BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F22 (921 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1685.10 |rps27||40S ribosomal protein S27|Schizosaccharomyce... 75 1e-14 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 52 1e-07 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 47 4e-06 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 46 8e-06 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 44 2e-05 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 42 9e-05 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 42 2e-04 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 41 2e-04 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 39 0.001 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 37 0.005 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 37 0.005 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 34 0.025 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 34 0.033 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 25 0.24 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 30 0.40 SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyc... 30 0.53 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 30 0.53 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 30 0.53 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 28 2.1 SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosacch... 28 2.1 SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pomb... 27 2.8 SPCC830.07c |psi1|psi|DNAJ domain protein Psi1|Schizosaccharomyc... 27 2.8 SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 27 3.7 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 27 3.7 SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schi... 27 3.7 SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|... 27 4.9 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 24 5.0 >SPBC1685.10 |rps27||40S ribosomal protein S27|Schizosaccharomyces pombe|chr 2|||Manual Length = 83 Score = 75.4 bits (177), Expect = 1e-14 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = +2 Query: 206 CYKITTVFSXAQRVVVCAGCSTILCQPTGGRARLTEGCSFRR 331 C+ ITTVFS AQ VV+C C+++LCQPTGG+ARL EGCSFRR Sbjct: 40 CFNITTVFSHAQTVVICGSCASVLCQPTGGKARLMEGCSFRR 81 Score = 55.2 bits (127), Expect = 1e-08 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 94 LAIDLLHPSPASERRXXKLKRLVPHPNSYFMDVKCPG 204 LA+DLL+PS SE R KLK+LV P S+FMDVKCPG Sbjct: 3 LAVDLLNPSHESEMRKHKLKQLVQGPRSFFMDVKCPG 39 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 52.0 bits (119), Expect = 1e-07 Identities = 40/141 (28%), Positives = 42/141 (29%), Gaps = 15/141 (10%) Frame = +1 Query: 541 PTXXPPXXXXXPXXXPXXG--PXPXXGGFXXPHXTXXXXPPRPXPXXPPPXTXP----PP 702 P P P P P P G PP P P PP P PP Sbjct: 1092 PPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPP 1151 Query: 703 XXXPXPXXPXPXP----PPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXP-----XXPXP 855 P P P P PP P P + + P P PP P P P Sbjct: 1152 VPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVP 1211 Query: 856 PPPXPPPXPXXXPPXPPPPXP 918 PP PP P PP P P Sbjct: 1212 PPSTAPPVPTPSAGLPPVPVP 1232 Score = 48.8 bits (111), Expect = 1e-06 Identities = 35/134 (26%), Positives = 38/134 (28%), Gaps = 8/134 (5%) Frame = +1 Query: 541 PTXXPPXXXXXPXXXPXXGPXPXXGGFXXPHXTXXXXPPRPXPXXPPPXTXPPPXXXPXP 720 P P P P P P P P P P + P P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSG 1081 Query: 721 XXPXPXP---PPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXP-----PP 876 P P P PP P P S+ + P P PP P PP P PP Sbjct: 1082 APPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPP 1141 Query: 877 XPXXXPPXPPPPXP 918 P PP P P Sbjct: 1142 VPKPSVAAPPVPAP 1155 Score = 48.8 bits (111), Expect = 1e-06 Identities = 39/135 (28%), Positives = 40/135 (29%), Gaps = 9/135 (6%) Frame = +1 Query: 541 PTXXPPXXXXXPXXXPXXGPXPXXGGFXXPHXTXXXXPPRPXPXXPPPXTXP----PPXX 708 PT PP P P PP P P PP P PP Sbjct: 1046 PTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVP 1105 Query: 709 XPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXP-----XXPXPPPPXPP 873 P P P P P P P P S+ P P PP P P P P P Sbjct: 1106 KPSVAVP-PVPAPSGAPPVPKP-----SVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAP 1159 Query: 874 PXPXXXPPXPPPPXP 918 P P PP P P Sbjct: 1160 PVPKPSVAAPPVPAP 1174 Score = 45.2 bits (102), Expect = 1e-05 Identities = 34/108 (31%), Positives = 35/108 (32%), Gaps = 4/108 (3%) Frame = +1 Query: 598 PXPXXGGFXXPHXTXXXXPPRPXPXXP-PPXTXP---PPXXXPXPXXPXPXPPPXXXPXX 765 P P G PP P P PP P PP P P P P P P Sbjct: 1084 PVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAP-PVPVPSGAPPV 1142 Query: 766 PXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXPPPXPXXXPPXPPP 909 P P S+ P P PP P PP P P PP P P Sbjct: 1143 PKP-----SVAAPPVPAPSGAPPVPKPSVAAPPVPAP-SSGIPPVPKP 1184 Score = 43.6 bits (98), Expect = 4e-05 Identities = 35/130 (26%), Positives = 35/130 (26%), Gaps = 4/130 (3%) Frame = +1 Query: 541 PTXXPPXXXXXPXXXPXXGPXPXXGGFXXPHXTXXXXPPRPXPXXPPPXTXPPPXXXPXP 720 P P P P P G PP P P PP P P P Sbjct: 1113 PVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVP 1172 Query: 721 XXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXPPPX----PXX 888 P PP P P S P PP P P PP P P P Sbjct: 1173 A-PSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPP-PSTAPPVPTPSAGLPPVP 1230 Query: 889 XPPXPPPPXP 918 P PP P Sbjct: 1231 VPTAKAPPVP 1240 Score = 39.5 bits (88), Expect = 7e-04 Identities = 32/129 (24%), Positives = 32/129 (24%), Gaps = 3/129 (2%) Frame = +1 Query: 541 PTXXPPXXXXXPXXXPXXGPXPXXGGFXXPHXTXXXXPPRPXPXXPPPXTXPPPXXXPXP 720 P P P P P G PP P P P P P P Sbjct: 1132 PVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVP-P 1190 Query: 721 XXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXPPP---XPXXX 891 P PP P P S P PP P PP P P P Sbjct: 1191 VPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVS 1250 Query: 892 PPXPPPPXP 918 P P P Sbjct: 1251 TPRSSVPSP 1259 Score = 38.7 bits (86), Expect = 0.001 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 2/86 (2%) Frame = +1 Query: 667 PXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXX 846 P PP PP P P P P P + L P P Sbjct: 982 PTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAP 1041 Query: 847 PXPPPPXPPPXP--XXXPPXPPPPXP 918 P P P PP P P PPP P Sbjct: 1042 PVPIPTSTPPVPKSSSGAPSAPPPVP 1067 Score = 35.9 bits (79), Expect = 0.008 Identities = 29/90 (32%), Positives = 30/90 (33%), Gaps = 5/90 (5%) Frame = +1 Query: 655 PRPX--PXXPPPXTXPPPXXXPXPXXPXPXPP--PXXXPXXPXPXXXXSSLLLXPPXGPX 822 PRP P PPP P P PP P P P + L PP P Sbjct: 961 PRPAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPA---APLARVPPV-PK 1016 Query: 823 XXPPXPXXPXPPPPXPP-PXPXXXPPXPPP 909 P P P PP P P PP P P Sbjct: 1017 LSSKAPPVPLPSADAPPIPVPSTAPPVPIP 1046 Score = 32.3 bits (70), Expect = 0.100 Identities = 26/105 (24%), Positives = 26/105 (24%), Gaps = 6/105 (5%) Frame = +2 Query: 620 SXXPTXQXPXXPPAPXPXXXPPPXXPPPXXPXPPPXPXPXPPPXXXXXXPXPXXXXXXXX 799 S P PP P PP P P P P PP P Sbjct: 1001 STSPAAPLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAP 1060 Query: 800 XXXXXXXXPXPXXPPXXXP--PPPXPPXXXXPPXXXP----PPXP 916 P P P PP P PP P PP P Sbjct: 1061 SAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVP 1105 Score = 31.9 bits (69), Expect = 0.13 Identities = 28/112 (25%), Positives = 30/112 (26%), Gaps = 4/112 (3%) Frame = +1 Query: 541 PTXXPPXXXXXPXXXPXXG----PXPXXGGFXXPHXTXXXXPPRPXPXXPPPXTXPPPXX 708 P P P P G P P G P + P+P PP PPP Sbjct: 1159 PPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPP---VPPPST 1215 Query: 709 XPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPP 864 P P PP P P S P P P P P Sbjct: 1216 APPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSSVPSPHSNASPSP 1267 Score = 26.6 bits (56), Expect = 4.9 Identities = 21/81 (25%), Positives = 22/81 (27%), Gaps = 1/81 (1%) Frame = +1 Query: 679 PPXTXPPPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXX-PPXPXXPXP 855 P PP P P P P P S + P P PP P Sbjct: 961 PRPAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSK 1020 Query: 856 PPPXPPPXPXXXPPXPPPPXP 918 PP P P PP P Sbjct: 1021 APPVP------LPSADAPPIP 1035 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 46.8 bits (106), Expect = 4e-06 Identities = 34/94 (36%), Positives = 34/94 (36%), Gaps = 5/94 (5%) Frame = +1 Query: 652 PPRPXPXXPPPXTXPPPXXXPXPXXPXPXP---PPXXXPXXPXPXXXXSSLLLXPPXGPX 822 P P P P PP P P P P P PP P P SSL PP Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIP----SSL---PP---- 173 Query: 823 XXPPXPXXPXPPPPXPPPXPXXXPPXPP--PPXP 918 P P P PP P P PP PP PP P Sbjct: 174 --PAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPP 205 Score = 39.5 bits (88), Expect = 7e-04 Identities = 23/78 (29%), Positives = 23/78 (29%) Frame = +2 Query: 629 PTXQXPXXPPAPXPXXXPPPXXPPPXXPXPPPXPXPXPPPXXXXXXPXPXXXXXXXXXXX 808 PT Q PP P P P PPP PP P PP P Sbjct: 131 PTPQSELRPPTSAP---PRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSA 187 Query: 809 XXXXXPXPXXPPXXXPPP 862 P PP PPP Sbjct: 188 PSLPSAVPPMPPKVPPPP 205 Score = 36.7 bits (81), Expect = 0.005 Identities = 22/73 (30%), Positives = 23/73 (31%), Gaps = 1/73 (1%) Frame = +1 Query: 658 RPXPXXPPPXTXPPPXXXPXPXXPXPXPP-PXXXPXXPXPXXXXSSLLLXPPXGPXXXPP 834 RP PP + PPP P P PP P P P S P P Sbjct: 138 RPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPM 197 Query: 835 XPXXPXPPPPXPP 873 P P PP P Sbjct: 198 PPKVPPPPLSQAP 210 Score = 35.9 bits (79), Expect = 0.008 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 745 PXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXPPPXPXXXPPXPPPPXP 918 P P P P PP P PP P P P PP P PP P P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPR-PSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAP 180 Score = 35.9 bits (79), Expect = 0.008 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 1/89 (1%) Frame = +2 Query: 644 PXXPPAPXP-XXXPPPXXPPPXXPXPPPXPXPXPPPXXXXXXPXPXXXXXXXXXXXXXXX 820 P P P P PP PP PPP P PP P Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPP---IPSKAPPIPSSLPPPAQPAAPV 181 Query: 821 XPXPXXPPXXXPPPPXPPXXXXPPXXXPP 907 P P PP PP PP P Sbjct: 182 KSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 Score = 35.1 bits (77), Expect = 0.014 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +1 Query: 787 SSLLLXPPXGPXXXPPXPXXPXPPPPXPPPXPXXXPPXP--PPPXP 918 SS PP P PP P PP PP P PP P PP P Sbjct: 118 SSASAAPPSAP--APPTPQSELRPPTSAPPRPSIPPPSPASAPPIP 161 Score = 35.1 bits (77), Expect = 0.014 Identities = 24/75 (32%), Positives = 25/75 (33%) Frame = +1 Query: 652 PPRPXPXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXP 831 PPRP PP PP P P PPP P P + P P P Sbjct: 144 PPRPS-IPPPSPASAPPIPSKAPPIPSSLPPP-AQPAAPVKSPPSA------PSLPSAVP 195 Query: 832 PXPXXPXPPPPXPPP 876 P P PPP P Sbjct: 196 PMPPKVPPPPLSQAP 210 Score = 31.5 bits (68), Expect = 0.17 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 847 PXPPPPXPPPXPXXXPPXPP 906 P PPPP P P P P PP Sbjct: 3 PAPPPPPPAPAPAAAAPAPP 22 Score = 31.1 bits (67), Expect = 0.23 Identities = 20/80 (25%), Positives = 20/80 (25%), Gaps = 1/80 (1%) Frame = +2 Query: 683 PPXXPPPXXPXPPPXPXPXPPPXXXXXXPXP-XXXXXXXXXXXXXXXXPXPXXPPXXXPP 859 PP P P P P PP P P P P P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKS 183 Query: 860 PPXPPXXXXPPXXXPPPXPP 919 PP P PP PP Sbjct: 184 PPSAPSLPSAVPPMPPKVPP 203 Score = 29.5 bits (63), Expect = 0.70 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 587 PXXAXXPSGGXSXXPTXQXPXXPPAPXPXXXPPPXXPPPXXPXPPPXPXPXPPP 748 P P+ P P P P P P PP PP P PPP Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIP----PPSPASAPPIPSKAPPIPSSLPPP 174 Score = 29.1 bits (62), Expect = 0.93 Identities = 25/108 (23%), Positives = 28/108 (25%) Frame = +1 Query: 541 PTXXPPXXXXXPXXXPXXGPXPXXGGFXXPHXTXXXXPPRPXPXXPPPXTXPPPXXXPXP 720 P PP P P P P + P P P P PPP P Sbjct: 154 PASAPPIPSKAP---PIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 Query: 721 XXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPP 864 P P P ++ P P P P PP P Sbjct: 211 VANTSSRPSSFAP----PAGHAPNVTSESPKFPNRGPSIPSASVPPVP 254 Score = 28.3 bits (60), Expect = 1.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 853 PPPPXPPPXPXXXPPXPPPP 912 P PP PPP P P PP Sbjct: 3 PAPPPPPPAPAPAAAAPAPP 22 Score = 26.6 bits (56), Expect = 4.9 Identities = 13/44 (29%), Positives = 14/44 (31%) Frame = +2 Query: 605 PSGGXSXXPTXQXPXXPPAPXPXXXPPPXXPPPXXPXPPPXPXP 736 PS + P P AP P P P PP P P Sbjct: 161 PSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPP 204 Score = 26.6 bits (56), Expect = 4.9 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +2 Query: 620 SXXPTXQXPXXPPA-PXPXXXPPPXXPPPXXPXPPPXPXPXPPP 748 S P PPA P PP P PP P PPP Sbjct: 162 SKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPP 205 Score = 26.2 bits (55), Expect = 6.5 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 693 PPPPPXPXPXXPPPPXP 743 PPPPP P P P P Sbjct: 6 PPPPPAPAPAAAAPAPP 22 Score = 25.8 bits (54), Expect = 8.6 Identities = 12/45 (26%), Positives = 13/45 (28%) Frame = +2 Query: 587 PXXAXXPSGGXSXXPTXQXPXXPPAPXPXXXPPPXXPPPXXPXPP 721 P + P P P P P PP PPP P Sbjct: 166 PIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 Score = 25.8 bits (54), Expect = 8.6 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +2 Query: 620 SXXPTXQXPXXPPAPXPXXXPPPXXPPPXXPXPPPXPXPXPP 745 S P P P P P PP P PP P P Sbjct: 169 SSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 46.0 bits (104), Expect = 8e-06 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +1 Query: 805 PPXGPXXXPPXPXXPXPPPPXPPPXPXXXPPXPPPPXP 918 PP PP P PPPP PP P P PPPP P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 37.9 bits (84), Expect = 0.002 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 693 PPPPPXPXPXXPPPPXPPPXPPXXPPP 773 PPPPP P P P P PP PPP Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 35.5 bits (78), Expect = 0.011 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +1 Query: 733 PXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPP--PPXPPPXPXXXPPXPP 906 P P P P PP P PP P P P PP PP P P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPS 1742 Query: 907 PPXP 918 P P Sbjct: 1743 VPNP 1746 Score = 35.5 bits (78), Expect = 0.011 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 656 PAPXPXXXPPPXXPPPXXPXPPPXPXPXPPPXXXXXXPXP 775 P P P PPP PP PP P P P P P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 34.3 bits (75), Expect = 0.025 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 661 PXPXXPPPXTXPPPXXXPXPXXPXPXPPP 747 P P PP PPP P P P PPP Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 33.5 bits (73), Expect = 0.043 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = +1 Query: 613 GGFXXPHXTXXXXPPRPXPXXPPPXTXP--PPXXXPXPXXPXPXPPPXXXPXXPXPXXXX 786 GG H P RP PP + P PP P P P P P P P Sbjct: 1679 GGMAPAHPVSTP-PVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPA 1737 Query: 787 SSLLLXPPXG 816 SS P G Sbjct: 1738 SSAPSVPNPG 1747 Score = 33.5 bits (73), Expect = 0.043 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +2 Query: 629 PTXQXPXXPPAPXPXXXPPPXXPPPXXPXPPPXPXPXPPPXXXXXXPXP 775 P P P + P P PPP PPP P P P P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 31.9 bits (69), Expect = 0.13 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = +1 Query: 667 PXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXX 846 P PP P P P P PPP P P + PP P PP P Sbjct: 1686 PVSTPP-VRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAG----PPSAP--PPPLPAS 1738 Query: 847 PXPPPPXP 870 P P P Sbjct: 1739 SAPSVPNP 1746 Score = 29.5 bits (63), Expect = 0.70 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +2 Query: 605 PSGGXSXXPTXQXPXXPPAPXPXXXPPPXXPPPXXPXPPPXP--XPXPPP 748 P+ S P PP PPP P P PP P P PP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPP 1732 Score = 27.1 bits (57), Expect = 3.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 693 PPPPPXPXPXXPPPPXPPPXPPXXPPP 773 PP P P PPPP P P P P Sbjct: 1721 PPMPAGPPS-APPPPLPASSAPSVPNP 1746 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 44.4 bits (100), Expect = 2e-05 Identities = 32/124 (25%), Positives = 33/124 (26%), Gaps = 2/124 (1%) Frame = +1 Query: 553 PPXXXXXPXXXPXXGPXPXXGGFXXPHXTXXXXPPRPXPXXPPPXTXPPPXXXPXPXXPX 732 PP P P P P R P PP P P P Sbjct: 363 PPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPS 422 Query: 733 --PXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXPPPXPXXXPPXPP 906 P PP P P + P PP P PP PP P PP P Sbjct: 423 LPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAP--APPPAP 480 Query: 907 PPXP 918 P P Sbjct: 481 APAP 484 Score = 39.9 bits (89), Expect = 5e-04 Identities = 35/144 (24%), Positives = 37/144 (25%), Gaps = 18/144 (12%) Frame = +1 Query: 541 PTXXPPXXXXXPXXXPXXGPXPXXGGFXXPHXTXXXXPPRPXPXX-------------PP 681 P PP P P P P PP P P PP Sbjct: 253 PPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAANKKRPP 312 Query: 682 PXTXPPPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXP-- 855 P P P P P P + + PP G PP P P Sbjct: 313 PPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPST 372 Query: 856 ---PPPXPPPXPXXXPPXPPPPXP 918 PPP PP PPP P Sbjct: 373 GRQPPPLSSSRAVSNPPAPPPAIP 396 Score = 38.7 bits (86), Expect = 0.001 Identities = 26/90 (28%), Positives = 26/90 (28%), Gaps = 3/90 (3%) Frame = +1 Query: 652 PPRPXPXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXP 831 PP P P P PP P PP P P P P Sbjct: 361 PPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTP 420 Query: 832 PXPXXPXPP--PP-XPPPXPXXXPPXPPPP 912 P PP PP PP P P PP P Sbjct: 421 PSLPPSAPPSLPPSAPPSLPMGAPAAPPLP 450 Score = 35.1 bits (77), Expect = 0.014 Identities = 31/101 (30%), Positives = 32/101 (31%), Gaps = 17/101 (16%) Frame = +1 Query: 667 PXXPPPXTXPPPXXXPXPXX----PXPXPPPXXXP--XXPXPXXXXSSLLLXPPXGPXXX 828 P PPP P P P P PPP P P S + PP P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAP-PPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAI 395 Query: 829 P--PXPXXP---------XPPPPXPPPXPXXXPPXPPPPXP 918 P P P PP P PP P PP PP P Sbjct: 396 PGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAP 436 Score = 30.7 bits (66), Expect = 0.30 Identities = 23/92 (25%), Positives = 24/92 (26%) Frame = +2 Query: 644 PXXPPAPXPXXXPPPXXPPPXXPXPPPXPXPXPPPXXXXXXPXPXXXXXXXXXXXXXXXX 823 P PP+ P PP P P PP P PPP P Sbjct: 230 PPIPPS-IPSSRPPERVPSLSAPAPP----PIPPPSNGTVSSPPNSPPRPIAPVSMNPAI 284 Query: 824 PXPXXPPXXXPPPPXPPXXXXPPXXXPPPXPP 919 PP P PPP PP Sbjct: 285 NSTSKPPLPPPSSRVSAAALAANKKRPPPPPP 316 Score = 29.5 bits (63), Expect = 0.70 Identities = 25/94 (26%), Positives = 27/94 (28%), Gaps = 16/94 (17%) Frame = +1 Query: 679 PPXTXPPPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXP- 855 P T PP P P P P P S+ + P P P P Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPA 283 Query: 856 -----PPPXPPPXP----------XXXPPXPPPP 912 PP PPP PP PPPP Sbjct: 284 INSTSKPPLPPPSSRVSAAALAANKKRPPPPPPP 317 Score = 27.9 bits (59), Expect = 2.1 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 2/70 (2%) Frame = +2 Query: 545 PXXXPXXXXXXXXXPXXAXXPSGGXSXXPTXQXPXXPPAPXPXXXPPPXXPPPXXPXPPP 724 P P P PS S P+ P P PP PP P PP Sbjct: 401 PALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPL--PPSAPIAPP 458 Query: 725 XPX--PXPPP 748 P P PP Sbjct: 459 LPAGMPAAPP 468 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 42.3 bits (95), Expect = 9e-05 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 829 PPXPXXPXPPPPXPPPXPXXXPPXPPPPXP 918 PP P PPPP PPP P PPPP P Sbjct: 753 PPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 39.5 bits (88), Expect = 7e-04 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +1 Query: 742 PPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPP---PXPPPXPXXXPPXPPPP 912 P P LLL P P PP P P P P PPP P P PPPP Sbjct: 710 PSPLLPDVSDTVEEQQKLLLKSPPPP---PPAVIVPTPAPAPIPVPPPAPIMGGPPPPPP 766 Query: 913 XP 918 P Sbjct: 767 PP 768 Score = 39.5 bits (88), Expect = 7e-04 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 5/32 (15%) Frame = +3 Query: 693 PPPPPXPXPXXPPPPXPPP-----XPPXXPPP 773 P PPP P PPPP PPP PP PPP Sbjct: 750 PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 39.1 bits (87), Expect = 9e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 644 PXXPPAPXPXXXPPPXXPPPXXPXPPPXPXPXPPP 748 P PPAP PPP PPP P P P PPP Sbjct: 750 PVPPPAPI-MGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 38.7 bits (86), Expect = 0.001 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = +2 Query: 680 PPPXXPPPXXPXPPPXPXPXPPPXXXXXXPXPXXXXXXXXXXXXXXXXPXPXXPPXXXPP 859 PPP P P P P P P PPP P P P P PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPP--------------PPPPPGVAGAGPPP 777 Query: 860 PPXPP 874 PP PP Sbjct: 778 PPPPP 782 Score = 38.3 bits (85), Expect = 0.002 Identities = 18/51 (35%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +1 Query: 772 PXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXPPP--XPXXXPPXPPPPXP 918 P + ++ P P PP PPP PPP PP PPPP P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 36.3 bits (80), Expect = 0.006 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 693 PPPPPXPXPXXPPPPXPPPXPP 758 PPPPP P PP PPP PP Sbjct: 762 PPPPPPPGVAGAGPPPPPPPPP 783 Score = 35.9 bits (79), Expect = 0.008 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +2 Query: 629 PTXQXPXXPPAPXPXXXPPPXXPPPXXPXPPP-----XPXPXPPP 748 P P PAP P P P P P PPP P P PPP Sbjct: 737 PAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 33.9 bits (74), Expect = 0.033 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = +1 Query: 667 PXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXX 846 P PPP P P P P P PPP P P PP P P Sbjct: 732 PPPPPPAVIVP---TPAP-APIPVPPPAPIMGGPPP----------PPPPPGVAGAGPPP 777 Query: 847 PXPPPP 864 P PPPP Sbjct: 778 PPPPPP 783 Score = 33.9 bits (74), Expect = 0.033 Identities = 20/59 (33%), Positives = 22/59 (37%) Frame = +1 Query: 697 PPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXPP 873 PP P P P P P P P P ++ PP P P PPPP PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPP-PAP------IMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 33.9 bits (74), Expect = 0.033 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 693 PPPPPXPXPXXPPPPXPPPXPPXXPPP 773 P P P P P PP P PP PPP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPPPPPPP 768 Score = 33.5 bits (73), Expect = 0.043 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 644 PXXPPAPX-PXXXPPPXXPPPXXPXPPPXPXPXPPPXXXXXXPXP 775 P PPA P P P PP P P P PPP P P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPP 777 Score = 32.7 bits (71), Expect = 0.075 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 693 PPPPPXPXPXXPPPPXPPPXPP 758 PPPPP P P PPP PP Sbjct: 761 PPPPPPPPGVAGAGPPPPPPPP 782 Score = 31.5 bits (68), Expect = 0.17 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +2 Query: 653 PPAPXPXXXPPPXXPPPXXPXPPPXPX----PXPPP 748 PP P P P P P P PPP P P PPP Sbjct: 732 PPPPPPAVIVPTPAPAPI-PVPPPAPIMGGPPPPPP 766 Score = 31.1 bits (67), Expect = 0.23 Identities = 20/72 (27%), Positives = 21/72 (29%) Frame = +1 Query: 667 PXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXX 846 P PP P P P P P P P P P P + PP P Sbjct: 733 PPPPPAVIVPTPAPAPIP-VPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSR 791 Query: 847 PXPPPPXPPPXP 882 P P P P Sbjct: 792 YYAPAPQAEPEP 803 Score = 30.7 bits (66), Expect = 0.30 Identities = 19/58 (32%), Positives = 22/58 (37%) Frame = +1 Query: 733 PXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXPPPXPXXXPPXPP 906 P PPP P P + + + PP PP P P PP P PP PP Sbjct: 733 PPPPPAVIVPTPAP----APIPVPPPAPIMGGPPPPPPPPGVAGAGPPPP---PPPPP 783 Score = 30.3 bits (65), Expect = 0.40 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 655 PRPXPXXPP-PXTXPPPXXXPXPXXPXPXPPPXXXP 759 P P P PP P PP P P PPP P Sbjct: 746 PAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 27.1 bits (57), Expect = 3.7 Identities = 13/51 (25%), Positives = 15/51 (29%) Frame = +3 Query: 765 PPPXXXXLLXXXXXXXXXXXXXPXXXXXXXPPPXXPPXXXXXPXXSPPPXP 917 PPP ++ P PPP PP PPP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 41.5 bits (93), Expect = 2e-04 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = -1 Query: 873 GGXGGG-GXXXGGXXGXGXXXXXXXXXXXXGXXXGXGXXXXXXGGGXGXGXGGGXGXXGG 697 GG GGG G G G G G G G GG G G GGG G GG Sbjct: 191 GGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPG-GFGGGPGGFGG 249 Query: 696 GXXGGGXXXGXGAGGXXG 643 G G G G GG G Sbjct: 250 GLGGFGGGPGGFGGGPGG 267 Score = 41.5 bits (93), Expect = 2e-04 Identities = 34/91 (37%), Positives = 34/91 (37%), Gaps = 2/91 (2%) Frame = -1 Query: 918 GGXGGGXXX-GGXXXXGGXGGGGXXXGGXXGXGXXXXXXXXXXXXGXXXGXGXXXXXXGG 742 GG GG GG GG GG G GG G G G GG Sbjct: 195 GGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPG------------GFEGGPGGFGG 242 Query: 741 GXGXGXGGGXGXXGGGXXG-GGXXXGXGAGG 652 G G G GGG G GGG G GG G G G Sbjct: 243 GPG-GFGGGLGGFGGGPGGFGGGPGGHGGPG 272 Score = 37.5 bits (83), Expect = 0.003 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 917 GXGGGGXGGXXXGXGGGXGGGGXGXXGXGGXXXGPXG 807 G GGG GG G GG GG G G GG GP G Sbjct: 224 GGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGG 260 Score = 34.3 bits (75), Expect = 0.025 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 769 GGXXGGXGGGXGGGGXXGXGXGGGGG 692 GG GG GGG GG G G GGG G Sbjct: 241 GGGPGGFGGGLGGFGGGPGGFGGGPG 266 Score = 32.7 bits (71), Expect = 0.075 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 917 GXGGGGXGGXXXGXGGGXGGGGXGXXGXGGXXXGP 813 G GGG GG G GG GGG G G G GP Sbjct: 238 GGFGGGPGGFGGGLGG-FGGGPGGFGGGPGGHGGP 271 Score = 31.1 bits (67), Expect = 0.23 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 769 GGXXGGXGGGXGGGGXXGXGXGGGGG 692 GG GG GGG GG G GG GG Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGG 212 Score = 30.7 bits (66), Expect = 0.30 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -2 Query: 773 GXGXXGXXXGGGXGXGXXGXGXXXGGGXVXGGGXXGXGRGGXXXXVXWGXXXPPXXGXGP 594 G G G GGG G G G G G G G G GG P G GP Sbjct: 187 GGGFGGF--GGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGP 244 Query: 593 XXGXXXGXXXXXGG 552 G G GG Sbjct: 245 -GGFGGGLGGFGGG 257 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 41.1 bits (92), Expect = 2e-04 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 5/96 (5%) Frame = +1 Query: 604 PXXGGFXXPHXTXXXXPPRPXPXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXXPX---- 771 P G P + P P PP P P P P PPP Sbjct: 148 PSASGVNAPTVSAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADAN 207 Query: 772 -PXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXPPP 876 P SS P P P P P PP PPP Sbjct: 208 EPDDYYSSGRAVSPEIPPTYTPKQADPLPAPPPPPP 243 Score = 35.1 bits (77), Expect = 0.014 Identities = 23/81 (28%), Positives = 24/81 (29%) Frame = +1 Query: 676 PPPXTXPPPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXP 855 PPP PP P P PP P P P + P P Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPP--PPPAVEDQAADANEPDD-YYSSGRAVSPEI 223 Query: 856 PPPXPPPXPXXXPPXPPPPXP 918 PP P P PPPP P Sbjct: 224 PPTYTPKQADPLPAPPPPPPP 244 Score = 33.1 bits (72), Expect = 0.057 Identities = 22/70 (31%), Positives = 23/70 (32%) Frame = +1 Query: 697 PPXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXPPXPXXPXPPPPXPPP 876 PP P P P PPP P P P +S L P P PPP Sbjct: 224 PPTYTPKQADPLPAPPPPPPPTLP-PQSTNTSQLPMPSRNVNNLGSQVNIP------PPP 276 Query: 877 XPXXXPPXPP 906 PP PP Sbjct: 277 ATPSQPPRPP 286 Score = 31.1 bits (67), Expect = 0.23 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 696 PPPPXPXPXXPPPPXPPPXPPXXPP 770 PP P P P PPP PP PP Sbjct: 224 PPTYTPKQADPLPAPPPPPPPTLPP 248 Score = 28.7 bits (61), Expect = 1.2 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 839 PPXXXPPPPXPPXXXXPPXXXPPPXPP 919 PP PP P P PPP PP Sbjct: 168 PPSFQPPSAAAPATSLPSDYNPPPPPP 194 Score = 25.8 bits (54), Expect = 8.6 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +1 Query: 808 PXGPXXXPPXPXXPXPPPPXPPPXPXXXPPXPPPPXP 918 P PP P P PP PPPP P Sbjct: 161 PNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPPP 197 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 38.7 bits (86), Expect = 0.001 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 842 PXXXPPPPXPPXXXXPPXXXPPPXPP 919 P PPPP PP PP PPP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 37.5 bits (83), Expect = 0.003 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 838 PXXPXPPPPXPPPXPXXXPPXPPPP 912 P P PPPP P P PP PPPP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 37.5 bits (83), Expect = 0.003 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 696 PPPPXPXPXXPPPPXPPPXPP 758 PPPP P P PP PPP PP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPP 29 Score = 36.7 bits (81), Expect = 0.005 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 693 PPPPPXPXPXXPPPPXPPPXPP 758 PPPPP P PP PPP PP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPPP 30 Score = 35.5 bits (78), Expect = 0.011 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 653 PPAPXPXXXPPPXXPPPXXPXPPPXP 730 PP P PPP PP P PPP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 35.1 bits (77), Expect = 0.014 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 659 APXPXXXPPPXXPPPXXPXPPPXPXPXPPP 748 A P PPP PPP PP P P PPP Sbjct: 2 ASLPPGNPPPPPPPPGF-EPPSQPPPPPPP 30 Score = 35.1 bits (77), Expect = 0.014 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 699 PPPXPXPXXPPPPXPPPXPPXXPPP 773 PP P P PPP PP P PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 33.9 bits (74), Expect = 0.033 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 702 PPXPXPXXPPPPX--PPPXPPXXPPP 773 PP P PPPP PP PP PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 32.7 bits (71), Expect = 0.075 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 805 PPXGPXXXPPXPXXPXPPPPXPPPXP 882 PP P PP P P P PPP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 32.7 bits (71), Expect = 0.075 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 829 PPXPXXPXPPPPXPPPXPXXXPPXPPP 909 PP P PPPP P P PP PPP Sbjct: 5 PPGNPPPPPPPPGFEP-PSQPPPPPPP 30 Score = 27.5 bits (58), Expect = 2.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 629 PTXQXPXXPPAPXPXXXPPPXXPPPXXP 712 P P PP P P PP PPP P Sbjct: 5 PPGNPP--PPPPPPGFEPPSQPPPPPPP 30 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 36.7 bits (81), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -2 Query: 917 GXGG--GGXGGXXXGXGGGXGGGGXGXXGXGGXXXGPXGG 804 G GG GG GG G GG GGG G G G G GG Sbjct: 17 GRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGG 56 Score = 33.9 bits (74), Expect = 0.033 Identities = 28/74 (37%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Frame = -2 Query: 905 GGXGGXXXGXGGGXGGGGXG-XXGXGGXXXGPXGGXRRREEXXXXGXGXXGXXXGGGXGX 729 GG GG G G G GG G G GG G GG R G G G GG G Sbjct: 9 GGRGGSRGGRG-GFNGGRGGFGGGRGGARGGGRGGAR-------GGRGGRGGAR-GGRGG 59 Query: 728 GXXGXGXXXGGGXV 687 G G GG V Sbjct: 60 SSGGRGGAKGGAKV 73 Score = 33.5 bits (73), Expect = 0.043 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 911 GGGGXGGXXXGXGGGXGGGGXGXXGXGGXXXGPXGGXRRREEXXXXGXG 765 G GG G G GGG GG G G G GG R G G Sbjct: 17 GRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRG 65 Score = 33.5 bits (73), Expect = 0.043 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = -1 Query: 774 GXGXXXXXXGGGXGXGXGGGXGXXG--GGXXGGGXXXGXGAGGXXGXCXV 631 G G GG G G GG G G GG GG G GG G V Sbjct: 24 GRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGGAKV 73 Score = 33.1 bits (72), Expect = 0.057 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 917 GXGGGGXGGXXXGXGGGXGGGGXGXXGXGGXXXGPXG 807 G GG GG GGG GG G G GG G G Sbjct: 23 GGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGG 59 Score = 33.1 bits (72), Expect = 0.057 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 772 GGGXXGGXGGGXGGGGXXGXGXGGGGG 692 GG GG GG GG G G GG GG Sbjct: 33 GGARGGGRGGARGGRGGRGGARGGRGG 59 Score = 32.3 bits (70), Expect = 0.100 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 917 GXGGGGXGGXXXGXGGGXGGGGXGXXGXGGXXXGPXGG 804 G GGG G G GG GG G G G G G GG Sbjct: 27 GFGGGRGGARGGGRGGARGGRG-GRGGARGGRGGSSGG 63 Score = 31.1 bits (67), Expect = 0.23 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = -2 Query: 911 GGGGXGGXXXGXGGGXGG--GGXGXXGXGGXXXGPXGGXRRREEXXXXGXGXXGXXXGGG 738 G GG G G GG GG GG G GG G GG R G G GG Sbjct: 10 GRGGSRGGRGGFNGGRGGFGGGRGG-ARGGGRGGARGG-RGGRGGARGGRGGSSGGRGGA 67 Query: 737 XG 732 G Sbjct: 68 KG 69 Score = 31.1 bits (67), Expect = 0.23 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 744 GGXGXGXGGGXGXXGGGXXGGGXXXGXGAGGXXG 643 GG G G GGG G GG GG G GG G Sbjct: 23 GGRG-GFGGGRGGARGGGRGGARGGRGGRGGARG 55 Score = 31.1 bits (67), Expect = 0.23 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 769 GGXXGGXGGGXGGG-GXXGXGXGGGGG 692 GG GG GG GGG G G GG GG Sbjct: 26 GGFGGGRGGARGGGRGGARGGRGGRGG 52 Score = 31.1 bits (67), Expect = 0.23 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = -3 Query: 772 GGGXXGGXGGGXGG--GGXXGXGXGGGG 695 GGG G GGG GG GG G G GG Sbjct: 29 GGGRGGARGGGRGGARGGRGGRGGARGG 56 Score = 30.3 bits (65), Expect = 0.40 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 787 RXXXXGGGXXGGXGGGXGGGGXXGXGXGGGGG 692 R GGG G GG G GG G G GG Sbjct: 32 RGGARGGGRGGARGGRGGRGGARGGRGGSSGG 63 Score = 28.7 bits (61), Expect = 1.2 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -1 Query: 744 GGXGXGXGGGXGXXGG-GXXGGGXXX--GXGAGGXXG 643 GG G GG G GG G GGG G G GG G Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARG 45 Score = 28.3 bits (60), Expect = 1.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -1 Query: 744 GGXGXGXGGGXGXXGGGXXGG-GXXXGXGAGGXXG 643 GG G G GG G GGG G G G GG G Sbjct: 16 GGRG-GFNGGRGGFGGGRGGARGGGRGGARGGRGG 49 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -2 Query: 767 GXXGXXXG-GGXGXGXXGXGXXXGGGXVXGGGXXGXGRGG 651 G G G GG G G G GG G G GRGG Sbjct: 10 GRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGG 49 Score = 25.8 bits (54), Expect = 8.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 917 GXGGGGXGGXXXGXGGGXGG--GGXGXXGXGGXXXG 816 G G GG G G GG GG G G G GG G Sbjct: 37 GGGRGGARGGRGGRGGARGGRGGSSG--GRGGAKGG 70 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 36.7 bits (81), Expect = 0.005 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 917 GXGGGGXGGXXXGXGGGXGGGGXGXXGXGGXXXGPXGGXRRR 792 G GG GG G GG GGG G GG G GG R R Sbjct: 153 GFGGNSRGGFGGGSRGGFGGGSRG-GSRGGFRGGSRGGFRGR 193 Score = 34.7 bits (76), Expect = 0.019 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 917 GXGGGGXGGXXXGXGGGXGGGGXGXXGXGGXXXGPXGGXR 798 G GG GG GG GGG G G GG G GG R Sbjct: 145 GGRGGSRGGFGGNSRGGFGGGSRGGFG-GGSRGGSRGGFR 183 Score = 32.3 bits (70), Expect = 0.100 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 772 GGGXXGGXGGGXGGGGXXGXGXGGGGG 692 GGG GG GGG GG G G GG Sbjct: 163 GGGSRGGFGGGSRGGSRGGFRGGSRGG 189 Score = 30.7 bits (66), Expect = 0.30 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 774 GXGXXXXXXGGGXGXGXGGG-XGXXGGGXXGG--GXXXGXGAGGXXG 643 G G GG G GGG G GGG GG G G GG G Sbjct: 146 GRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGGFRG 192 Score = 30.3 bits (65), Expect = 0.40 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -1 Query: 744 GGXGXGXGGGXGXXGG---GXXGGGXXXGXGAGGXXG 643 GG G GG G GG G GGG G G G G Sbjct: 141 GGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGG 177 Score = 29.9 bits (64), Expect = 0.53 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = -1 Query: 774 GXGXXXXXXGGGXGXGXGGGXGXXGGGXXG--GGXXXGXGAGGXXG 643 G G GG G G G GGG G GG G GG G Sbjct: 139 GRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRG 184 Score = 29.9 bits (64), Expect = 0.53 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 769 GGXXGGXGGGXGGGGXXGXGXGGGG 695 GG GG GG GG G G GGG Sbjct: 141 GGFRGGRGGSRGGFGGNSRGGFGGG 165 Score = 29.5 bits (63), Expect = 0.70 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = -3 Query: 769 GGXXGGXG----GGXGGGGXXGXGXGGGGG 692 GG GG G GG GGG G G G GG Sbjct: 148 GGSRGGFGGNSRGGFGGGSRGGFGGGSRGG 177 Score = 28.7 bits (61), Expect = 1.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 772 GGGXXGGXGGGXGGGGXXGXGXGGGGG 692 GG GG GGG GG G G GG Sbjct: 155 GGNSRGGFGGGSRGGFGGGSRGGSRGG 181 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 34.3 bits (75), Expect = 0.025 Identities = 29/107 (27%), Positives = 30/107 (28%), Gaps = 7/107 (6%) Frame = +1 Query: 619 FXXPHXTXXXXPPRPXPXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXX---PXPXXXXS 789 F H PP P P PPP P P PP P P P Sbjct: 197 FPAHHEPGEHMPPPPMHHKPGEHMPPPPMHHE-PGEHMPPPPMHHEPGEHMPPPPMHHEP 255 Query: 790 SLLLXPPX----GPXXXPPXPXXPXPPPPXPPPXPXXXPPXPPPPXP 918 + PP PP P P PPP P PP P Sbjct: 256 GEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 302 Score = 33.5 bits (73), Expect = 0.043 Identities = 28/103 (27%), Positives = 29/103 (28%), Gaps = 7/103 (6%) Frame = +1 Query: 631 HXTXXXXPPRPXPXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXX---PXPXXXXSSLLL 801 H PP P P PPP P P PP P P P + Sbjct: 214 HKPGEHMPPPPMHHEPGEHMPPPPMHHE-PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHM 272 Query: 802 XPPX----GPXXXPPXPXXPXPPPPXPPPXPXXXPPXPPPPXP 918 PP PP P P PPP P PP P Sbjct: 273 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 33.5 bits (73), Expect = 0.043 Identities = 28/103 (27%), Positives = 29/103 (28%), Gaps = 7/103 (6%) Frame = +1 Query: 631 HXTXXXXPPRPXPXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXX---PXPXXXXSSLLL 801 H PP P P PPP P P PP P P P + Sbjct: 227 HEPGEHMPPPPMHHEPGEHMPPPPMHHE-PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHM 285 Query: 802 XPPX----GPXXXPPXPXXPXPPPPXPPPXPXXXPPXPPPPXP 918 PP PP P P PPP P PP P Sbjct: 286 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 328 Score = 33.5 bits (73), Expect = 0.043 Identities = 28/103 (27%), Positives = 29/103 (28%), Gaps = 7/103 (6%) Frame = +1 Query: 631 HXTXXXXPPRPXPXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXX---PXPXXXXSSLLL 801 H PP P P PPP P P PP P P P + Sbjct: 240 HEPGEHMPPPPMHHEPGEHMPPPPMHHE-PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHM 298 Query: 802 XPPX----GPXXXPPXPXXPXPPPPXPPPXPXXXPPXPPPPXP 918 PP PP P P PPP P PP P Sbjct: 299 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 687 HXPPPP--PXPXPXXPPPPXPPPXPPXXPPP 773 H PPPP P PPPP PPP Sbjct: 206 HMPPPPMHHKPGEHMPPPPMHHEPGEHMPPP 236 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 687 HXPPPP--PXPXPXXPPPPXPPPXPPXXPPP 773 H PPPP P PPPP PPP Sbjct: 219 HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 249 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 687 HXPPPP--PXPXPXXPPPPXPPPXPPXXPPP 773 H PPPP P PPPP PPP Sbjct: 232 HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 262 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 687 HXPPPP--PXPXPXXPPPPXPPPXPPXXPPP 773 H PPPP P PPPP PPP Sbjct: 245 HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 275 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 687 HXPPPP--PXPXPXXPPPPXPPPXPPXXPPP 773 H PPPP P PPPP PPP Sbjct: 258 HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 288 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 687 HXPPPP--PXPXPXXPPPPXPPPXPPXXPPP 773 H PPPP P PPPP PPP Sbjct: 271 HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 301 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 687 HXPPPP--PXPXPXXPPPPXPPPXPPXXPPP 773 H PPPP P PPPP PPP Sbjct: 284 HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 314 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 687 HXPPPP--PXPXPXXPPPPXPPPXPPXXPPP 773 H PPPP P PPPP PPP Sbjct: 297 HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 327 Score = 27.9 bits (59), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +3 Query: 687 HXPPPP--PXPXPXXPPPPXPPPXPPXXPPP 773 H PPPP P PPPP PPP Sbjct: 310 HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 340 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 33.9 bits (74), Expect = 0.033 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 772 GGGXXGGXGGGXGGGGXXGXGXGGGG 695 GGG GG GG G GG G G GGG Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGG 471 Score = 29.5 bits (63), Expect = 0.70 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 746 GGGXGXGXXGXGXXXGGGXVXG-GGXXGXGRGG 651 GGG G G G G G G GG G GRGG Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGG 478 Score = 25.8 bits (54), Expect = 8.6 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 772 GGGXXGGXG-GGXGGGGXXGXGXGGGGG 692 GG G G GG GG G G G GGG G Sbjct: 447 GGSRGGRGGFGGRGGFGGRG-GFGGGRG 473 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 25.4 bits (53), Expect(2) = 0.57 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 717 PXXPPPPXPPP 749 P PPPP PPP Sbjct: 942 PAFPPPPPPPP 952 Score = 23.0 bits (47), Expect(2) = 2.7 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 732 PPXPPPXPPXXPPP 773 P PPP PP PPP Sbjct: 942 PAFPPPPPP--PPP 953 Score = 23.0 bits (47), Expect(3) = 0.24 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 892 PPXPPPPXP 918 PP PPPP P Sbjct: 945 PPPPPPPPP 953 Score = 22.6 bits (46), Expect(2) = 0.57 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 687 HXPPPPPXPXP 719 H PPPP P P Sbjct: 904 HPTPPPPPPLP 914 Score = 22.6 bits (46), Expect(2) = 2.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 726 PPPPXPPPXP 755 P PP PPP P Sbjct: 905 PTPPPPPPLP 914 Score = 22.2 bits (45), Expect(3) = 0.24 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +1 Query: 808 PXGPXXXPPXPXXPXPPPPXPPP 876 P P P PPPP P P Sbjct: 892 PNDATSLPTIITHPTPPPPPPLP 914 Score = 22.2 bits (45), Expect(3) = 0.24 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 880 PXXXPPXPPPP 912 P PP PPPP Sbjct: 942 PAFPPPPPPPP 952 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 30.3 bits (65), Expect = 0.40 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 829 PPXPXXPXPPPPXPPPXPXXXPPXPPPPXP 918 PP P P P P P P P P P P Sbjct: 107 PPLPNEPVPEEPLPGEPPLPDEPVPEEPLP 136 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 653 PPAPXPXXXPPPXXPPPXXPXPPPXPXPXPP 745 P P P P P P P P P P P P Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLPDEP 129 Score = 28.7 bits (61), Expect = 1.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 653 PPAPXPXXXPPPXXPPPXXPXPPPXPXPXPP 745 P P P P P P P P P P P P Sbjct: 115 PEEPLPGEPPLPDEPVPEEPLPGEPPLPNEP 145 Score = 27.5 bits (58), Expect = 2.8 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +1 Query: 628 PHXTXXXXPPRPXPXXP--PPXTXPPPXXXPXPXXPXPXPPPXXXPXXPXP 774 P PP P P P PP P P P P PP P P P Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPP--LPNEPVP 147 Score = 27.5 bits (58), Expect = 2.8 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +1 Query: 805 PPXGPXXXPPXPXXPXPPPPXPPPXPXXXPPXP-PPPXP 918 P P P P P P P P P P P PP P Sbjct: 104 PREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLP 142 Score = 25.8 bits (54), Expect = 8.6 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 829 PPXPXXPXPPPPXPPPXPXXXPPXP 903 PP P P P P P P P P Sbjct: 123 PPLPDEPVPEEPLPGEPPLPNEPVP 147 >SPAC26A3.16 |dph1|ucp5|UBA domain protein Dph1|Schizosaccharomyces pombe|chr 1|||Manual Length = 354 Score = 29.9 bits (64), Expect = 0.53 Identities = 21/74 (28%), Positives = 22/74 (29%) Frame = -2 Query: 917 GXGGGGXGGXXXGXGGGXGGGGXGXXGXGGXXXGPXGGXRRREEXXXXGXGXXGXXXGGG 738 G GG G GG GG GG G G + G G G Sbjct: 227 GLGGAGLGGLGGAGLGGFGGANNATAGIAGAAPVDQTAAANTIQNLLNNLGGAGF----G 282 Query: 737 XGXGXXGXGXXXGG 696 G G G G GG Sbjct: 283 AGLGDAGLGAGLGG 296 Score = 27.1 bits (57), Expect = 3.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 748 GGGXGGGGXXGXGXGGGGG 692 GGG GG G G G G GG Sbjct: 225 GGGLGGAGLGGLGGAGLGG 243 Score = 26.6 bits (56), Expect = 4.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 875 GGGXGGGGXGXXGXGGXXXGPXGG 804 GGG GG G G G GG G GG Sbjct: 225 GGGLGGAGLG--GLGGAGLGGFGG 246 Score = 26.2 bits (55), Expect = 6.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 747 GGGXGXGXGGGXGXXGGGXXGGGXXXGXGAGG 652 GGG G GG G G G GG G G Sbjct: 225 GGGLGGAGLGGLGGAGLGGFGGANNATAGIAG 256 Score = 26.2 bits (55), Expect = 6.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 Query: 772 GGGXXGGXGGGXGGGGXXGXG 710 GGG G GG GG G G G Sbjct: 225 GGGLGGAGLGGLGGAGLGGFG 245 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 29.9 bits (64), Expect = 0.53 Identities = 23/85 (27%), Positives = 25/85 (29%), Gaps = 3/85 (3%) Frame = +1 Query: 667 PXXPPPXTXPPPXXXPXPXXPXPXPPPXXXPXXPX-PXXXXSSLLLXPPXGPXXXPPXPX 843 P P P P P P P P P + + PP P P P Sbjct: 620 PQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVV-PEVPS 678 Query: 844 XPXPP--PPXPPPXPXXXPPXPPPP 912 P PP P P P PP P Sbjct: 679 VPQPPAVPVVPEAGQLNEPVVPPLP 703 Score = 27.9 bits (59), Expect = 2.1 Identities = 24/89 (26%), Positives = 26/89 (29%), Gaps = 2/89 (2%) Frame = +1 Query: 652 PPRPXPXXPPPXTXPP--PXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXX 825 P P PP P P P P P P + + PP P Sbjct: 524 PEAPSVHQPPAAPVAPEVPSAPQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQPPVAPVA 583 Query: 826 XPPXPXXPXPPPPXPPPXPXXXPPXPPPP 912 P P P PP P P P P PP Sbjct: 584 -PEVPSVPQPP--VAPVVP-EAPSVPQPP 608 Score = 27.9 bits (59), Expect = 2.1 Identities = 22/91 (24%), Positives = 25/91 (27%), Gaps = 2/91 (2%) Frame = +1 Query: 652 PPRPXPXXPPPXTXPP--PXXXPXPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXX 825 P P P PP P P P P P + ++ P P Sbjct: 593 PVAPVVPEAPSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQR 652 Query: 826 XPPXPXXPXPPPPXPPPXPXXXPPXPPPPXP 918 P P P P PP P P P P Sbjct: 653 -PAVPVVPEAPSVPQPPAAPVVPEVPSVPQP 682 Score = 27.1 bits (57), Expect = 3.7 Identities = 22/91 (24%), Positives = 24/91 (26%), Gaps = 3/91 (3%) Frame = +1 Query: 655 PRPXPXXPPPXTXPPPXXXP-XPXXPXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXXXP 831 P P P + P P P P P PP P + P P Sbjct: 577 PPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQ 636 Query: 832 PXPXXPXPPPPXPPPXP--XXXPPXPPPPXP 918 P P P P P P P P P Sbjct: 637 PPAAPVVPEVPSVPQRPAVPVVPEAPSVPQP 667 Score = 26.2 bits (55), Expect = 6.5 Identities = 22/92 (23%), Positives = 22/92 (23%), Gaps = 3/92 (3%) Frame = +2 Query: 653 PPAPXPXXXPPPXXPPPXXPXPPPXP-XPXPPPXXXXXXPXPXXXXXXXXXXXXXXXXPX 829 PPA P PP P P P P P P Sbjct: 517 PPAAPVVPEAPSVHQPPAAPVAPEVPSAPQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQ 576 Query: 830 PXXPP--XXXPPPPXPPXXXXPPXXXPPPXPP 919 P P P P PP P P PP Sbjct: 577 PPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPP 608 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 29.9 bits (64), Expect = 0.53 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 693 PPPPPXPXPXXPPPPXPP--PXPPXXPP 770 PPPPP P PP P PP PP Sbjct: 1883 PPPPPMALPKAGPPSAAPTSALPPAGPP 1910 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 27.9 bits (59), Expect = 2.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 814 GPXXXPPXPXXPXPPPPXPPPXPXXXPPXPPPP 912 G P P PP P P P PPPP Sbjct: 716 GAVNSPAIKPQVTPAPPTPAPTPAVKHHPPPPP 748 >SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 476 Score = 27.9 bits (59), Expect = 2.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -3 Query: 787 RXXXXGGGXXGGX--GGGXGGGGXXGXGXGGGGG 692 R GG GG GGG GG G G GGG Sbjct: 433 RAYQAGGSFPGGGFPGGGFPGGSYNSQGFGMGGG 466 >SPCC645.07 |rgf1||RhoGEF for Rho1, Rgf1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1334 Score = 27.5 bits (58), Expect = 2.8 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 1/59 (1%) Frame = +1 Query: 661 PXPXXPPPXTXPPPXXXPXPXXPXPXPPP-XXXPXXPXPXXXXSSLLLXPPXGPXXXPP 834 P P P P P P PPP P P P S L PP PP Sbjct: 25 PRKREPARTVSTPAFMEPAPVSKKPLPPPTRRLPRKPLPFRSTS---LQPPSSQPPAPP 80 >SPCC830.07c |psi1|psi|DNAJ domain protein Psi1|Schizosaccharomyces pombe|chr 3|||Manual Length = 379 Score = 27.5 bits (58), Expect = 2.8 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 875 GGGXGGGGXGXXGXGGXXXGPXGGXRRREEXXXXGXGXXGXXXGGGXG 732 GGG GGG G G GG R G GGG G Sbjct: 135 GGGGMGGGMGGMGGMDDDMDMDGGFGTRTRGGGMPGGFANMFGGGGAG 182 >SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 589 Score = 27.1 bits (57), Expect = 3.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 838 PXXPXPPPPXPPPXPXXXPPXPPP 909 P PP P P P PP PPP Sbjct: 164 PNPAMPPIPFLPFNPAAQPPFPPP 187 Score = 26.6 bits (56), Expect = 4.9 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +2 Query: 653 PPAPXPXXXPPPXXPP-PXXPXPPPXPXPXPPP 748 P P P P PP P P P P PPP Sbjct: 155 PSIPGFGNLPNPAMPPIPFLPFNPAAQPPFPPP 187 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 27.1 bits (57), Expect = 3.7 Identities = 26/97 (26%), Positives = 28/97 (28%), Gaps = 9/97 (9%) Frame = +1 Query: 655 PRPXPXXPPPXTXPPPXXXPXPXX---PXPXPPPXXXPXXPXPXXXXSSLLLXPPXGPXX 825 P+ P + PP P P P P P PP P Sbjct: 447 PQSAPALSMNPSSLPPWQQPTQQSAVQPSNLVPSQNAPFIPGTSAPLPPTTFAPPGVPL- 505 Query: 826 XPPXPXXPXPP------PPXPPPXPXXXPPXPPPPXP 918 PP P P P PP PP PP P P P Sbjct: 506 -PPIPGAPGMPNLNMSQPPMVPPG-MALPPGMPAPFP 540 Score = 26.2 bits (55), Expect = 6.5 Identities = 25/95 (26%), Positives = 27/95 (28%), Gaps = 9/95 (9%) Frame = +1 Query: 652 PPRPXPXXPP--PXTXPPPXXXPXPXXPXPXP-------PPXXXPXXPXPXXXXSSLLLX 804 P P P P P + P P P P P P P +S L Sbjct: 435 PSNPAPWQQPAAPQSAPALSMNPSSLPPWQQPTQQSAVQPSNLVPSQNAPFIPGTSAPLP 494 Query: 805 PPXGPXXXPPXPXXPXPPPPXPPPXPXXXPPXPPP 909 P P P P P P P PP PP Sbjct: 495 PTT--FAPPGVPLPPIPGAPGMPNLNMSQPPMVPP 527 Score = 26.2 bits (55), Expect = 6.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 693 PPPPPXPXPXXPPPPXPPPXPPXXPPP 773 PP P P P P P P P PP Sbjct: 532 PPGMPAPFPGYPAVPAMPGIPGATAPP 558 >SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 690 Score = 27.1 bits (57), Expect = 3.7 Identities = 25/86 (29%), Positives = 26/86 (30%), Gaps = 7/86 (8%) Frame = +1 Query: 676 PPPXTXPPPXXXPXPXXPXPXPPPXXXPXXP---XPXXXXSSLLLXPPXG-PXXXPPXPX 843 P P + PP P P P P P P P S L P P P P Sbjct: 132 PFPHSHHPPLHNPLPVSCQPVLRPPPVPQVPSHWYPVSLPSPNLPHQPISKPPVIPNLPK 191 Query: 844 XPXPPPPXPPP---XPXXXPPXPPPP 912 P P P P P PPP Sbjct: 192 LQVHPNRLPHPIHNHPYSSPTSYPPP 217 >SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1372 Score = 26.6 bits (56), Expect = 4.9 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 711 PXPXXPPPPXPPPXPP 758 P PP P PPP PP Sbjct: 802 PFKAPPPAPLPPPAPP 817 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 24.2 bits (50), Expect(2) = 5.0 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 847 PXPPPPXPPPXPXXXPPXPPPP 912 P PPPP PP P P Sbjct: 306 PPPPPPPPPSNDFWKDSNEPAP 327 Score = 20.6 bits (41), Expect(2) = 5.0 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +1 Query: 805 PPXGPXXXPPXPXXPXPPPP 864 P G P P PPPP Sbjct: 295 PSSGDSANGGLPPPPPPPPP 314 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,667,019 Number of Sequences: 5004 Number of extensions: 58008 Number of successful extensions: 1872 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 468512460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -