BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F21 (945 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 35 0.015 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 34 0.034 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 28 2.2 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 27 3.8 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 26 8.9 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 35.1 bits (77), Expect = 0.015 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 2/87 (2%) Frame = -1 Query: 939 GGGVXXXGGG--WGPPXPXXXGGAXPQGXXXXXXXGXXGGXGXXGXXGGXVXKIFGVPXX 766 GGG GGG PP P GG G G G G G G G P Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGP-- 244 Query: 765 GGGXGGNLXXLXGXXGXKXXGIFGXXG 685 GG GG L G G G G G Sbjct: 245 -GGFGGGLGGFGGGPGGFGGGPGGHGG 270 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 33.9 bits (74), Expect = 0.034 Identities = 20/67 (29%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = +2 Query: 650 PFPXPRXIXFXNPXXPKIPXXFXPXXPXNXXRFPPXPPPXXGTPKI---FXTXPPXXPXX 820 P P P + P P +P P P PP PP P + PP P Sbjct: 416 PVPTPPSLPPSAP--PSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAA 473 Query: 821 PXPPXXP 841 P PP P Sbjct: 474 PAPPPAP 480 Score = 26.2 bits (55), Expect = 6.7 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +2 Query: 686 PXXPKIPXXFXPXX--PXNXXRFPPXPPPXXGTPKIFXTXPPXXPXXPXPP 832 P P IP P + PP PPP GT + PP P P P Sbjct: 231 PIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGT----VSSPPNSPPRPIAP 277 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 27.9 bits (59), Expect = 2.2 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 686 PXXPKIPXXFXPXXPXNXXRFPPXPPPXXGTPKIFXTXPPXXPXXPXP 829 P PK P P P PP P P G P + P P P P Sbjct: 1159 PPVPK-PSVAAPPVPAPSSGIPPVPKPAAGVPPV--PPPSEAPPVPKP 1203 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 27.1 bits (57), Expect = 3.8 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +2 Query: 677 FXNPXXPKIPXXFXPXXPXNXXRFPPXPPPXXGTPKIFXTXPPXXPXXPXPPXXP 841 F P P P P P PP PP P P P P P P Sbjct: 498 FAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAVPAMPGIP 552 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 25.8 bits (54), Expect = 8.9 Identities = 20/61 (32%), Positives = 22/61 (36%) Frame = +2 Query: 650 PFPXPRXIXFXNPXXPKIPXXFXPXXPXNXXRFPPXPPPXXGTPKIFXTXPPXXPXXPXP 829 P P P + P IP P P PP PPP P + PP P P P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVP--PPAPIMGG--PPPPPP---PPGVAGAGPP--PPPPPP 782 Query: 830 P 832 P Sbjct: 783 P 783 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,404,952 Number of Sequences: 5004 Number of extensions: 14664 Number of successful extensions: 54 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 481321826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -