAAPPPPPPPP 569 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP PP PPPP Sbjct: 551 PPPPPPGTQAAPPPPPPPP 569 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P PPPPP Sbjct: 510 PPPPPPLPTTIAAPPPPPPP 529 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPP 966 P PP PP PPPPP Sbjct: 549 PPPPPPPPGTQAAPPPPPP 567 >At1g53640.1 68414.m06100 hypothetical protein ; expression supported by MPSS Length = 290 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGG G GG GGG GG GG Sbjct: 270 GGGCGGGGGCGGGCGGGCGG 289 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG GG GGG GG GG Sbjct: 786 GCGGGHHGGGGGGCGGCGGG 805 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG GG +G Sbjct: 793 GGGGGGCGGCGG--GGCGGGGDG 813 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 962 GGGGXXGGX-GGGXGGXXGGKEGFC 891 GGGG GG GGG GG G G C Sbjct: 783 GGGGCGGGHHGGGGGGCGGCGGGGC 807 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 31.9 bits (69), Expect = 0.66 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPP 963 P PP PPP PP PP P Sbjct: 255 PFAPPTPPPPPPPPPPRP 272 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPP 945 P L + P PP PP PPP PP Sbjct: 242 PASSLGKRDENSSPFAPPTPPPPPPPPPP 270 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 922 PXPPPXPPXXPPPPP 966 P PP PP PPPPP Sbjct: 255 PFAPPTPPPPPPPPP 269 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 P PP PP PPPPP Sbjct: 255 PFAPPTPPPPPPPPPP 270 >At5g62440.1 68418.m07837 expressed protein Length = 202 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGGGG GG GGG GG Sbjct: 183 GGGGGRRGGRGGGRGG 198 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEG 897 PG G GG GG GG GG+ G Sbjct: 171 PGANGNGHGGGRGGGGGRRGGRGG 194 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGK 903 GGG G GG GG GG GG+ Sbjct: 179 GGGRGGGGGRRGGRGGGRGGR 199 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P P PPP P PPPPP Sbjct: 67 PPSPYPHPHQPPPPPHVLPPPPP 89 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP PP P PP PPP P Sbjct: 37 PFSPPHHPPPPHFSPPHQPPPSP 59 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXP---PXXPPPPP 966 Q P P P PPP P P PPPPP Sbjct: 54 QPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P F P P P P P PPPP Sbjct: 47 PHFSPPHQPPPSPYPHPHPPPP 68 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +1 Query: 874 SXQTSXQKPSFPPXX---PPXPPPXPPXXPPPP 963 S Q P PP PP PP PP PPPP Sbjct: 15 SHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPP 47 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPP--PPP 966 P PP PP PP P PP PPP Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPP 57 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P P PPP P PPPP Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPP 47 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXP---PXPPPXPPXXPPPPP 966 P PP P P PP PP PPPP Sbjct: 63 PHPPPPSPYPHPHQPPPPPHVLPPPP 88 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPP 966 P P PPP PPPPP Sbjct: 19 PLPSPVPPPPSHISPPPPP 37 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPP 964 P PP P P P PPPP Sbjct: 63 PHPPPPSPYPHPHQPPPPP 81 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 31.5 bits (68), Expect = 0.87 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PPP P PPP Sbjct: 135 PPPPPPPPPPRSPNSASPPP 154 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGGGG GG GGG GG Sbjct: 123 GGGGGGGGGGGGGGGG 138 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGGGG GG GGG GG Sbjct: 124 GGGGGGGGGGGGGGGG 139 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPP 963 +KP P PP P P PP PPP Sbjct: 18 KKPKNRPPSPPPPLPLPPSPSPPP 41 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXX--PPXPPPXPPXXPPPPP 966 P+ PP PP P PP PPPPP Sbjct: 331 PTLPPLPVLPPVPIVNPPSLPPPPP 355 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 31.5 bits (68), Expect = 0.87 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP P P P PPP P Sbjct: 22 PPEKPPSPEPPPSPEPPPSP 41 >At3g10720.2 68416.m01291 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 619 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPP--XPPPXPPXXPP 957 P L + + P FPP PP PP PP PP Sbjct: 39 PPSQLPFEPPVESPFFPPSQPPIFVPPSQPPSLPP 73 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGGGG GG GGG GG Sbjct: 611 GGGGGGGGGPGGGGGG 626 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGK 903 GGGGG G GGG GG G+ Sbjct: 612 GGGGGGGGPGGGGGGGPYCGR 632 >At1g68390.1 68414.m07813 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266; expression supported by MPSS Length = 408 Score = 31.5 bits (68), Expect = 0.87 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXP 954 S PP PP PPP PP P Sbjct: 77 SLPPSPPPPPPPSPPSEP 94 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP PP PP P Sbjct: 79 PPSPPPPPPPSPPSEP 94 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXGGXGGG--XGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 77 GGGGGGLGGGGGGLLGGGGFGGGAG 101 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = -1 Query: 965 GGGGGXXGGXG--GGXGGXXGG 906 GGGGG GG G GG GG GG Sbjct: 85 GGGGGLLGGGGFGGGAGGGLGG 106 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 27.1 bits (57), Expect(2) = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%), Gaps = 3/19 (15%) Frame = +1 Query: 919 PPXP---PPXPPXXPPPPP 966 PP P P PP PPPPP Sbjct: 66 PPHPMMFSPPPPQPPPPPP 84 Score = 22.6 bits (46), Expect(2) = 1.1 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 904 FPPXXPPXPPPXPP 945 + P P PPP PP Sbjct: 34 YTPPPPQLPPPLPP 47 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP PPP PP P PP Sbjct: 26 PPKSPPPPPP-PPALPKPP 43 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GGG GG GG G Sbjct: 394 GNGGGSFYGGGGGRGGYGGGGSG 416 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG GG G G GG GG Sbjct: 379 GVGGGGAGGYGAGGGGNGGG 398 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGGKEG 897 GGG G GGG GG GG G Sbjct: 229 GGGYGDGYGGGHGGGYGGPGG 249 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPP 960 +FPP P PP PP PPP Sbjct: 65 AFPPPPPIYSPPPPPIYPPP 84 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPP--PXPPXXPPPPP 966 P V S + P P PP PP P P PPPPP Sbjct: 56 PPPVYSRPVAFPPPP-PIYSPPPPPIYPPPIYSPPPPP 92 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 865 KVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 K+L T+ Q P + P PP P P PPPPP Sbjct: 28 KLLQTTTNYQ-PIYSP--PPPPYRSPVTIPPPPP 58 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P PP P PPPPP Sbjct: 37 PPPPPVYSPPISPPPPPPPP 56 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP PP PP PPPPP Sbjct: 38 PPPPVYSPPISPPPPP--PPPPP 58 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 K S PP PP PP PPPPP Sbjct: 34 KYSPPPPPVYSPPISPPPPPPPPP 57 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 10/30 (33%) Frame = +1 Query: 907 PPXXPPXPPPXPPXX----------PPPPP 966 PP PP PPP PP PPPPP Sbjct: 45 PPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPP 966 S+ PP P PP PPPPP Sbjct: 32 SYKYSPPPPPVYSPPISPPPPP 53 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P PP P P PP PPPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGG 906 PGGGG GG GG GG GG Sbjct: 113 PGGGGLGGGGLPGGLGGLGGG 133 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG GGG G GG G Sbjct: 73 GAGGGLGGGLGGGAGSGLGGGLG 95 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG GG G G GG GG G Sbjct: 77 GLGGGLGGGAGSGLGGGLGGGSG 99 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP--PPXPPXXPPPPP 966 P V+S P P PP P PP P PPP P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMP 87 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 T P PP P PPP P PP P Sbjct: 68 TPPPMPMTPPPMPMAPPPMPMASPPMMP 95 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 TS P P PP PPP P PPP P Sbjct: 35 TSCDNPCQPNPSPP-PPPSNPSPPPPSP 61 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP P PPP Sbjct: 47 PPPPPSNPSPPPPSPTTTACPPP 69 >At4g15830.1 68417.m02408 expressed protein Length = 296 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/70 (25%), Positives = 32/70 (45%) Frame = +3 Query: 153 DDFSQITAVVTSQCXKNXAEDKVPEVEAALRTFGNCLKGLVDLNVLKTEIEEAKPNGALD 332 ++ + ++ +Q + DK+PE A R+ N L N EE G+ Sbjct: 217 NEMEEFGMILLAQMAADQLSDKLPEAREAARSMVNSLFEKFTWN------EEEDEEGSKQ 270 Query: 333 EVFKKYCDKS 362 E +KK+C+K+ Sbjct: 271 EAWKKFCEKN 280 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 928 PPPXPPXXPPPPP 966 PPP PP PPPPP Sbjct: 71 PPPPPPLSPPPPP 83 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPX--PPPXPPXXPPPPP 966 P P P PPP PP PPPP Sbjct: 58 PKHDPTKPGYGFPPPPPPPLSPPPP 82 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P+ P P PPP P PPPP Sbjct: 62 PTKPGYGFPPPPPPPLSPPPPP 83 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 928 PPPXPPXXPPPPP 966 PPP PP PPPPP Sbjct: 44 PPPPPPPRPPPPP 56 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 928 PPPXPPXXPPPPP 966 PPP PP PPPPP Sbjct: 45 PPPPPPRPPPPPP 57 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPP 945 T+ Q + PP PP PPP PP Sbjct: 37 TTGQTLTPPPPPPPRPPPPPP 57 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 919 PPXPPPXPPXXPPPP 963 PP PPP PP PPPP Sbjct: 45 PPPPPPRPP--PPPP 57 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPPP 966 KP P PP P P PP PP P Sbjct: 157 KPPPTPCPPPTPTPTPPVVTPPTP 180 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P+ PP P PP PP P PP Sbjct: 120 PTKPPPSTPKPPTKPPPSTPKPP 142 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PP P PP PP Sbjct: 36 PHKPPKHPVKPPKPPAVKPPKPP 58 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PP PP PP P Sbjct: 43 PVKPPKPPAVKPPKPPAVKPPTP 65 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPP 960 PP PP P PP PPP Sbjct: 119 PPTKPPPSTPKPPTKPPP 136 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP P PP PPP Sbjct: 130 PPTKPPPSTPKPPTTKPPP 148 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P P P PP P P P Sbjct: 153 PPHHKPPPTPCPPPTPTPTP 172 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGK 903 GGGGG GG GG G GG+ Sbjct: 607 GGGGGYGGGYGGASSGGYGGE 627 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG G G Sbjct: 603 GGGYGGGGGYGGGYGGASSGGYG 625 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXG 909 GGGGG GG GGG GG G Sbjct: 588 GGGGGGYGG-GGGYGGGGG 605 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG G GG G Sbjct: 591 GGGYGGGGGYGGGGGYGGGGGYG 613 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGG 906 GGGG GG GGG GG GG Sbjct: 601 GGGGGYGG-GGGYGGGYGG 618 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG GG GG G Sbjct: 597 GGGYGGGGGYGGG-GGYGGGYGG 618 >At2g30505.1 68415.m03716 Expressed protein Length = 321 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 928 PPPXPPXXPPPPP 966 PPP PP PPPPP Sbjct: 6 PPPPPPPPPPPPP 18 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 919 PPXPPPXPPXXPPPP 963 PP PPP PP PPPP Sbjct: 6 PPPPPPPPP--PPPP 18 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GG GG GG GGG G GG F Sbjct: 208 GGRGGARGGRGGGARGGRGGSRDF 231 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPP 966 + PP PP P P PP PPP Sbjct: 90 NIPPPSPPPPSPPPPSQACPPP 111 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP PP PP P PPPP Sbjct: 93 PPSPPPPSPPPPSQACPPPP 112 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPP--XPPXXPPPPP 966 P K + PS PP PP P PP PP PP Sbjct: 81 PIKCTPCLQNIPPPSPPPPSPPPPSQACPPPPLPPSPP 118 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P+ PP P PPP P PP P Sbjct: 122 PTSPPPTPASPPPAPASPPPAP 143 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPP 963 P+ PP P PPP P PP P Sbjct: 129 PASPPPAPASPPPAPASPPPAP 150 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 S T P PP P PPP P PP P Sbjct: 107 SAPTVSPPPVSPPPAPTSPPPTPASPPPAP 136 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P S S S PP PP P PP P PP Sbjct: 98 PQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPP 133 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP--PPXPPXXPPPPP 966 P V P P PP P PP P PPP P Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAP 150 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPP 957 P+ PP P PPP P PP Sbjct: 136 PASPPPAPASPPPAPVSPPP 155 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGG G GG GGG GG GG G+ Sbjct: 134 GGGYGGSGGYGGGAGG-YGGSGGY 156 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGGKEGF 894 GGG GG GG GG GG G+ Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGY 143 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG GG GG GG GG G Sbjct: 131 GGGGGGYGG-SGGYGGGAGGYGG 152 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXG 909 G GGG GG GGG GG G Sbjct: 124 GFGGGGYGGGGGGYGGSGG 142 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GG GG GG GG GG GG Sbjct: 154 GGYGGGAGGYGGNSGGGYGG 173 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GG GG GG G Sbjct: 151 GGSGGYGGGAGGYGGNSGGGYG 172 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG GG G GGG GG G G Sbjct: 158 GGAGGYGGNSGGGYGGNAAGGYG 180 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GG G GG GGG GG G G Sbjct: 148 GGYGGSGGYGGGAGGYGGNSGG 169 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GG GG G GGG G GG +G Sbjct: 82 GGSGGLGGSGGGGGGSGGGGGDG 104 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEG 897 PGG G GG GG GG G G Sbjct: 77 PGGNSGGSGGLGGSGGGGGGSGGG 100 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGK 903 GG GG GG GGG G GK Sbjct: 88 GGSGGGGGGSGGGGGDGSDGK 108 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG G GG G GG GF Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGF 84 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXGGXGGGX--GGXXGGKEG 897 GGGGG G GGG GG GG G Sbjct: 62 GGGGGSTGNNGGGSGSGGGGGGFGG 86 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXG 909 GGG GG GGG GG G Sbjct: 72 GGGSGSGGGGGGFGGSGG 89 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG G GGG G GG Sbjct: 62 GGGGGSIGNHGGGSGSGGGG 81 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 Q++ PP PP PPP PPPPP Sbjct: 221 QSAVGANGLPP--PPPPPPHQAQPPPPPP 247 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPP---XXPPPPP 966 P PP PPP PP PPPPP Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPPP 257 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PP PP P PPP Sbjct: 80 PPPPPHLLPLSPPLPPLLPLPPP 102 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -1 Query: 968 PGGGGGXXG--GXGGGXGGXXGG 906 PGGGGG G G G G GG GG Sbjct: 112 PGGGGGGGGDTGAGAGGGGYGGG 134 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GG G GG G Sbjct: 116 GGGGGDTGAGAGGGGYGGGGDTG 138 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGGKEG 897 GGG GG GGG GG G G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGG 116 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -1 Query: 965 GGGGGXXGGX-GGGXGGXXGGKEG 897 GGGGG GG GGG GG GG G Sbjct: 102 GGGGGYGGGTPGGGGGG--GGDTG 123 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 898 PSFPPXXPPX---PPPXPPXXPPPP 963 P PP PP PPP PP PPP Sbjct: 79 PPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Frame = +1 Query: 907 PPXXPP--XPPPXPPXXPPP 960 PP PP PPP PP PPP Sbjct: 69 PPNQPPNTTPPPTPPSSPPP 88 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXP-----PXXPPPPP 966 Q PP PP PPP P P PPPPP Sbjct: 93 QATRIPPPQPP-PPPQPLNLFSPPPPPPPP 121 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q ++PP PP P PPPPP Sbjct: 193 QPSAYPPPSTSGYPPIPSAYPPPPP 217 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG GG GG G Sbjct: 569 GGGGADYYGGGGGYGGVPGGGYG 591 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG G GGG G GG Sbjct: 577 GGGGGYGGVPGGGYGAMPGG 596 >At3g55790.1 68416.m06199 expressed protein predicted protein, Arabidopsis thaliana; expression supported by MPSS Length = 103 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGF 894 GGGGG GG GGG GG GG E F Sbjct: 59 GGGGGGRGG-GGGHGG--GGGEDF 79 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPP 966 SF P PP PPP P PPP Sbjct: 6 SFTPPPPPPPPPSFRSIPRPPP 27 >At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature Length = 348 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 919 PPXPPPXPPXXPPPP 963 PP PPP PP PP P Sbjct: 306 PPRPPPPPPSPPPTP 320 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = -1 Query: 965 GGGGGXXGGXGGG--XGGXXGG 906 GGGGG GG GGG GG GG Sbjct: 154 GGGGGGGGGLGGGGCGGGGCGG 175 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGG G GGG GG GG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGG 165 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +1 Query: 907 PPXXPPXPP-PXPPXXPPPPP 966 PP PP PP P P P PPP Sbjct: 72 PPPKPPEPPKPPEPEKPKPPP 92 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPP 963 KP PP P P PP P PP Sbjct: 75 KPPEPPKPPEPEKPKPPPAPEPP 97 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGFC 891 G GGG G GG GG GG G C Sbjct: 17 GCGGGGSSGGGGSSGGGGGGPCGAC 41 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGFC 891 GGGG GG GG G GG G C Sbjct: 14 GGGGCGGGGSSGGGGSSGGGGGGPC 38 >At2g41260.2 68415.m05096 glycine-rich protein / late embryogenesis abundant protein (M17) identical to late-embryogenesis abundant M17 protein GI:3342551 from [Arabidopsis thaliana] Length = 280 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 953 GXXGGXGGGXGGXXGGKEGFCXEVWXXR 870 G GG GGG GG G + G C W R Sbjct: 118 GGRGGGGGGGGGRGGCRWGCCGGWWRGR 145 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 953 GXXGGXGGGXGGXXGGKEGFCXEVWXXR 870 G GG GGG GG G + G C W R Sbjct: 173 GGRGGGGGGGGGRGGCRWGCCGGWWRGR 200 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 953 GXXGGXGGGXGGXXGGKEGFCXEVWXXR 870 G GG GGG GG G + G C W R Sbjct: 228 GGRGGGGGGGGGRGGCRWGCCGGWWRGR 255 >At2g41260.1 68415.m05095 glycine-rich protein / late embryogenesis abundant protein (M17) identical to late-embryogenesis abundant M17 protein GI:3342551 from [Arabidopsis thaliana] Length = 225 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 953 GXXGGXGGGXGGXXGGKEGFCXEVWXXR 870 G GG GGG GG G + G C W R Sbjct: 118 GGRGGGGGGGGGRGGCRWGCCGGWWRGR 145 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 953 GXXGGXGGGXGGXXGGKEGFCXEVWXXR 870 G GG GGG GG G + G C W R Sbjct: 173 GGRGGGGGGGGGRGGCRWGCCGGWWRGR 200 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGG G GGG GG GG G Sbjct: 68 GGGGHGLDGYGGGHGGHYGGGGG 90 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPX---PPXXPPPPP 966 P V S + P PP PPP PP PPPP Sbjct: 55 PPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPP 93 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 TS + PP PPP PP PPP Sbjct: 22 TSSDGSAAPPPTDSAPPPSPPADSSPPP 49 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P PP P PP PPP P Sbjct: 78 PPPPDLTPPPSSPPPPDAPPPIP 100 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPP 963 +S PS PP PPP PPPP Sbjct: 490 SSKMSPSVKAYPPPPPPPEYEPSPPPP 516 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPP--XXPPPPP 966 P PP PP P P PP PPPP Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPP 552 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPP 963 +S PS PP P PP PPPP Sbjct: 517 SSEMSPSVRAYPPPPPLSPPPPSPPPP 543 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 5/28 (17%) Frame = +1 Query: 898 PSFPPXXPPXPP-----PXPPXXPPPPP 966 P PP P PP P PP PPPP Sbjct: 532 PLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P P P PPP PPPPP Sbjct: 162 PESPSPPSPEPPPPSSLEPPPPP 184 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S + PS P P PPP PPPPP Sbjct: 161 SPESPS--PPSPEPPPPSSLEPPPPPP 185 >At1g53620.1 68414.m06094 glycine-rich protein Length = 143 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 G GGG G GGG GG GG G Sbjct: 76 GDGGGCDGDAGGGDGGGCGGCGG 98 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFC 891 GGGG GG G GG GG G C Sbjct: 73 GGGGDGGGCDGDAGGGDGGGCGGC 96 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 919 PPXPPPXPPXXPPPP 963 PP PPP PP PP P Sbjct: 234 PPGPPPPPPPPPPSP 248 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 931 PPXPPXXPPPPP 966 PP PP PPPPP Sbjct: 234 PPGPPPPPPPPP 245 >At5g11550.1 68418.m01347 expressed protein Length = 314 Score = 27.9 bits (59), Expect(2) = 2.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXP 954 Q PS P PP PPP PP P Sbjct: 74 QTPSTAPP-PPHPPPPPPPLP 93 Score = 20.6 bits (41), Expect(2) = 2.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 934 PXPPXXPPPPPG 969 P PP P PPG Sbjct: 130 PDPPSDPTCPPG 141 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPP 963 Q PS PP P P P PPPP Sbjct: 345 QSPSPPPPPPVIQPELPQPQPPPP 368 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG GG GGG GG GG G Sbjct: 81 GGGRREGGGYGGGDGGSYGGGGG 103 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXGGXGGG--XGGXXGGKEG 897 GGGGG G GGG GG GG +G Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDG 95 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGG 906 GGG GG GG GG GG Sbjct: 87 GGGYGGGDGGSYGGGGGG 104 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGGKEG 897 GGG GG GG GG GG+ G Sbjct: 76 GGGGRGGDRGGGGGGRGGRGG 96 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEGFCXE 885 GGG G G GGG G GG + C E Sbjct: 77 GGGRGGDRGGGGGGRGGRGGSDLKCYE 103 >At4g21620.1 68417.m03134 glycine-rich protein Length = 131 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 968 PGGGGGXXG-GXGGGXGGXXGGKEG 897 PG G G G G GGG GG GG G Sbjct: 44 PGFGNGFPGTGVGGGYGGGFGGPSG 68 >At2g27660.1 68415.m03352 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 718 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -1 Query: 965 GGGGGXXGGXG-GGXGGXXGGKEGF 894 GGGG GG G GG GG GG+ F Sbjct: 694 GGGGDANGGAGDGGGGGFFGGETEF 718 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GG GGG G GG G Sbjct: 67 GGGDGGGGGCGGGGGCGGGGGGG 89 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXG-GKEGFC 891 GGG GG GGG GG G G G C Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGC 82 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG GG GGG G GG Sbjct: 61 GDGGGDGGGDGGGGGCGGGG 80 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPP 966 PP P P P P PPPPP Sbjct: 224 PPPPPSQPLPRPLLLPPPPP 243 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXP---PXXPPPPP 966 P V + KP P PP PPP P PPPPP Sbjct: 226 PPHVKTDSFEFVKPD-PTPPPPPPPPIPVKQSATPPPPP 263 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP PPPPP Sbjct: 249 PPLPPPGTAALPPPPP 264 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPPG 969 P PP P P PPPPPG Sbjct: 604 PWGPPVPSYSPYALPPPPPG 623 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPPG 969 P PP P P PPPPPG Sbjct: 604 PWGPPVPSYSPYALPPPPPG 623 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPPP 966 P + S P PP PP PP PPPP Sbjct: 24 PLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPP 59 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +1 Query: 907 PPXXPPXPPPXPPX--XPPPPP 966 PP P PP PP PPPPP Sbjct: 98 PPSTPATTPPAPPQTVSPPPPP 119 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPPG 969 PP P P PP P PPG Sbjct: 134 PPKPSPSPPGETPSPPG 150 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXX---PPXPPPXPPXXPPPPP 966 P +LS +S + PP P P PP PPP P Sbjct: 6 PLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSP 44 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 + PS P P P P PPPPP Sbjct: 151 ETPSPPKPSPSTPTPTTTTSPPPPP 175 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP PPPPP Sbjct: 90 PPPPPPIENLPPPPPP 105 Score = 29.1 bits (62), Expect = 4.7 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = +1 Query: 868 VLSXQTSXQKPSFPPXXP--PXPPPXPP--XXPPPPP 966 VL Q +K S P P PPP PP PPPPP Sbjct: 68 VLLDQQHYEKQSRNNVDPASPQPPPPPPIENLPPPPP 104 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 898 PSFPPXXPPXPP-PXPPXXPPPPP 966 P+ PP P P P PP PPPP Sbjct: 400 PTSPPLSTPPPARPCPPVYSPPPP 423 >At5g17760.2 68418.m02083 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 341 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKE 900 GGGG GG GGG GG GG + Sbjct: 136 GGGGGVGGRGGG-GGRRGGMD 155 >At5g17760.1 68418.m02082 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 505 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKE 900 GGGG GG GGG GG GG + Sbjct: 136 GGGGGVGGRGGG-GGRRGGMD 155 >At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEAFY PETIOLE, putative nearly identical to AP2/EREBP-like transcription factor LEAFY PETIOLE [Arabidopsis thaliana] GI:6942018 Length = 211 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXXPP 957 S TS P PP PP PPP PP P Sbjct: 84 SSVTSIVSPDDPP--PPPPPPAPPSNDP 109 >At5g12370.1 68418.m01455 exocyst complex component Sec10-related low similarity to SP|O00471 Exocyst complex component Sec10 (hSec10) {Homo sapiens} Length = 858 Score = 29.5 bits (63), Expect = 3.5 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 10/99 (10%) Frame = +3 Query: 222 PEVEAALRTFGNCLKGLVD--------LNVLKTEI--EEAKPNGALDEVFKKYCDKSAXL 371 PEV+ L F + K LVD LN LK E+ +++K L E + A L Sbjct: 87 PEVDGLLSLFKDACKELVDLRKQVDGRLNTLKKEVSTQDSKHRKTLTEGVDGLFESFARL 146 Query: 372 KGCIXSVLQGVRPCVGXDYANHINDAQNSTNQLIDFVCY 488 G I SV Q +G D+ + + + +Q ID + Y Sbjct: 147 DGRISSVGQTAAK-IG-DHLQSADAQRETASQTIDLIKY 183 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 895 KPSFPPXXPPXPPPXPPXXPPPP 963 KPS P P P P P PPPP Sbjct: 31 KPSPKPKPVPSPKPKPVQCPPPP 53 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 880 QTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 Q Q S PP PP P PP PPP Sbjct: 860 QPPLQPQSQPPEPPPEMMPPPPQALPPP 887 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 968 PGGGGGXX---GGXGGGXGGXXGGKEGF 894 PGGGGG GG GGG G GG G+ Sbjct: 121 PGGGGGGVVIGGGFGGGAGYGSGGGLGW 148 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = -1 Query: 965 GGGGGXXGGXGGG--XGGXXGGKEGFC 891 GGG G GG GGG GG GG G C Sbjct: 163 GGGIGGGGGIGGGVIIGGGGGGCGGSC 189 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Frame = -1 Query: 965 GGGGGXXGGX--GGGXGGXXGGKEG 897 GGGGG GG GGG GG G G Sbjct: 167 GGGGGIGGGVIIGGGGGGCGGSCSG 191 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEGFC 891 GGGG GG G G G GG G C Sbjct: 162 GGGGIGGGGGIGGGVIIGGGGGGC 185 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G GG GG G G Sbjct: 180 GGGGGCGGSCSGGGGGGGGYGHG 202 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 968 PGGGGGXXGGXGGGXGGXXGGKEG 897 PG GGG G GGG G GG G Sbjct: 112 PGYGGGGYGPGGGGGGVVIGGGFG 135 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +1 Query: 892 QKPSFPPXX--PPXPPPXPPXXPPPPP 966 + P PP PP PPP PPPPP Sbjct: 158 KSPPPPPYVYSPPPPPPYVYQSPPPPP 184 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXG 909 GGG G GG GGG GG G Sbjct: 123 GGGVGGLGGVGGGVGGLGG 141 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPPX--PPXXPPPPP 966 P P PP PPP PP P PPP Sbjct: 378 PRPPYGPPPGPPPMMRPPLPPGPPP 402 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPPG 969 PP PP PP P PP PPG Sbjct: 380 PPYGPPPGPP-PMMRPPLPPG 399 >At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing protein similar to zinc finger protein OBP4 gi:5059396 from [Arabidopsis thaliana]; EMBL:AF155817 Length = 307 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 963 GGGGXXGXXGXGXGXGGXGERR 898 GGGG G G G GG G+RR Sbjct: 15 GGGGGGRFFGGGIGGGGGGDRR 36 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG GGG GG GG Sbjct: 14 GGGGGGGRFFGGGIGGGGGG 33 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = +1 Query: 898 PSFPPXXPPXPPPX----PPXXPPPPP 966 P PP P PPP PP PPPP Sbjct: 160 PPRPPTRPKSPPPRKSSFPPSRSPPPP 186 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPP 964 P PP P P P PPPP Sbjct: 388 PPPPAPPPGSGGPKPPPPP 406 Score = 28.3 bits (60), Expect = 8.1 Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 7/44 (15%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP-------PPXPPXXPPPPPG 969 P K L + S +K S PP P P PP PP P PPPG Sbjct: 356 PPKFL--KVSSKKASAPPPPVPAPQMPSSAGPPRPP-PPAPPPG 396 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +1 Query: 907 PPXXPPXPPPXPP--XXPPPPPG 969 PP PP PP PPPPPG Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPG 407 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Frame = +1 Query: 898 PSFPPXXPPXPPPX----PPXXPPPPP 966 P PP P PPP PP PPPP Sbjct: 160 PPRPPTRPKSPPPRKSSFPPSRSPPPP 186 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 908 PXPPXPXPXPXXPXXPPPP 964 P PP P P P PPPP Sbjct: 388 PPPPAPPPGSGGPKPPPPP 406 Score = 28.3 bits (60), Expect = 8.1 Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 7/44 (15%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXP-------PPXPPXXPPPPPG 969 P K L + S +K S PP P P PP PP P PPPG Sbjct: 356 PPKFL--KVSSKKASAPPPPVPAPQMPSSAGPPRPP-PPAPPPG 396 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +1 Query: 907 PPXXPPXPPPXPP--XXPPPPPG 969 PP PP PP PPPPPG Sbjct: 385 PPRPPPPAPPPGSGGPKPPPPPG 407 >At5g11700.1 68418.m01367 glycine-rich protein predicted protein, Arabidopsis thaliana Length = 1411 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGG G GG GGG GG Sbjct: 733 GGGSGSPGGGGGGGGG 748 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXXPPP 960 S TS S PP P PPP PPP Sbjct: 21 SNGTSPSNESSPPTPPSSPPPSSISAPPP 49 >At4g33520.3 68417.m04762 metal-transporting P-type ATPase, putative (PAA1) nearly identical to gi:2668492; contains Pfam heavy-metal-associated domain PF00403 Length = 949 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGG G G GG GG GG E Sbjct: 105 GGGSGFGGYNGGSGGGGGGGSE 126 >At4g33520.2 68417.m04761 metal-transporting P-type ATPase, putative (PAA1) nearly identical to gi:2668492; contains Pfam heavy-metal-associated domain PF00403 Length = 949 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGG G G GG GG GG E Sbjct: 105 GGGSGFGGYNGGSGGGGGGGSE 126 >At4g33520.1 68417.m04760 metal-transporting P-type ATPase, putative (PAA1) nearly identical to gi:2668492; contains Pfam heavy-metal-associated domain PF00403 Length = 237 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGG G G GG GG GG E Sbjct: 105 GGGSGFGGYNGGSGGGGGGGSE 126 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 965 GGGGGXXGGXGGGXG 921 GGGGG GG GGG G Sbjct: 36 GGGGGGSGGGGGGGG 50 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXP--PXPPPXPPXXPPP--PP 966 P S ++ PS PP P P PP PP P P PP Sbjct: 125 PSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPP 164 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGGG GG GGG GG Sbjct: 200 GGGGSGFGGGGGGGGG 215 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGG 918 GGG G GG GGG GG Sbjct: 201 GGGSGFGGGGGGGGGG 216 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 868 VLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 V + + +P FP PP PP PP P P Sbjct: 19 VFADRRVLHEPFFPIDSPPPSPPSPPPLPKLP 50 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP P PPPP Sbjct: 23 PPPPPPPPSSSLPPPP 38 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP P PPPP Sbjct: 23 PPPPPPPPSSSLPPPP 38 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 886 SXQKPSFPPXXPPXPPPXPPXXPPPPP 966 S K SFP P P PP PPPPP Sbjct: 411 SSSKTSFPINVPNSQPRPPP--PPPPP 435 >At2g22800.1 68415.m02706 homeobox-leucine zipper protein 9 (HAT9) / HD-ZIP protein 9 identical to GB:U09341 Length = 274 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 965 GGGGGXXGGXGGGXG 921 GGGGG GG GGG G Sbjct: 226 GGGGGGNGGGGGGSG 240 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPP 966 S PP P P PP PPPP Sbjct: 75 SSPPPASPPPATPPPVASPPPP 96 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 868 VLSXQTSXQKPSFPPXXPPXP--PPXPPXXPPPPP 966 VL + Q P+ PP P P P PP PPP Sbjct: 13 VLIAGVTGQAPTSPPTATPAPPTPTTPPPAATPPP 47 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP P PP PPP Sbjct: 66 PPANPPPPVSSPPPASPPP 84 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPP--XPPXXPPPP 963 P V S + P+ PP PPP PP PPP Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPP 966 S PP P P PP PPPP Sbjct: 75 SSPPPASPPPATPPPVASPPPP 96 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 868 VLSXQTSXQKPSFPPXXPPXP--PPXPPXXPPPPP 966 VL + Q P+ PP P P P PP PPP Sbjct: 13 VLIAGVTGQAPTSPPTATPAPPTPTTPPPAATPPP 47 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PP P PP PPP Sbjct: 66 PPANPPPPVSSPPPASPPP 84 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPP--XPPXXPPPP 963 P V S + P+ PP PPP PP PPP Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGG GG GGG G GG Sbjct: 26 GGGGPAFGGRGGGPGRGYGG 45 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPP 957 PS PP P PPP PP PP Sbjct: 256 PSAPPYI-PSPPPSPPRPPP 274 Score = 24.2 bits (50), Expect(2) = 5.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPP 960 S PP PPP PP PPP Sbjct: 357 SDPPLVYSPPPPPPP--PPP 374 Score = 23.0 bits (47), Expect(2) = 5.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 940 PPXXPPPPP 966 PP PPPPP Sbjct: 394 PPPPPPPPP 402 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 919 PPXPPPXPPXXPPPPP 966 PP PPP PP PPP Sbjct: 38 PPPPPPPPPLSLSPPP 53 >At1g35830.1 68414.m04452 VQ motif-containing protein contains PF05678: VQ motif Length = 302 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 Query: 919 PPXPPPXPPXXPPPP 963 PP PPP PP PPPP Sbjct: 81 PPQPPPPPP--PPPP 93 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 Query: 868 VLSXQTSXQKPSFPPXXPPXPPPXPP 945 ++S Q PP PP PPP PP Sbjct: 68 LISDDILNQTHLLPPQPPPPPPPPPP 93 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 931 PPXPPXXPPPPP 966 PP PP PPPPP Sbjct: 81 PPQPPPPPPPPP 92 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPPPG 969 P PP P PP PPPPG Sbjct: 45 PQGYPPPPHGYPPAAYPPPPG 65 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 962 GGGGXXGGXGGGXGG 918 GGGG GG GGG GG Sbjct: 77 GGGGFGGGAGGGLGG 91 >At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from (Glycine max); contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 491 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPP--PP 966 PS PP PPP PP P P PP Sbjct: 51 PSSSISQPPTPPPGPPDSPAPSLPP 75 >At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) Length = 120 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGK 903 GGGGG G G GG GG+ Sbjct: 72 GGGGGFAAGGGAAAGGGGGGE 92 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 874 SXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 S T P+ PPP PP PPPP Sbjct: 49 SSATGPPPPACAITLKDSPPPPPPPPPPPP 78 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 931 PPXPPXXPPPPP 966 PP PP PPPPP Sbjct: 67 PPPPPPPPPPPP 78 >At3g43520.1 68416.m04614 expressed protein contains Pfam profile PF03647: Uncharacterised protein family (UPF0136) Length = 240 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 965 GGGGGXXGGX-GGGXGGXXGGKEG 897 GGGGG G GGG GG G +G Sbjct: 95 GGGGGIGGDKFGGGGGGGDGNDDG 118 >At2g28500.1 68415.m03463 LOB domain protein 11 / lateral organ boundaries domain protein 11 (LBD11) identical to SP|Q9SK08 LOB domain protein 11 {Arabidopsis thaliana} Length = 229 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 865 KVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 KV T PS P P PPP P P PP Sbjct: 17 KVTETTTPVNSPS--PTSSPPPPPSPQQPPQPP 47 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 959 GGGXXGGXGGGXGGXXGGKEG 897 GGG GG GGG G G EG Sbjct: 47 GGGAWGGGGGGGGAWGGEGEG 67 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPP 960 PP P PPP P PPP Sbjct: 30 PPARPTTPPPARPTTPPP 47 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP PPP PP PPP Sbjct: 641 PPPMAEMPPPPPPGEAPPP 659 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 23.8 bits (49), Expect(2) = 6.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 859 PXKVLSXQTSXQKPSFPPXXPPXPPPXPPXXPPPP 963 P + TS P P PP PP PPPP Sbjct: 547 PPSAEAAVTSSPLPPLKPLRILSRPPPPP--PPPP 579 Score = 23.0 bits (47), Expect(2) = 6.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 940 PPXXPPPPP 966 PP PPPPP Sbjct: 601 PPPPPPPPP 609 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 965 GGGGGXXGGXGGGXG-GXXGGK 903 GGGGG G GGG G G GG+ Sbjct: 646 GGGGGNRFGGGGGRGRGGSGGR 667 >At5g58540.1 68418.m07330 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 484 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 892 QKPSFPPXXPPXPPPXPPXXPPPPP 966 Q P PP P P P P P PP Sbjct: 106 QTPETPPAITPLPVPLAPAPSPSPP 130 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 901 SFPPXXPPXPPPXPPXXPPPPP 966 S PP P PP P PPPP Sbjct: 48 SSPPPPSPPPPSTPTTACPPPP 69 >At5g41460.1 68418.m05035 fringe-related protein strong similarity to unknown protein (pir||T13026) similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 524 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 928 PPPXPPXXPPPP 963 PPP PP PPPP Sbjct: 97 PPPSPPPPPPPP 108 >At5g20130.1 68418.m02396 expressed protein Length = 202 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 956 GGXXGGXGGGXGGXXGG 906 GG GG GGG GG GG Sbjct: 89 GGGNGGKGGGGGGWFGG 105 >At5g07540.2 68418.m00864 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 190 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GGG GG GG G Sbjct: 139 GGGDKPGGASGGGPGGASGGAVG 161 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXX--PPXPPPXPPXXPPPPP 966 P PP PP P P PPPPP Sbjct: 97 PHLPPHHLPPPFPGPYDSAPPPPPP 121 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXX--PPXPPPXPPXXPPPPP 966 P PP PP P P PPPPP Sbjct: 97 PHLPPHHLPPPFPGPYDSAPPPPPP 121 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXX--PPXPPPXPPXXPPPPP 966 P PP PP P P PPPPP Sbjct: 97 PHLPPHHLPPPFPGPYDSAPPPPPP 121 >At4g29240.1 68417.m04182 leucine-rich repeat family protein / extensin family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana] Length = 415 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 G GGG G GGG GG GG Sbjct: 31 GVGGGVGVGIGGGGGGGGGG 50 >At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 680 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 931 PPXPPXXPPPPP 966 PP PP PPPPP Sbjct: 254 PPLPPPPPPPPP 265 >At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 674 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 931 PPXPPXXPPPPP 966 PP PP PPPPP Sbjct: 254 PPLPPPPPPPPP 265 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 968 PGG-GGGXXGGXGGGXGGXXGG 906 PGG GGG G GGG G GG Sbjct: 335 PGGMGGGMPAGMGGGMPGMGGG 356 >At4g12880.1 68417.m02016 plastocyanin-like domain-containing protein Length = 141 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 928 PPPXPPXXPPPP 963 PPP PP PPPP Sbjct: 128 PPPPPPFTPPPP 139 >At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to RNA helicases GI:3775995, GI:3775987 from [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 616 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GG GG GG GG GG+ G Sbjct: 510 GGRSGGGGYGGSSGGYGGGRSG 531 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKE 900 GGGGG GG GG GG + Sbjct: 546 GGGGGSYGGSGGSSSRYSGGSD 567 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P PP P PPP PPPP Sbjct: 243 PQRPPMGGPPPPPHIGGSAPPPP 265 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPPPP 966 P + PP PP P PPP P Sbjct: 52 PLYSSTSPPPPPSPPQPLPPPAP 74 >At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain, PF00397: WW domain Length = 1088 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 962 GGGGXXGGXGGGXGGXXGGKEG 897 GGGG GGG GG GG G Sbjct: 838 GGGGTRWDSGGGFGGRGGGFSG 859 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGG G GGG GG GK+G Sbjct: 294 GGGHPQDGKNGGGGGGPNAGKKG 316 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 928 PPPXPPXXPPPP 963 PPP PP PPPP Sbjct: 55 PPPPPPPPPPPP 66 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 931 PPXPPXXPPPPP 966 PP PP PPPPP Sbjct: 55 PPPPPPPPPPPP 66 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPP 960 PP PP P PP PPP Sbjct: 473 PPVKPPTPTYSPPVQPPP 490 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPP 960 PP PP P PP PPP Sbjct: 523 PPVKPPTPTYSPPIKPPP 540 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPP 960 PP P PPP P PPP Sbjct: 151 PPTAPVMPPPQVPVMPPP 168 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGGKEG 897 GGGGG G G G GG G G Sbjct: 19 GGGGGSGDGSGSGDGGGSGDGGG 41 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = -1 Query: 965 GGGGGXXGGXGGGXG----GXXGGKEGF 894 GGGGG GGG G G GG E F Sbjct: 190 GGGGGYGSNFGGGGGYGVAGGVGGSENF 217 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPP 966 P P PPP PP PP P Sbjct: 56 PHSPSPPPPPPPQWGPPSP 74 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPP 966 P P PPP PP PP P Sbjct: 56 PHSPSPPPPPPPQWGPPSP 74 >At1g54060.1 68414.m06160 expressed protein similar to 6b-interacting protein 1 (NtSIP1) [Nicotiana tabacum] GI:18149189 Length = 383 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGG G G GGG G GG Sbjct: 68 GGGSGNRNGRGGGGGSGGGG 87 >At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kinase 2 (SERK2) nearly identical to somatic embryogenesis receptor-like kinase 2 [Arabidopsis thaliana] GI:14573457; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; identical to cDNA somatic embryogenesis receptor-like kinase 2 (SERK2) GI:14573456 Length = 628 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 883 TSXQKPSFPPXXPPXPPPXPPXXPPPPPG 969 TS P PP PP PP PP P P G Sbjct: 209 TSRPCPGSPPFSPP-PPFIPPPIVPTPGG 236 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPP--PP 966 P+ PP PP PP P PP PP Sbjct: 103 PTKPPVKPPVSPPAKPPVKPPVYPP 127 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +1 Query: 898 PSFPPXXPPXPPPXPPXXPPP--PP 966 P+ PP PP PP P PP PP Sbjct: 175 PTKPPVKPPVSPPAKPPVKPPVYPP 199 >At1g17790.1 68414.m02202 DNA-binding bromodomain-containing protein similar to SP|P13709 Female sterile homeotic protein (Fragile-chorion membrane protein) {Drosophila melanogaster}; contains Pfam profile PF00439: Bromodomain Length = 487 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 910 PXXPPXPPPXPPXXPPPPP 966 P P P P P PPPPP Sbjct: 267 PAIVPSPSPSSPPPPPPPP 285 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 965 GGGGGXXGGXGGGXGGXXGG 906 GGGGG G GGG G GG Sbjct: 53 GGGGGGDGTKGGGDGISGGG 72 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 907 PPXXPPXPPPXPPXXPPPP 963 PP P PP PP PPP Sbjct: 654 PPPMPGMAPPPPPEEAPPP 672 >At5g46780.2 68418.m05763 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 23.8 bits (49), Expect(2) = 9.7 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 919 PPXPPPXPPXXPPP 960 PP PPP PP P Sbjct: 102 PPPPPPPPPVQSVP 115 Score = 22.6 bits (46), Expect(2) = 9.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 907 PPXXPPXPPP 936 PP PP PPP Sbjct: 101 PPPPPPPPPP 110 >At5g46780.1 68418.m05762 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 23.8 bits (49), Expect(2) = 9.7 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 919 PPXPPPXPPXXPPP 960 PP PPP PP P Sbjct: 102 PPPPPPPPPVQSVP 115 Score = 22.6 bits (46), Expect(2) = 9.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 907 PPXXPPXPPP 936 PP PP PPP Sbjct: 101 PPPPPPPPPP 110 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,802,908 Number of Sequences: 28952 Number of extensions: 316031 Number of successful extensions: 11829 Number of sequences better than 10.0: 246 Number of HSP's better than 10.0 without gapping: 1426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6982 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2353558416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -