BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F20 (1054 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 69 8e-12 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 54 3e-07 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 51 1e-06 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 51 2e-06 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 48 1e-05 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 48 1e-05 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 48 1e-05 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 48 1e-05 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 48 2e-05 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 5e-05 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 43 5e-05 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 46 5e-05 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 46 5e-05 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 7e-05 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 9e-05 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 45 9e-05 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 44 2e-04 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 44 2e-04 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 44 2e-04 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 2e-04 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 44 3e-04 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 36 3e-04 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 43 4e-04 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 5e-04 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 43 5e-04 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 42 8e-04 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 41 0.001 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 41 0.001 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 41 0.002 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 41 0.002 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 41 0.002 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 40 0.004 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 40 0.004 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 39 0.006 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 39 0.008 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 39 0.008 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 38 0.010 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.018 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 38 0.018 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 38 0.018 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 38 0.018 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.018 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 37 0.024 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 37 0.024 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 37 0.024 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 37 0.024 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.024 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.028 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 37 0.031 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.041 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 36 0.041 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 34 0.042 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 36 0.055 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.055 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 36 0.055 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 36 0.055 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 31 0.062 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 32 0.065 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 32 0.067 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.072 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.072 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 36 0.072 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 36 0.072 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.095 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.095 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.13 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.13 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 35 0.13 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 35 0.13 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.13 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 34 0.17 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.22 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.22 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 34 0.22 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.22 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.22 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 34 0.22 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 34 0.22 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 33 0.29 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 33 0.29 SB_57911| Best HMM Match : Drf_FH1 (HMM E-Value=2.3) 33 0.29 SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.29 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 33 0.29 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 33 0.29 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 33 0.29 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 33 0.39 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 33 0.39 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 33 0.39 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 33 0.39 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 33 0.39 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 33 0.39 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 31 0.49 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.51 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 33 0.51 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.51 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 33 0.51 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 32 0.67 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 32 0.67 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.67 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 32 0.67 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 32 0.67 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.67 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 32 0.67 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.89 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 32 0.89 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 31 1.2 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 31 1.2 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 31 1.2 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 31 1.2 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 31 1.6 SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_128| Best HMM Match : SH3BP5 (HMM E-Value=3.3) 31 1.6 SB_48645| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=0.17) 31 2.1 SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.1 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.1 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 31 2.1 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.1 SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.1 SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.1 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 31 2.1 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.1 SB_19556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.1 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 31 2.1 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 31 2.1 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.1 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 25 2.5 SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) 30 2.7 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 30 2.7 SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 30 2.7 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 30 2.7 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_45794| Best HMM Match : zf-CCCH (HMM E-Value=3.1e-27) 30 2.7 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 30 2.7 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 30 2.7 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 30 2.7 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 30 2.7 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 3.2 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.6 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 30 3.6 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.6 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 30 3.6 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 4.4 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 29 4.7 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) 29 4.7 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 29 4.7 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) 29 4.7 SB_53724| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 29 4.7 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 29 4.7 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 29 4.7 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 29 4.7 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 29 6.3 SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 29 6.3 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 29 6.3 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 29 6.3 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 29 6.3 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 29 6.3 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 29 6.3 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 29 6.3 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 29 6.3 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 29 6.3 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 29 6.3 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 6.5 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 6.6 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) 29 8.3 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) 29 8.3 SB_27853| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_20539| Best HMM Match : VWA (HMM E-Value=5.1848e-44) 29 8.3 SB_20177| Best HMM Match : hATC (HMM E-Value=1e-04) 29 8.3 SB_19890| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) 29 8.3 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 29 8.3 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_51094| Best HMM Match : VWA (HMM E-Value=0) 29 8.3 SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) 29 8.3 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.3 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 29 8.3 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 68.5 bits (160), Expect = 8e-12 Identities = 27/59 (45%), Positives = 29/59 (49%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P +PP PP PP+ P PPP P P PP PP P PP PP PP PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 65.7 bits (153), Expect = 6e-11 Identities = 26/54 (48%), Positives = 27/54 (50%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 PP PP PP P PPP P P PP+ PP P PP PP PP PPA Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Score = 64.5 bits (150), Expect = 1e-10 Identities = 26/59 (44%), Positives = 27/59 (45%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P PP +PP PP PPP P P PP PP P PP PP PP PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 63.7 bits (148), Expect = 2e-10 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P PP P PP P PPP P P PP PP P PP PP PP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 63.3 bits (147), Expect = 3e-10 Identities = 25/54 (46%), Positives = 26/54 (48%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 +PP PP PP P PPP P P PP PP P PP PP PP PP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 54.0 bits (124), Expect(2) = 3e-09 Identities = 28/60 (46%), Positives = 29/60 (48%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P +PP P PP P PPP P P PP PPAP PP PP PP PPA Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP--PPAP----PP---PPPPPPPPPPA 433 Score = 53.6 bits (123), Expect = 3e-07 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAA 881 P PPPP PPP P P PP PP PPP PPP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 882 PAXPP 896 P PP Sbjct: 427 PPPPP 431 Score = 51.6 bits (118), Expect = 1e-06 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPP 622 PPPPPPPP P PP PP PP P PA PPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 623 XP 628 P Sbjct: 427 PP 428 Score = 50.8 bits (116), Expect = 2e-06 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 2/69 (2%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRP--PXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAP 884 PPPP PPP P P P P PP+PPP PPP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 885 AXPPXXAPA 911 PP PA Sbjct: 425 PPPPPPPPA 433 Score = 50.8 bits (116), Expect = 2e-06 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PPPP PPP P P PP PP PPP PPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPP 622 PPPPPPPP P PP PP PP P P PPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 623 XP 628 P Sbjct: 425 PP 426 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPP 622 PPPPPPPP P PP PP PP P P PPPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 623 XP 628 P Sbjct: 429 PP 430 Score = 49.6 bits (113), Expect = 4e-06 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 P P PP PP PP P PPP P P PP PP P PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 46.4 bits (105), Expect = 4e-05 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPP 622 PPPPPP P P PP PP PP P P PPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 623 XP 628 P Sbjct: 431 PP 432 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPAXX 730 P PP PP PP P P PPPP P PPPPA Sbjct: 365 PPPPPPPPPPPPSPPP---PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Query: 731 XPP 739 PP Sbjct: 422 PPP 424 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 869 PPXRPXXPPPGXXRXXXXXXXXXXXXXXXXXXXXXXXXXXPAXPXAPXPXPXPPXPXPPP 1048 PP P PPP P P P P P PP P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 1049 PP 1054 PP Sbjct: 425 PP 426 Score = 37.1 bits (82), Expect = 0.024 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPPP Sbjct: 408 PPPPPPPPPPPAPPPPPPPPPP 429 Score = 37.1 bits (82), Expect = 0.024 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPPP Sbjct: 410 PPPPPPPPPAPPPPPPPPPPPP 431 Score = 36.7 bits (81), Expect = 0.031 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 869 PPXRPXXPPPGXXRXXXXXXXXXXXXXXXXXXXXXXXXXXPAXPXAPXPXPXPPXPXPPP 1048 PP P PPP P P P P P P P PPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 1049 PP 1054 PP Sbjct: 427 PP 428 Score = 36.3 bits (80), Expect = 0.041 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 869 PPXRPXXPPPGXXRXXXXXXXXXXXXXXXXXXXXXXXXXXPAXPXAPXPXPXPPXPXPPP 1048 PP P PPP P P P P P PP P PPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Query: 1049 P 1051 P Sbjct: 432 P 432 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 869 PPXRPXXPPPGXXRXXXXXXXXXXXXXXXXXXXXXXXXXXPAXPXAPXPXPXPPXPXPPP 1048 PP P PPP P P P P P P P PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 1049 PP 1054 PP Sbjct: 426 PP 427 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 869 PPXRPXXPPPGXXRXXXXXXXXXXXXXXXXXXXXXXXXXXPAXPXAPXPXPXPPXPXPPP 1048 PP P PPP P P P P PP P PPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 1049 PP 1054 PP Sbjct: 431 PP 432 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPP 622 PPPPPP P P PP PP PP P PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 33.5 bits (73), Expect = 0.29 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPR 794 P PPPP PPP P P R PPR Sbjct: 412 PPPPPPPAPPPPPPPPPPPPPALRLACAPPR 442 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 853 PPAPXAXXPPXXXPPXXXPPXPPA 924 PP P PP PP PP PP+ Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPS 388 Score = 30.3 bits (65), Expect = 2.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 1004 APXPXPXPPXPXPPPPP 1054 +P P P PP P P PPP Sbjct: 364 SPPPPPPPPPPPPSPPP 380 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR 849 P P PP P PP P PP PPR Sbjct: 408 PPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPR 442 Score = 25.8 bits (54), Expect(2) = 3e-09 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +1 Query: 547 APPXAPXXXXXPAXPXPRXPXPPAXXP 627 +PP P P P P P PP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPP 390 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 57.2 bits (132), Expect = 2e-08 Identities = 26/61 (42%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXP--PAPXAXXPPXXXPPXXXPPXP 918 P P PP P PP P PPP P P PP P P+P A PP PP P P Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYP 162 Query: 919 P 921 P Sbjct: 163 P 163 Score = 56.0 bits (129), Expect = 5e-08 Identities = 37/127 (29%), Positives = 37/127 (29%), Gaps = 3/127 (2%) Frame = +1 Query: 550 PPXAPXXXXXPAXPXPRXPXPPAXXPXXXRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 729 PP P P P P P PP P Sbjct: 110 PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Query: 730 XXXXXPXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR--XPPAPXAXXPPXXXPP-X 900 P P PP PP PP P PPP P PP PP P A PP PP Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNP-PYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNA 228 Query: 901 XXPPXPP 921 PP PP Sbjct: 229 PNPPYPP 235 Score = 54.4 bits (125), Expect = 1e-07 Identities = 35/126 (27%), Positives = 35/126 (27%), Gaps = 2/126 (1%) Frame = +1 Query: 550 PPXAPXXXXXPAXPXPRXPXPPAXXPXXXRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 729 PP P P P P P PP Sbjct: 97 PPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPY 156 Query: 730 XXXXXPXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR--XPPAPXAXXPPXXXPPXX 903 P P PP P PP P PPP P P PP PP P A PP PP Sbjct: 157 PPPLYPPPPNPPPPNAPYPPP----PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Query: 904 XPPXPP 921 PP P Sbjct: 213 PPPNAP 218 Score = 54.0 bits (124), Expect = 2e-07 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR--XPPAPXAXXPPXXXPPXXXPPXP 918 P P P PP PP P PPP P PP PP P A PP P PP P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Query: 919 P 921 P Sbjct: 155 P 155 Score = 53.2 bits (122), Expect = 3e-07 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P P PP PP PP P PPP P P PP P P P PP PP P Sbjct: 183 PNPPYPPPPNPPYPPPPNA-PNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 50.4 bits (115), Expect = 2e-06 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 2/118 (1%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAA 881 P PPPP PPP P PP P PPP PP P A Sbjct: 92 PPYPPPPYPPYPPPP-----PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNA 146 Query: 882 PAXPPXXAPAXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXP--PPPXXAPRP 1049 P PP P P PP P P PPP AP P Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNP 204 Score = 49.2 bits (112), Expect = 5e-06 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP PP PPP P P PP PP P A PP PP PP P Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPP-YPPPPNAPYPPPPNPPYPPPPNAP 139 Score = 47.6 bits (108), Expect = 2e-05 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 1/93 (1%) Frame = +3 Query: 552 PXRPXXPRXPRPXXPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPXXPPPPXXX 731 P P P P P P P P PPPP Sbjct: 114 PPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAP 173 Query: 732 XPPPXXPRX-RPXXRPPXXPPRPPPXXXPPPXP 827 PPP P P PP PP PPP P P P Sbjct: 174 YPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 46.4 bits (105), Expect = 4e-05 Identities = 26/64 (40%), Positives = 26/64 (40%), Gaps = 4/64 (6%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR----XPPAPXAXXPPXXXPPXXXPP 912 P P PP P PP P PPP P P PP PP P PP PP PP Sbjct: 112 PNPPYPPPPNAPYPPPPN--PPYPPP-PNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPP 168 Query: 913 XPPA 924 P A Sbjct: 169 PPNA 172 Score = 46.4 bits (105), Expect = 4e-05 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = +3 Query: 552 PXRPXXPRXPRPXXPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPXXPPPPXXX 731 P P P P PP P P PPPP Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPP 186 Query: 732 XPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPP P P P PP PP PP P Sbjct: 187 YPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 Score = 43.2 bits (97), Expect = 4e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPPP PPP P P P P PPP PP P Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 787 PPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P P P P P P PP P PP PP P PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPP--RPPPXXXPPP 821 P PPPP PPP P PP PP P P PPP Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 35.1 bits (77), Expect = 0.095 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXP--AXXXPP 616 PPP PPPP P P PP PP P P A P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Query: 617 PPXP 628 PP P Sbjct: 223 PPPP 226 Score = 34.7 bits (76), Expect = 0.13 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P PPP P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPP 115 Score = 34.3 bits (75), Expect = 0.17 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 2/94 (2%) Frame = +3 Query: 552 PXRPXXPRXPRPXXPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPXXP-PPPXX 728 P P P P P P P P P PPP Sbjct: 133 PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPN 192 Query: 729 XXPPPXXPRXRPXXRPPXXPPRPPPXXXP-PPXP 827 PP P PP PP PPP P PP P Sbjct: 193 PPYPPPPNAPNP---PPPNPPYPPPPNAPNPPYP 223 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPA-XXXPPPPXP 628 P PP PP PP P P PPPP P Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNP 130 Score = 33.1 bits (72), Expect = 0.39 Identities = 26/100 (26%), Positives = 26/100 (26%), Gaps = 1/100 (1%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPP-XPPXXAPPXPXPAXXXPPP 619 PP PPPPP P PP PP AP P P PPP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPP--------PNPPYPPPPNAPYPPSPNAPYPPP 151 Query: 620 PXPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPAXXXPP 739 P P PP P PP Sbjct: 152 PNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PP PP Sbjct: 97 PPYPPYPPPPPYPPPPNPPYPP 118 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPP Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPP 191 Score = 31.9 bits (69), Expect = 0.89 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 446 PPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXP----PXXAPPXPXPAXXXP 613 PPPP PP P PP P P PP P P Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Query: 614 PPPXP 628 PPP P Sbjct: 235 PPPNP 239 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +2 Query: 551 PXPPXPPXXAPP--XPXPAXXXPPPP 622 P PP PP PP P P PPPP Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPP 120 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPAXX 730 P PP PP PP P P PPP PPPP Sbjct: 98 PYPPYPP--PPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP 155 Query: 731 XPP 739 PP Sbjct: 156 YPP 158 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 869 PPXRPXXPPPGXXRXXXXXXXXXXXXXXXXXXXXXXXXXXPAXPXAPXPXPXPPXPXPPP 1048 PP P PPP P P AP P P P P PP Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP--PYPPPPN 184 Query: 1049 PP 1054 PP Sbjct: 185 PP 186 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 P P P P PP P PPPP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPP 112 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +2 Query: 551 PXPPXP-PXXAPPXPXPAXXXPPPPXP 628 P PP P P PP P P PP P P Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPP 119 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 1007 PXPXPXPPXPXPPPPP 1054 P P P PP P PPPP Sbjct: 105 PPPYPPPPNPPYPPPP 120 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPP Sbjct: 115 PYPPPPNAPYPPPPNPPYPPPP 136 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPP Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPP 199 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPP Sbjct: 194 PYPPPPNAPNPPPPNPPYPPPP 215 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P P P P PPP Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPP 111 Score = 28.7 bits (61), Expect = 8.3 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +2 Query: 989 PAXPXAPXP-XPXPPXPXPPPPP 1054 P P P P P PP P PP PP Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPP 197 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 53.6 bits (123), Expect = 3e-07 Identities = 28/58 (48%), Positives = 28/58 (48%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG GG G GG GG G G GGG G GG GG GGA AG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGGGAGGAGAGAG 710 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGA 771 G GG GG GG G GG GG G G GGG G AGG GA Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGA 709 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 GG GG GG GG G GG GG G G GGG G AG G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G GG GG G G GGG GG GGA GA G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG------GGGGAGGAGAGAGDDDG 714 Score = 45.6 bits (103), Expect = 7e-05 Identities = 22/52 (42%), Positives = 22/52 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 GG GG GG GG G GG GG G G GGG G AG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GGG GGGG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GGG GGGG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GGG GGGG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GGG GG G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG GGG GG GG G G GGG GGGG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG GGG GG GG G G GGG GGGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GGG GG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GGG G G G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G G G G G G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 35.5 bits (78), Expect = 0.072 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GGG GG GG G G G G G G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGG 685 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGG 687 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGG 688 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGG 689 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGG 690 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGG 692 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GG G G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 681 GGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG G G Sbjct: 679 GGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGG G G GG GG GG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGG 684 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG G G G Sbjct: 685 GGGGGGGGGGGGGGGGGAGGAGAGAG 710 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 51.2 bits (117), Expect = 1e-06 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G GG GG G G G G GG GG GG G G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 51.2 bits (117), Expect = 1e-06 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G G GG G GGG G GG GG GG G G Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 50.0 bits (114), Expect = 3e-06 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG GG GG G G G G G GGG G GG GG GG G Sbjct: 820 GGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 48.8 bits (111), Expect = 7e-06 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXA-GGXXGGAXGGAXAGXG 744 G GG GG GG G GG GG G G GG G GG GG GG G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 48.8 bits (111), Expect = 7e-06 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G G GG GGG G GG GG GG G G Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 48.4 bits (110), Expect = 1e-05 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXG-GGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG G GG G GG GG G G G GG G GG GG GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G GG GG G GGG G GG GG GG G G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG--GGDGGGYGDGGG 835 Score = 47.6 bits (108), Expect = 2e-05 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -3 Query: 920 GGXG-GXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G G GG GG G GG G G G GGG GG GG GG G G Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 46.8 bits (106), Expect = 3e-05 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXX-GXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G GG GG G GG GG G G GGG G GG GG G G G Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDG 839 Score = 46.0 bits (104), Expect = 5e-05 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG G G GG GG G G G G G GG GG G G Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Score = 45.6 bits (103), Expect = 7e-05 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G GG GG G G GGG G GG G G A G Sbjct: 791 GGGGGGGGGGGGDGGGYGDGDGGG-GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGG 848 Score = 45.6 bits (103), Expect = 7e-05 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG G G GG GG G G G G GG G GG G G Sbjct: 797 GGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGG 855 Score = 45.2 bits (102), Expect = 9e-05 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG G GG G GG G G GG G A G GG GG G G Sbjct: 801 GGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGG 859 Score = 44.4 bits (100), Expect = 2e-04 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G G GG G G GGG G G GG G G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADG 845 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG G G GG GG G G GG G G GG G G G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGG 851 Score = 43.6 bits (98), Expect = 3e-04 Identities = 30/107 (28%), Positives = 30/107 (28%) Frame = -1 Query: 1030 GGGGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXRXGXAGAXXGGXAGAAXXXXXXXX 851 GGGG G GG G GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 850 XXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG G G GG GG G G GGG GGGG Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 43.2 bits (97), Expect = 4e-04 Identities = 29/92 (31%), Positives = 29/92 (31%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXGXXXXXXXXXXXXXXXXXX 647 G GGG GGG GG GG G G GG GGGG G Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGY 842 Query: 646 XXXXXXXXXXXXGXGXGGXXGRGXRGXXGRXG 551 G G GG G G G G G Sbjct: 843 ADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 42.7 bits (96), Expect = 5e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG GG GG G G G G G GGG G GG G G G Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Score = 42.3 bits (95), Expect = 6e-04 Identities = 29/92 (31%), Positives = 29/92 (31%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXGXXXXXXXXXXXXXXXXXX 647 G GGG GGG GG GG G G GG GGGG G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGF 836 Query: 646 XXXXXXXXXXXXGXGXGGXXGRGXRGXXGRXG 551 G G GG G G G G G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 38.3 bits (85), Expect = 0.010 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG G G GG GG G G GGG GGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDG 810 Score = 38.3 bits (85), Expect = 0.010 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G GGGG G G G GG GG G GGGGGG Sbjct: 794 GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGG 853 Query: 447 GG 442 GG Sbjct: 854 GG 855 Score = 38.3 bits (85), Expect = 0.010 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G GGGG G G G GG GG G GGGGGG Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGG 855 Query: 447 GG 442 GG Sbjct: 856 GG 857 Score = 38.3 bits (85), Expect = 0.010 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G GGG G G GG GG GG G GGGGGG Sbjct: 798 GGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGG 857 Query: 447 GG 442 GG Sbjct: 858 GG 859 Score = 37.5 bits (83), Expect = 0.018 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G G GG G G GG GG GG G GGGGGG Sbjct: 800 GGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGG 859 Query: 447 GG 442 GG Sbjct: 860 GG 861 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 621 GGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGGGG 442 GGGG G G GG GG GG G GGGGG GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 36.7 bits (81), Expect = 0.031 Identities = 27/99 (27%), Positives = 27/99 (27%) Frame = -2 Query: 738 GGXXXAGGGGXXXXXXXXXXXXXXXXXXXXXXXXGXXGXGGGGXXXAGXGXGGAXXGGXG 559 GG GGGG G GGGG G G GG GG G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG-GGGDGGGYG 831 Query: 558 GXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGGGG 442 G GGGGGGGG Sbjct: 832 DGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 36.3 bits (80), Expect = 0.041 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -2 Query: 738 GGXXXAGGGGXXXXXXXXXXXXXXXXXXXXXXXXGXXGXGGGGXXXAGXGXGGAXXGGXG 559 GG GGGG G G GGGG G G GG GG G Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Query: 558 GXG 550 G G Sbjct: 873 GGG 875 Score = 36.3 bits (80), Expect = 0.041 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -2 Query: 738 GGXXXAGGGGXXXXXXXXXXXXXXXXXXXXXXXXGXXGXGGGGXXXAGXGXGGAXXGGXG 559 GG GGGG G G GGGG G G GG GG G Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Query: 558 GXG 550 G G Sbjct: 874 GGG 876 Score = 35.5 bits (78), Expect = 0.072 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G GGGG G G G G GG G GGGGGG Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Query: 447 GG 442 GG Sbjct: 872 GG 873 Score = 35.5 bits (78), Expect = 0.072 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G GGGG G G G GG G G GGGGGG Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Query: 447 GG 442 GG Sbjct: 875 GG 876 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G GGGG G G GG G G A GGGGGG Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Query: 447 GG 442 GG Sbjct: 873 GG 874 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G GGGG G GG GG G G GGGGGG Sbjct: 814 GGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Query: 447 GG 442 GG Sbjct: 874 GG 875 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 50.8 bits (116), Expect = 2e-06 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P P AP PP P PPP P P PP A PP P PP PP Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 49.6 bits (113), Expect = 4e-06 Identities = 25/53 (47%), Positives = 25/53 (47%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P PP PPA P PPP P P P AP A PP PP PP PPA Sbjct: 50 PPPPPPSPPAAA-PAAPPPPAAAPAAPPPPAAPPAAPPPP--PPLPAPPPPPA 99 Score = 42.7 bits (96), Expect = 5e-04 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP 894 P P A P APP P PPP P P PP P PP P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 5/60 (8%) Frame = +1 Query: 745 PXPAXAPPXAPPXX---PPAXXXPXXPPPXPXXPXP-PRXPPAPXAXXP-PXXXPPXXXP 909 P P A P APP P A P PP P P P P PP P P P PP P Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPPP P P PP PP PPP PPP P Sbjct: 62 PAAPPPPAAAPAAPPPPAA-----PPAAPPPPPPLPAPPPPP 98 Score = 38.7 bits (86), Expect = 0.008 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +2 Query: 449 PPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPPXP 628 PPPPPP A PP PP APP P PPP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 36.3 bits (80), Expect = 0.041 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPPP PP P P PP P +P P PPP P Sbjct: 72 PAAPPPP--AAPPAAPPPPPPLPAPPPPPAQPAP--QPPPAP 109 Score = 35.5 bits (78), Expect = 0.072 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 446 PPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPPX 625 PPPPPP A P PP P PP P PPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Query: 626 P 628 P Sbjct: 110 P 110 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRP--PPXXXPPPXP 827 PPPP P P P PP P PP PPP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P A P P PP P PPPPP Sbjct: 78 PAAPPAAPPPP-PPLPAPPPPP 98 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P AP P PP P P PPP Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPP 96 Score = 31.9 bits (69), Expect = 0.89 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 992 AXPXAPXPXPXPPXPXPPPPP 1054 A P AP P PP PPPPP Sbjct: 70 AAPAAPPPPAAPPAAPPPPPP 90 Score = 31.9 bits (69), Expect = 0.89 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPP 791 PPPP PPP P +P +PP PP Sbjct: 86 PPPPPLPAPPP--PPAQPAPQPPPAPP 110 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P P P P PPP Sbjct: 86 PPPPPLPAPPPPPAQPAPQPPP 107 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXP 815 P PP PPP P +P PP PP P Sbjct: 77 PPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P P P P PP P P P Sbjct: 82 PAAPPPPPPLPAPPPPPAQPAP 103 Score = 28.7 bits (61), Expect = 8.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P AP P P P P PPP P Sbjct: 89 PPLP-APPPPPAQPAPQPPPAP 109 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 50.8 bits (116), Expect = 2e-06 Identities = 25/59 (42%), Positives = 26/59 (44%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G G GG G G G G G GG GG GG +G G Sbjct: 169 GGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 49.6 bits (113), Expect = 4e-06 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXG-XXXAGGXXGGAXGGAXAGXG 744 GG G GG GG GG RGG G G GGG G GG GG GG G G Sbjct: 125 GGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGG 184 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/58 (41%), Positives = 25/58 (43%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG GG G G GG G G GGG G +G GG GG G G Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 46.4 bits (105), Expect = 4e-05 Identities = 28/61 (45%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -3 Query: 920 GGXGGX-XXGGXXXGGXXAXGAGGXRG-GXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGX 747 GG GG GG GG G GG RG G G G GGG G GG GG GG G Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYG---GGGYGGGGHGGGGYGG 193 Query: 746 G 744 G Sbjct: 194 G 194 Score = 46.4 bits (105), Expect = 4e-05 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG G GG G GG GG G G GGG G GG GG G G G Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGG--GGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGG 212 Score = 44.4 bits (100), Expect = 2e-04 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG G G G GG G G GGG G GG G GG G G Sbjct: 150 GGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSG 207 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG G G GG RGG G G G GG GG GG G G Sbjct: 131 GYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Score = 43.2 bits (97), Expect = 4e-04 Identities = 24/59 (40%), Positives = 25/59 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G GG GG G G GG G G GGG G GG GG+ G G G Sbjct: 159 GGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG--GYGGGGGGYGGSGYGGGGGYG 215 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G G GG G G G G G G GG GG G G Sbjct: 134 GGRGGG--GGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGG 190 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 820 GGGXXXGGG-RGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG RGG G R GR G GGG GG G G Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGG 185 Score = 38.3 bits (85), Expect = 0.010 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Frame = -1 Query: 826 GXGGGXXXGGG-RGG----XXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG RGG GG GR RG G G GGGG G Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGG 183 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG G G G GGG GGGG G Sbjct: 165 GRGGGGYGGGGYGGGGYG-GGGHGGGGYGGGGYGGGGGGYGG 205 Score = 37.5 bits (83), Expect = 0.018 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 826 GXGG--GXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG G GGGRGG G R G G GGG GGGG G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGG---GYRGGGGYRGGGGGYRG 163 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG G G G GG GGGG G Sbjct: 180 GYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 36.7 bits (81), Expect = 0.031 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGG-GXXXXGGGGXXG 701 G GGG GGG GG GG G G GG G GGGG G Sbjct: 175 GYGGGGYGGGGHGG--GGYGGGGYGGGGGGYGGSGYGGGGGYG 215 Score = 35.9 bits (79), Expect = 0.055 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -1 Query: 826 GXGGGXXXGG--GRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GG G GG GG G G GGG G GG G Sbjct: 170 GYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGG 213 Score = 35.5 bits (78), Expect = 0.072 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G G GGG G Sbjct: 185 GHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 35.1 bits (77), Expect = 0.095 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGR--GGXXGGRXXGRXRGXX 743 G G GG G G GGG G GR GG GG G G Sbjct: 126 GRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYR-GRGRGGGGYGGGGYGGGGYGGG 184 Query: 742 GGGXXXXGGGGXXG 701 G G GGGG G Sbjct: 185 GHGGGGYGGGGYGG 198 Score = 34.3 bits (75), Expect = 0.17 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG+ GG GG G Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGGGGYG 215 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GG GG GG G G GG GGG G Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGG 217 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GGG G G G G G G GGGG Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG RGG G G GG G GG GG GG G G Sbjct: 123 GGGGRRGG-GYGGGRGGGGGYRSGGGYRGG--GGYRGGGG 159 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGR 547 G GGGG +G G GG GG G GR Sbjct: 197 GGGGGGYGGSGYGGGGGYGGGGYGGGR 223 Score = 31.9 bits (69), Expect = 0.89 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = -2 Query: 627 GXGGGGXXXAGXGX--GGAXXGGXGG-XGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGG 457 G GGGG +G G GG GG GG GR GGG Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Query: 456 GGGGG 442 G GGG Sbjct: 195 GYGGG 199 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG GGG G GG G G GG GGG G Sbjct: 184 GGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSG 225 Score = 30.7 bits (66), Expect = 2.1 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = -1 Query: 907 GAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGG--RGGXXGGRXXGRXRGXXGGG 734 G GG G G GG GGG GG GG G GGG Sbjct: 152 GGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGG 211 Query: 733 XXXXGGGGXXG 701 GGG G Sbjct: 212 GGYGGGGYGGG 222 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG G G Sbjct: 185 GHGGGGYGGGGYGGGGGGYGGSGYGG 210 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG G GG G Sbjct: 195 GYGGGGGGYGGSGYGGGGGYGGGGYG 220 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGX--GXXGXGGG 813 G GG GG GG G GG GG G GGG Sbjct: 192 GGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 29.5 bits (63), Expect = 4.7 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGA--XXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGG 454 G GGG G G GG GG GG G GGGG Sbjct: 153 GYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGG 212 Query: 453 GGGG 442 G GG Sbjct: 213 GYGG 216 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 50.8 bits (116), Expect = 2e-06 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G GG G G G G G G AGG G GG G G Sbjct: 1762 GGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGG 1820 Score = 48.8 bits (111), Expect = 7e-06 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAG-GXXGGAXGGAXAGXG 744 G GG GG GG G GG GG G G GGG G G G GG G G G Sbjct: 1781 GGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGG 1839 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 A G G G GG A G GG GG G G GG G G GG GGA G G Sbjct: 1786 AAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 46.4 bits (105), Expect = 4e-05 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G GG GG G GG G GG GG G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGG 1814 Score = 46.4 bits (105), Expect = 4e-05 Identities = 27/60 (45%), Positives = 27/60 (45%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 AGG GG GG GG G G GG G G GGG G GG GG G AG G Sbjct: 1774 AGGGGGMGGGGMAAGGGE-FGGGEGMGGGGMAGGGGGMGG--GGGGMGGGGEGMGAAGGG 1830 Score = 44.4 bits (100), Expect = 2e-04 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXX-GXGGGXXGXXXAGGXXGGAXGGAXA 753 GG G GG GG G GG GG G G GG G GG GG GG A Sbjct: 1793 GGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGGYSA 1849 Score = 43.2 bits (97), Expect = 4e-04 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG GG A G GG GG G G G GG G GG G G Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGX---GXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG GG GG GG GG G G GG G GG GG G A Sbjct: 1768 GGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAA 1827 Query: 749 XG 744 G Sbjct: 1828 GG 1829 Score = 36.7 bits (81), Expect = 0.031 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G G GG A G GGG GGG GG GG G G GG Sbjct: 1775 GGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGM--GGGGGGMGGG---GEGMGAAGG 1829 Query: 736 GXXXXGGGGXXG 701 G G GG G Sbjct: 1830 GMGAGGEGGGAG 1841 Score = 36.7 bits (81), Expect = 0.031 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = -1 Query: 907 GAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXX 728 G GG AA GGG GGG G GG G G G G Sbjct: 1777 GGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGE 1836 Query: 727 XXGGGGXXG 701 G GG G Sbjct: 1837 GGGAGGGGG 1845 Score = 34.7 bits (76), Expect = 0.13 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 817 GGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GG GGG GG GG G GGG GGG G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGG 1794 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G GGG G G GG GG GG G A GGGGG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Query: 447 G 445 G Sbjct: 1816 G 1816 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXR---GXXGGGXXXXGGGGXXG 701 G GGG GGG G GG G G GGG GGG G Sbjct: 1762 GGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGG 1806 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -3 Query: 893 GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G + G G GG G G GGG G G G A GG G G Sbjct: 1746 GRQMSSSSSTGGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGG 1795 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -1 Query: 826 GXGGGXXXGGGRG-GXXGGRXXGRXRGXXGGGXXXXGGG 713 G GGG GGG G G GG G G GGG GGG Sbjct: 1811 GGGGGGMGGGGEGMGAAGG---GMGAGGEGGGAGGGGGG 1846 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -1 Query: 826 GXGGGXXXGGGRG--GXXGGRXXGRXRGXXG--GGXXXXGGGGXXG 701 G GGG GGG G G GG G G GG GGGG G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAG 1805 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GG GG GG G GG GG G G Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGG 1800 Score = 31.1 bits (67), Expect = 1.6 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGG--GGXXG 701 G GGG GGG G GG G G GGG GG GG G Sbjct: 1757 GFGGG---GGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEG 1797 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXA 535 G GGGG G G GG GG GG G A Sbjct: 1797 GMGGGGMAGGGGGMGGG-GGGMGGGGEGMGA 1826 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 49.2 bits (112), Expect = 5e-06 Identities = 27/64 (42%), Positives = 28/64 (43%), Gaps = 5/64 (7%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPX--PXXPXPPR---XPPAPXAXXPPXXXPPXXXP 909 P P PP +PP PP P PPP P P PP PP P PP PP P Sbjct: 348 PPPTNNPP-SPP--PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 404 Query: 910 PXPP 921 P PP Sbjct: 405 PPPP 408 Score = 49.2 bits (112), Expect = 5e-06 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPP---XXPPRPPPXXXPPPXP 827 P PPPP PPP P +P PP PP PPP PPP P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/55 (41%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXX--PPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P PP+ P PPP P PP PP P PP PP PP PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPP--PPPPPTNGPPPPPPPTNGPPPPP 398 Score = 43.6 bits (98), Expect = 3e-04 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 745 PXPAXAPPXAPP-XXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P PP PP PP P PP P P PP P PP PP PP Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 3/67 (4%) Frame = +2 Query: 437 GXPPPPPP---PPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXX 607 G PPPPP PP P PP PP PP P P Sbjct: 343 GVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTN 402 Query: 608 XPPPPXP 628 PPPP P Sbjct: 403 GPPPPPP 409 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPP--XXPPRPPPXXXPPPXP 827 P PPP PPP P PP PP PPP PPP P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXX--PPRPPPXXXPPP 821 P PPPP PPP P P PP PP PPP PP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXX----PPRPPPXXXPPPXP 827 PPPP PPP P P PP PP PP PPP P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXX--PPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAP 884 PPPP P P P PP PP PPP PP P P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Query: 885 AXPPXXAP 908 PP P Sbjct: 407 PPPPTNGP 414 Score = 38.7 bits (86), Expect = 0.008 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 711 PPPPXXXXPP-PXXPRXRPXXRPP---XXPPRPPPXXXPPPXP 827 PPPP PP P P PP PP PPP PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 31.9 bits (69), Expect = 0.89 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 4/62 (6%) Frame = +2 Query: 443 PPPPPPP----PXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXX 610 PP PPPP P P PP PP PP P P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG 413 Query: 611 PP 616 PP Sbjct: 414 PP 415 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP PPPPP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPP 388 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP PPPPP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPP 378 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP PPPPP Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPP 398 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP PPPPP Sbjct: 387 PPPPTNGPPPPPPPTNGPPPPP 408 Score = 28.7 bits (61), Expect = 8.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P+ P AP P P PP PP PP Sbjct: 72 PSTP-APPPPPPPPSSGPPLPP 92 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 48.4 bits (110), Expect = 1e-05 Identities = 25/58 (43%), Positives = 26/58 (44%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG GG G GG +GG G GGG G GG GG GG G G Sbjct: 179 GGGGSQGGGYRSGGG---GYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 42.7 bits (96), Expect = 5e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = -3 Query: 908 GXXXGGXXXGGXXAXGAGGXRGGXGXX--GXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG G GG G G G GGG G GG GG GG G G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGG 232 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG G G GG GG G G GGG G GG GG+ G Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/55 (40%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXX-GXGGGXXGXXXAGGXXGGAXGG 762 +GG G G GG G GG RGG G G GGG G GG+ GG Sbjct: 190 SGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGG 774 GG GG GG GG G GG GG G G GGG G GG Sbjct: 200 GGYGGGSGGGGYGGGR---GGGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG GGGRGG GG G G GGG GGG G Sbjct: 204 GGSGGGGYGGGRGG--GGYGGGHGGGGYGGGGRHDYGGGSKG 243 Score = 35.9 bits (79), Expect = 0.055 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GG GGG GG GG G G GGG G GG G Sbjct: 186 GGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHG 225 Score = 35.9 bits (79), Expect = 0.055 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GG G G GG GGR G G GGG GGGG Sbjct: 197 GSKGGYGGGSGGGGYGGGRGGGGYGGGHGGG--GYGGGG 233 Score = 35.5 bits (78), Expect = 0.072 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -1 Query: 817 GGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXG-GGGXXG 701 GG GG +GG GG G G GGG G GGG G Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYG 230 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -1 Query: 820 GGGXXXGGG---RGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG GG GG G G GGG GGG G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYG 221 Score = 32.7 bits (71), Expect = 0.51 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = -1 Query: 916 GXAGAXXGGX-AGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXG 740 G G+ GG +G G GGG GG GG GG G R G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYG 238 Query: 739 GGXXXXGGG 713 GG GGG Sbjct: 239 GG--SKGGG 245 Score = 31.9 bits (69), Expect = 0.89 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -1 Query: 826 GXGGGX-XXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG GGG GG GG GR G GGG GGGG G Sbjct: 194 GYGGSKGGYGGGSGG--GGYGGGRGGGGYGGG---HGGGGYGG 231 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG GG G GG G +G GGG G GG G Sbjct: 176 GDSGGGGSQGG-GYRSGGGGYGGSKGGYGGGSGGGGYGGGRG 216 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 48.4 bits (110), Expect = 1e-05 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG G GG GG G G GGG G GG GG GG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG GG GG GG G GG G G G GGG G GG GG GG Sbjct: 62 GGGGGG--GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 45.6 bits (103), Expect = 7e-05 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG GG GG G GG G G GGG GG GG G A G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 42.7 bits (96), Expect = 5e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG GG GG G G GGG GGGG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDG 102 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GGG G GG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGG 106 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG G G G GGG GGGG G Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG G G G GGG GGGG G Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGG--GXXGXXXAGGXXGGAXGGAXAGXG 744 GG G GG GG G G GG G G GG GG GG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/55 (43%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 920 GGXGGX-XXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGA 759 GG GG GG GG G GG GG G G GGG G GG G A G+ Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG--GGGGGGGGVGRARFGS 120 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGG--RXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GGG GGGG G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG G GG G G GG GGGG G Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDG 88 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG G GG G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGG 91 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G GG GG GG G Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 621 GGGGXXXAGXGXGGAXXGGXGG 556 GGGG G G GG GG GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGG 83 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 76 GGGGGGGGDDGDG-GGGDGGGGGGGG 100 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGR 547 G GGG G G GG GG GG GR Sbjct: 90 GGDGGGGGGGGDGGGGG-GGGGGGVGR 115 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 48.4 bits (110), Expect = 1e-05 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P P PP PP PP P PPP P P PPR A PP P PP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPP-PSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-PXXXPPXPP 921 P PP PP PP P PP P P PP PP P A P P P P PP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP-SPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPP PR P PP PP P P PPP P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXP-PAPXAXXPPXXXPP 897 P PP PP P P PPP P P + P P P PP PP Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +1 Query: 778 PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P P PPP P P PP PP P P PP PP P A Sbjct: 195 PTSPSQITQPPPPPPRP-PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLA 242 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PP P PPP RP PP PPRP P P P Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 40.3 bits (90), Expect = 0.003 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPPP P P P P PP PP PPP PP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP---SPPRP 240 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 1/58 (1%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXP-XXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P PP P PPP P P PPR PP P P PP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAPAX 890 PPPP PP P P P PPRPPP PPP P P Sbjct: 204 PPPPPPRPPPSPPP---PPPPPSPSPPRPPP--PPPPSPPRPLAAKLPEPPPIPNMPPTL 258 Query: 891 PP 896 PP Sbjct: 259 PP 260 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPP-----PXXXPPPXP 827 P P PP PPP P P PP PP PP PPP P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 36.3 bits (80), Expect = 0.041 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP P PP P P+ PPPP P Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 35.1 bits (77), Expect = 0.095 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P PP P P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPP 231 Score = 35.1 bits (77), Expect = 0.095 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 548 RPXPPXPPXXAPPXPXPAXXXPPPP 622 RP P PP PP P P PPPP Sbjct: 210 RPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 35.1 bits (77), Expect = 0.095 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 217 PPPPPPSPSPPRPPPPPPP 235 Score = 35.1 bits (77), Expect = 0.095 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP +PP P A PPP P Sbjct: 227 PRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 34.3 bits (75), Expect = 0.17 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P +P P P PP P PP PP Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPP 230 Score = 34.3 bits (75), Expect = 0.17 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP +PP P P PPPP P Sbjct: 216 PPPPPPPSPSPPRPPP----PPPPSP 237 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P P P PPPPP Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPP 233 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 745 PXPAXA-PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP 879 P P+ PP PP PP P P P PP PP P Sbjct: 222 PSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLGYLP 267 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PP P PPP P P P PP PP P Sbjct: 218 PPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLP 259 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRP--PPXXXPP 818 P P PP PPP P + P PP P PP PP Sbjct: 221 PPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 32.3 bits (70), Expect = 0.67 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P P PP PP P P+ P PP P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 31.9 bits (69), Expect = 0.89 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P P P P PPPPP Sbjct: 204 PPPPPPRPPPSPPPPPPPP 222 Score = 31.9 bits (69), Expect = 0.89 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPP P Sbjct: 206 PPPPRPPPSPPPPPPPPSP 224 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXP 628 PP PP PP P P PPPP P Sbjct: 204 PPPPPPRPPPSPPP---PPPPPSP 224 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P P PP P P P PP P PP PPP Sbjct: 224 PSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP--TLPPP 261 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P P P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSP 226 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P +P P P PP P PP PP Sbjct: 218 PPPPPSPSP-PRPPPPPPPSPP 238 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P+ P P P P P PPPPP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPP 219 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P P P PPP P Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSP 237 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 1005 PPXPXPPPPXXAPRP 1049 PP P PPPP PRP Sbjct: 226 PPRPPPPPPPSPPRP 240 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 4/63 (6%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPP----RXPPAPXAXXPPXXXPPXXXPP 912 P P APP PP+ PPP P PP PP A PP PP PP Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPP 375 Query: 913 XPP 921 PP Sbjct: 376 PPP 378 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXP--RXRPXXRPPXXPPRPPP-XXXPPPXP 827 P PPPP PPP P RP PP PPP PPP P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 37.9 bits (84), Expect = 0.014 Identities = 18/54 (33%), Positives = 22/54 (40%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P PP+ PPP PP PP+ + PP PP P PP+ Sbjct: 300 PSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPP---PPSRGAPPPPS 350 Score = 37.1 bits (82), Expect = 0.024 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRP----XXRPPXXPPRPPPXXXPPPXP 827 PPPP PPP P PP PP PPP PPP P Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPP--PPPPPPVGGPPPPP 378 Score = 36.7 bits (81), Expect = 0.031 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP + PP PPP P P PP P PP PP P Sbjct: 341 PSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 36.3 bits (80), Expect = 0.041 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P APP PP PP P PPP P PP P PP P P P Sbjct: 357 PVGGAAPPPPPP--PPVGGPP--PPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 35.1 bits (77), Expect = 0.095 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 7/66 (10%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXX----PXPPRX---PPAPXAXXPPXXXPPXX 903 P P + APP PPA PPP P P PP PP PP Sbjct: 305 PPPPPSRGSAPPP-PPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAP 363 Query: 904 XPPXPP 921 PP PP Sbjct: 364 PPPPPP 369 Score = 35.1 bits (77), Expect = 0.095 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P APP PP P P P P PP+ PP P PP P Sbjct: 349 PSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 33.9 bits (74), Expect = 0.22 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 6/72 (8%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPP----XXPPRPPPXXXP--PPXPXXXXXXXXXXXXXXX 872 PPPP PPP R PP PP PPP PP P Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPP 356 Query: 873 XAAPAXPPXXAP 908 A PP P Sbjct: 357 PVGGAAPPPPPP 368 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/61 (26%), Positives = 18/61 (29%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPAXXXP 736 PP PP P P+ PPPP PPPP+ P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 737 P 739 P Sbjct: 347 P 347 Score = 33.1 bits (72), Expect = 0.39 Identities = 21/59 (35%), Positives = 23/59 (38%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P + APP PP+ P PPP PP PPA PP P PP Sbjct: 287 PPPPPSRGAAPP--PPSRGAP--PPPPSRGSAPP-PPPARMGTAPPPPPPSRSSQRPPP 340 Score = 32.3 bits (70), Expect = 0.67 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P AP P P PP PPPPP Sbjct: 357 PVGGAAPPPPPPPPVGGPPPPP 378 Score = 31.9 bits (69), Expect = 0.89 Identities = 30/120 (25%), Positives = 30/120 (25%), Gaps = 7/120 (5%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPP--XXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAP 884 PPPP PP R P P PP PP P P A P Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP 347 Query: 885 AXPPXXAPAXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP-----PXPXPPPPXXAPRP 1049 PP A P P P P PPP AP P Sbjct: 348 --PPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 787 PPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 PP PP P PP P A PP PP PP+ Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPS 332 Score = 31.1 bits (67), Expect = 1.6 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 13/77 (16%) Frame = +2 Query: 437 GXPPPPP-----PPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPX-----PPXXA-- 580 G PPPPP PPP P PP PP Sbjct: 303 GAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAA 362 Query: 581 -PPXPXPAXXXPPPPXP 628 PP P P PPPP P Sbjct: 363 PPPPPPPPVGGPPPPPP 379 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 3/64 (4%) Frame = +2 Query: 437 GXPPPPPPPPXXXXXXXXXXXXXXXXXXXXXXX---AXXXRPXPPXPPXXAPPXPXPAXX 607 G PPPPPP P PP PP PP P P Sbjct: 323 GTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIE 382 Query: 608 XPPP 619 PP Sbjct: 383 GRPP 386 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPAXXXP 736 PP P APP P P+ PPP P PPP P Sbjct: 297 PPPPSRGAPP-PPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAP 355 Query: 737 P 739 P Sbjct: 356 P 356 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPP----XXPPRPPPXXXPPP 821 P PP PPP P R RPP PP P PPP Sbjct: 315 PPPPPARMGTAPPPPPP-SRSSQRPPPPSRGAPPPPSMGMAPPP 357 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 6/59 (10%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPX----PXXPXPPRXPPAPXAXXPPXXXPP--XXXPPXPP 921 PP PP PPP P P PP P P PP PP PP Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP 396 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 47.6 bits (108), Expect = 2e-05 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG A G GG G G G GG G GG G GGA G G Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATG-GHGGATGGGGGATGDGGGATGGGGGATGGGG 108 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG G A G GG G G G GG G GG G GGA G G Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATG-GGGGATGGHGGATGGGGGATGDGGGATGGGG 101 Score = 42.7 bits (96), Expect = 5e-04 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG GG A G G GG G G GGG G GG GG G G G Sbjct: 41 GATGGH--GGATGGGGGATGGGATGGGGGATGGGGGATGGH--GGATGGGGGATGDGGG 95 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 1/60 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXX-AXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G GG GG A G GG G G GGG GG GG G G G Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVG 123 Score = 41.5 bits (93), Expect = 0.001 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G GG G G GGG G GG G GGA G G Sbjct: 63 GGGGGATGGG---GGATGGHGGATGGGGGATGDGGGATG---GGGGATGGGGGATGGHG 115 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/64 (40%), Positives = 26/64 (40%), Gaps = 5/64 (7%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXX--GXGGGXXGXXXAGGXXGGAXGG---AX 756 GG G G GG G GG GG G G GG G A G GGA GG A Sbjct: 80 GGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGAT 139 Query: 755 AGXG 744 G G Sbjct: 140 GGHG 143 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG G GG G G G GG G A G GGA GG G Sbjct: 112 GGHGGATGGGVGATGGHGGATGGHGGATG--GHGGATGGGGGATGGGGGATGGGGGATG 168 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG G GG G G G GG G A G GGA GG G Sbjct: 98 GGGGGATGGGGGATGGHGGATGGGVGATG--GHGGATGGHGGATGGHGGATGGGGGATG 154 Score = 40.3 bits (90), Expect = 0.003 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGG-XXGXXXAGGXXGGAXGGAXAGX 747 A G GG GG GG G G G G G GGG G A G GGA GG Sbjct: 68 ATGGGGGATGG--HGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGAT 125 Query: 746 G 744 G Sbjct: 126 G 126 Score = 40.3 bits (90), Expect = 0.003 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = -3 Query: 920 GGXGGXXXG--GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGX 747 GG GG G G GG A G GG G G GGG GG GG GA G Sbjct: 70 GGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGV-GATGGH 128 Query: 746 G 744 G Sbjct: 129 G 129 Score = 39.1 bits (87), Expect = 0.006 Identities = 31/118 (26%), Positives = 31/118 (26%) Frame = -1 Query: 1054 GXGRGAXXGGGGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXRXGXAGAXXGGXAGAA 875 G G GA GG G GG G G G A Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGA 110 Query: 874 XXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 A G GG GG G GG G GGG GGGG G Sbjct: 111 TGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGGATG 168 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G GG GG GG G G GG G G G GGA G G Sbjct: 99 GGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGG 157 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXG-GGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG G G GG G G G GG G GG G GGA G G Sbjct: 105 GGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 38.3 bits (85), Expect = 0.010 Identities = 31/118 (26%), Positives = 31/118 (26%), Gaps = 2/118 (1%) Frame = -1 Query: 1048 GRGAXXGGGG--XGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXRXGXAGAXXGGXAGAA 875 G G GGGG G G G G GG GA Sbjct: 45 GHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGAT 104 Query: 874 XXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G G GG GG GG G GGG GGGG G Sbjct: 105 GGGGGATGGHGGATGGGVGATGGHGGATGG-HGGATGGHGGATGGGGGATGGGGGATG 161 Score = 37.5 bits (83), Expect = 0.018 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXX--GXGGGXXGXXXAGGXXGGAXGG 762 GG G G G G GG GG G G GG G A G GGA GG Sbjct: 115 GGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGGATGG 169 Score = 36.7 bits (81), Expect = 0.031 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G A GG G G GGG G G GG G G GG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG 99 Query: 736 GXXXXGGGG 710 G GGGG Sbjct: 100 GGGATGGGG 108 Score = 35.1 bits (77), Expect = 0.095 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 878 GXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G G GG GG G GG G A G GGA GG G Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATG 84 Score = 34.7 bits (76), Expect = 0.13 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -3 Query: 863 GAGGXRGGXGXX-GXGGGXXGXXXAGGXXG--GAXGGAXAGXG 744 G GG GG G G GGG G GG G G GGA G G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHG 80 Score = 34.7 bits (76), Expect = 0.13 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G A G GG G G GGG GG GG GGA G G Sbjct: 40 GGATGGHGGATGGGG--GATGGGATGGGGGATGGGGGATGG-HGGATGGGG 87 Score = 32.7 bits (71), Expect = 0.51 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG GG G GG G G GGG GGGG G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATG--GGGGATGGGGGATG 77 Score = 28.7 bits (61), Expect = 8.3 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGG-- 454 G GG G GGA GG G G A GGGG Sbjct: 45 GHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGAT 104 Query: 453 GGGG 442 GGGG Sbjct: 105 GGGG 108 Score = 28.7 bits (61), Expect = 8.3 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGG-XGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGG 451 G GGG G GG GG GG G A GGGG Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGA 110 Query: 450 GGG 442 GG Sbjct: 111 TGG 113 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 47.2 bits (107), Expect = 2e-05 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P A PP PP P A PP P P P PPAP PP PP PP PP Sbjct: 155 PSIASQPPQ-PPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPP---PPAPP 209 Score = 42.7 bits (96), Expect = 5e-04 Identities = 25/58 (43%), Positives = 26/58 (44%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P+ A P PPA P P P P PP P AP A PP PP PP PPA Sbjct: 155 PSIASQPPQPPAPPAA--PFMAPAAPPAPPPPGAPAAPPA--PPFGGPPSA-PPPPPA 207 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPP---PXXXPPPXP 827 P P PP P P P P PP PP P PPP P Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPP 800 P PPPP PP P P PP PP PP Sbjct: 178 PPAPPPPGAPAAPPAPPFGGPPSAPP-PPPAPP 209 Score = 29.5 bits (63), Expect = 4.7 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PP P PPP P P P PP PP PPP P Sbjct: 175 PAAPPAP----PPPGAPAAPPAP-PFGGPPSAPP---PPPAP 208 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +2 Query: 551 PXPPXPP--XXAPPXPXPAXXXPPPPXP 628 P PP P APP P PPPP P Sbjct: 181 PPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG GG G GG GG GG G GG GG GG G Sbjct: 580 GNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGG 636 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPP 800 P PPPP PPP P +P PP P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 4/62 (6%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP--XAXXPPXXXP--PXXXPP 912 P P PP PP PP P PPP P P + AP A P P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPP 742 Query: 913 XP 918 P Sbjct: 743 PP 744 Score = 38.7 bits (86), Expect(2) = 5e-05 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P PPPP P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 37.9 bits (84), Expect = 0.014 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG G GG G GG G G GG G GG GG G G Sbjct: 571 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTG 627 Score = 37.5 bits (83), Expect = 0.018 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P P PPP P P PP PP P P PP P PP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPP---PPQPSTPPPPPPSTPP 715 Score = 37.1 bits (82), Expect = 0.024 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G G GG G GG GG GG G GG GG GG G Sbjct: 554 GNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGG 610 Score = 36.3 bits (80), Expect = 0.041 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG GG GG G G GG G GG GG G G Sbjct: 545 GNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTG 601 Score = 36.3 bits (80), Expect = 0.041 Identities = 20/60 (33%), Positives = 22/60 (36%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P PP PP PP P PPP P P P PP P + P P P+ Sbjct: 677 PIQTMVPPPPPP--PP----PPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPS 730 Score = 35.9 bits (79), Expect = 0.055 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P P PPP P P PP PP P P PPP P Sbjct: 675 PIPIQTMVPPPPPPPPPPP--PPPPPPPPQPSTPPPPPP 711 Score = 35.9 bits (79), Expect = 0.055 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXP 815 PPPP PPP P P P PP PPP P Sbjct: 684 PPPPPPPPPPPPPP---PPPPQPSTPPPPPPSTPP 715 Score = 35.5 bits (78), Expect(2) = 4e-04 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P PPP P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 35.1 bits (77), Expect = 0.095 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGA 771 GG G GG G GG G G GG G GG GG+ Sbjct: 597 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGS 646 Score = 35.1 bits (77), Expect = 0.095 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 683 PPPPPPPPPPPPPPPPPPP 701 Score = 34.3 bits (75), Expect = 0.17 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPP 698 Score = 33.9 bits (74), Expect = 0.22 Identities = 22/63 (34%), Positives = 24/63 (38%), Gaps = 4/63 (6%) Frame = -3 Query: 920 GGXGGXXXGGXXXG--GXXAXG--AGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXA 753 G GG GG G G G GG GG G GG G G GG GG+ + Sbjct: 589 GNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGSNS 648 Query: 752 GXG 744 G Sbjct: 649 HSG 651 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPP Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPP 709 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAPAX 890 P P P P P PP PP PPP PPP P AP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPP--PPPPQPSTPPPPPPSTPPVQQSGAPGS 724 Query: 891 P 893 P Sbjct: 725 P 725 Score = 32.7 bits (71), Expect = 0.51 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = -3 Query: 920 GGXGGXXXGGXXXG--GXXAXG--AGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXA 753 G GG GG G G G GG GG G GG G G GG GG Sbjct: 563 GNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNN 622 Query: 752 G 750 G Sbjct: 623 G 623 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G G GG GG G G GG G G GG GG+ G Sbjct: 497 GNNNGENNGGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNG 553 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGG-GGXXG 701 G GG GG GG GG G G GG G GG G Sbjct: 563 GNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNG 605 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGG-GGXXG 701 G GG GG GG GG G G GG G GG G Sbjct: 589 GNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNG 631 Score = 31.9 bits (69), Expect = 0.89 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPP P Sbjct: 685 PPPPPPPPPPPPPPPPPQP 703 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/73 (27%), Positives = 20/73 (27%), Gaps = 1/73 (1%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXG-RXRGXXG 740 G G GG G G GG G GG GG G G G Sbjct: 572 GNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNG 631 Query: 739 GGXXXXGGGGXXG 701 G GG G Sbjct: 632 GNTGGNNNGGNSG 644 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Frame = -3 Query: 911 GGXXXGGXXXGGXX--AXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG GG G GG GG G GG GG G G Sbjct: 520 GGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTG 575 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 P P P P P PP P PP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQP 703 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 P P P P P P P PPPP Sbjct: 691 PPPPPPPPPPPQPSTPPPPPP 711 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGG 716 G GG GG GG GG G G GG G Sbjct: 615 GNTGGNNNGGNTGGNNGGNTGGNNNGGNSGGSNSHSG 651 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXP----XPPPPP 1054 P P P P P PP P PPPPP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/66 (25%), Positives = 19/66 (28%) Frame = -1 Query: 907 GAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXX 728 G+ GG G+ G GG G GG GG G G GG Sbjct: 549 GSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNT 608 Query: 727 XXGGGG 710 G Sbjct: 609 GGNNNG 614 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/70 (27%), Positives = 20/70 (28%), Gaps = 1/70 (1%) Frame = -1 Query: 907 GAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXG-RXRGXXGGGX 731 G GG G + G G GG GG GG G G GG Sbjct: 540 GNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGN 599 Query: 730 XXXGGGGXXG 701 GG G Sbjct: 600 TGGNNGGNTG 609 Score = 27.1 bits (57), Expect(2) = 0.10 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPP 619 P PP PP P P P PP Sbjct: 693 PPPPPPPPPQPSTPPPPPPSTPP 715 Score = 26.6 bits (56), Expect(2) = 4e-04 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 683 PPPPPPPP 690 Score = 26.6 bits (56), Expect(2) = 5e-05 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 684 PPPPPPPP 691 Score = 26.6 bits (56), Expect(2) = 0.10 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 685 PPPPPPPP 692 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 42.7 bits (96), Expect = 5e-04 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP 864 APP PP PP P PPP P P PP PP P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPP-PPFPPPPPPTP 496 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPPP PPP P P PP PP PPP PPP P Sbjct: 464 PPPPPPPPPPPPPP---PPPPPPPPPPFPPP---PPPTP 496 Score = 40.3 bits (90), Expect = 0.003 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 754 AXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXP 855 A PP PP PP P PPP P P PP P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 814 PPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 PPP P P PP PP P PP PP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPP--PPPTP 496 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPP 803 P PPPP PPP P P PP PP PPP Sbjct: 464 PPPPPPPPPPPPPPPPP---PPPPPPPFPPPPPP 494 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 817 PPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P P PP PP P PP PP PP PP Sbjct: 464 PPPPPPPPPPPPPPPP----PPPPPPPPFPPPPPP 494 Score = 38.7 bits (86), Expect = 0.008 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P PPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFP 489 Score = 38.7 bits (86), Expect = 0.008 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P PPPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 38.7 bits (86), Expect(2) = 5e-05 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P PPPP P Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP 894 APP PP PPP P P PP PP P PP P Sbjct: 463 APPPPPP-------PPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 37.1 bits (82), Expect = 0.024 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPP 485 Score = 37.1 bits (82), Expect = 0.024 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPP 486 Score = 37.1 bits (82), Expect = 0.024 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPP 487 Score = 37.1 bits (82), Expect = 0.024 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPPP Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPP 493 Score = 36.7 bits (81), Expect = 0.031 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXP 837 P P PP PP PP P PPP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 36.3 bits (80), Expect = 0.041 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 992 AXPXAPXPXPXPPXPXPPPPP 1054 A P P P P PP P PPPPP Sbjct: 463 APPPPPPPPPPPPPPPPPPPP 483 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 P PPP P P PP PP P PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 34.3 bits (75), Expect = 0.17 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P P PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 34.3 bits (75), Expect = 0.17 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P PPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 34.3 bits (75), Expect = 0.17 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 P P P P P PP P PPPP Sbjct: 474 PPPPPPPPPPPPPPFPPPPPP 494 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFP 489 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PP PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPP 490 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P P PPP Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPP 491 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPP 492 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP PPPPP Sbjct: 473 PPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P P P PPP P Sbjct: 475 PPPPPPPPPPPPPFPPPPPPTP 496 Score = 26.6 bits (56), Expect(2) = 5e-05 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 466 PPPPPPPP 473 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 46.0 bits (104), Expect = 5e-05 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G GG GG G GG GG G G GG G GG G GG G G Sbjct: 137 GGEGNGAGGGIGRGG--GRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGG 193 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 AGG G G GG G G GG G GGG G GG GG G G G Sbjct: 143 AGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRG 202 Score = 43.2 bits (97), Expect = 4e-04 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -3 Query: 908 GXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G G GG GAGG G G G GGG G GG GG GG G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGG 179 Score = 41.9 bits (94), Expect = 8e-04 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG G G A G G GG G G GG G GG GG GG G G Sbjct: 127 GGRGGWRGRGGGEGNG-AGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRG 184 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXG--GRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG G G GR G GGG GGG G Sbjct: 148 GRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRG 191 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXG---GGXXXXGGGGXXG 701 G GGG GGRGG GGR G G G GG GGG G Sbjct: 154 GRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 38.3 bits (85), Expect = 0.010 Identities = 26/69 (37%), Positives = 26/69 (37%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G G G GA G GG GGGRGG GG GR RG GG Sbjct: 131 GWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGG--GGRGRG-TGG 187 Query: 736 GXXXXGGGG 710 G GG G Sbjct: 188 GSRGGGGDG 196 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGGR G GG RG GGG GGG G Sbjct: 142 GAGGGIGRGGGR-GRGGGEGGWGGRGGNGGGRGGGEGGGGRG 182 Score = 35.1 bits (77), Expect = 0.095 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXG---GRXXGRXRGXXGGGXXXXGGGG 710 G GG GGG G G GR GR RG GG GG G Sbjct: 128 GRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNG 169 Score = 34.7 bits (76), Expect = 0.13 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G G GG G G GGG GGG GG GGR G G GG Sbjct: 137 GGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGR--GGGEGG--GGRGRGTGGGSRGG 192 Query: 736 GXXXXGGG 713 G G G Sbjct: 193 GGDGRGRG 200 Score = 34.3 bits (75), Expect = 0.17 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 2/52 (3%) Frame = -3 Query: 893 GXXXGGXXAXGAGGXRGGXGXXGXG-GGXXGXXXAGGXXGGAXG-GAXAGXG 744 G GG G GG RG G G G GG G G GG G G G G Sbjct: 118 GWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNG 169 Score = 29.5 bits (63), Expect = 4.7 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRG-GXGXXGXGGGXXGXXXAG 789 GG GG G GG G G RG G G G GG G G Sbjct: 160 GGWGGRGGNGGGRGGGEGGGGRG-RGTGGGSRGGGGDGRGRGRGG 203 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G G G RGG G R G G GG GGG G Sbjct: 115 GMEGWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRG 156 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 46.0 bits (104), Expect = 5e-05 Identities = 29/65 (44%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Frame = -3 Query: 923 AGGX--GGXXXGGXXXGGXXAXGAGGXRGGXG-XXGXGGGXXGXXXAGGXXGGA--XGGA 759 AGG GG GG GG G GG RGG G G GGG G GG GG GG Sbjct: 88 AGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGG 147 Query: 758 XAGXG 744 G G Sbjct: 148 SKGGG 152 Score = 43.2 bits (97), Expect = 4e-04 Identities = 25/60 (41%), Positives = 26/60 (43%), Gaps = 2/60 (3%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGA--GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG GG G+ GG GG G G GGG G GG GG GG G Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGR-GGGYGGGRRDYG 145 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG G RGG GGR G G GGG G GG G Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYG 138 Score = 38.7 bits (86), Expect = 0.008 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GG GG GG G G GGG GGG G Sbjct: 110 GYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGG 151 Score = 33.5 bits (73), Expect = 0.29 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG GG + G G GG G GGG G GG GG GG G Sbjct: 84 GERGAGGSRAGGYRSGGGG--YGGSSRGGYGGGRGG----GGYGGGRGGGGYGG 131 Score = 31.9 bits (69), Expect = 0.89 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGG 734 G GG GGGRGG GG G GGG Sbjct: 122 GGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 817 GGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GG GG R G GG G RG GGG GGGG G Sbjct: 89 GGSRAGGYRSG--GGGYGGSSRGGYGGG---RGGGGYGG 122 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 46.0 bits (104), Expect = 5e-05 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPP-XPXXPXP-PRXPPAPXAXXPPXXXPPXXXPPXPP 921 PA P PP PA P PPP P P P P A + PP PP PP PP Sbjct: 146 PATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 Score = 43.6 bits (98), Expect = 3e-04 Identities = 22/56 (39%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPP-APXAXXPPXXXPPXXXPPXPPA 924 APP PP P P PP P PP PP AP A P P P PP+ Sbjct: 137 APPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPS 192 Score = 41.9 bits (94), Expect = 8e-04 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 3/75 (4%) Frame = +3 Query: 702 PXXPPPPXX---XXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXX 872 P PPPP PPP P PP PP P PPP P Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPL 183 Query: 873 XAAPAXPPXXAPAXP 917 AA PP P P Sbjct: 184 AAASPPPPSGGPPPP 198 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P A A P PP P P P P PP P PP P PP PP Sbjct: 98 PTPMVAQSVA-PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/60 (43%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPX-PXXPXPPRXPP-APXAXXPPXXXPPXXXPPXPPA 924 P+ AP PP PA P PPP P PP PP AP PP PP PP PA Sbjct: 120 PSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPP---PP---PPIAPA 173 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 4/61 (6%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXX----PPXXXPPXXXPPXP 918 P PP P P P PP P PP PP A PP P PP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Query: 919 P 921 P Sbjct: 168 P 168 Score = 38.7 bits (86), Expect = 0.008 Identities = 26/106 (24%), Positives = 26/106 (24%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAPAX 890 P PP PPP P P PP P PPP P A Sbjct: 108 PTPP----PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGG 163 Query: 891 PPXXAPAXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPPP 1028 PP P P PP P PPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPP P P P P PP P PPP PPP P Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 37.5 bits (83), Expect = 0.018 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P PP P PPP P P R PP P P PP PP PA Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPAT-RAPPPPPPIAPATGGPP-PPPPIAPA 160 Score = 37.5 bits (83), Expect = 0.018 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXX---PPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP AP PA P PPP P PP PP P PP PP P Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP---PPPPPILELAAPPPP 219 Score = 36.7 bits (81), Expect = 0.031 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 8/67 (11%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPX-----PXXPXPPRXPPAPX---AXXPPXXXPPX 900 P P APP P P P P P PPR P P + PP P Sbjct: 76 PTPQTQASTAPPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPAT 135 Query: 901 XXPPXPP 921 PP PP Sbjct: 136 RAPPPPP 142 Score = 36.3 bits (80), Expect = 0.041 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRX-PPAPXAXXPPXXXPPXXXPPXPP 921 PP PP P A P P PP PP P PP PP PP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPP 217 Score = 35.5 bits (78), Expect = 0.072 Identities = 30/116 (25%), Positives = 30/116 (25%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAA 881 P P P PP P PP PP P PPP P Sbjct: 114 PRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP----------PIAPATGG 163 Query: 882 PAXPPXXAPAXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPXPXPPPPXXAPRP 1049 P PP APA PP P PPPP P P Sbjct: 164 PPPPPPIAPA----------ATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 35.1 bits (77), Expect = 0.095 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 8/70 (11%) Frame = +2 Query: 437 GXPPPPP--------PPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXP 592 G PPPPP PPP P PP PP PP P Sbjct: 150 GPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Query: 593 XPAXXXPPPP 622 PPPP Sbjct: 210 ILELAAPPPP 219 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 437 GXPPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPP 616 G PPP PPP A P PP PP P P PP Sbjct: 149 GGPPP--PPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPP 206 Query: 617 PP 622 PP Sbjct: 207 PP 208 Score = 34.3 bits (75), Expect = 0.17 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +1 Query: 754 AXAPPXAPPXXPPAXXXPXXPPP--XPXXPXPPRXPP-APXAXXPPXXXP--PXXXPPXP 918 A PP P P PPP P PP PP AP PP P P P P Sbjct: 107 APTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPP 166 Query: 919 P 921 P Sbjct: 167 P 167 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPP 209 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 992 AXPXAPXPXPXPPXPXPPPPP 1054 A P P P PP P PPPPP Sbjct: 186 ASPPPPSGGPPPPPPPPPPPP 206 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPPP PPP P PP PP P PP P Sbjct: 188 PPPPSGGPPPPPPP-------PPPPPPPPILELAAPPPP 219 Score = 30.7 bits (66), Expect = 2.1 Identities = 21/99 (21%), Positives = 21/99 (21%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPP 622 PPPPP P P PP P P PPPP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Query: 623 XPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPAXXXPP 739 PPPP PP Sbjct: 170 IAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP 864 P PA A P P P PPP P P P AP Sbjct: 177 PAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAP 216 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPP 622 P PP PP AP P A PPPP Sbjct: 108 PTPPPPP-RAPETPSQAPSPPPPP 130 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPP 858 P A +PP PP P PPP P PP Sbjct: 182 PLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +2 Query: 989 PAXPXAPXPXPXP---PXPXPPPPP 1054 PA P A P P P P PPPPP Sbjct: 179 PAVPLAAASPPPPSGGPPPPPPPPP 203 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 45.6 bits (103), Expect = 7e-05 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG G A G G G G G GG G G GGA G A AG G Sbjct: 38 GVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAG 96 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG GG GAG GG G G AGG GG G G G Sbjct: 54 GAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG GG GG G GG G G G G G GG GG G +G Sbjct: 59 GCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 43.2 bits (97), Expect = 4e-04 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G GG GG G G G G G GGG G GG G GG AG G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDG-GNGGGGAGNGGGGGGAGNG 85 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG GG GG G G G G GG G GG GGA G AG Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/59 (40%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = -3 Query: 920 GGXG-GXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXX-GGAXGGAXAG 750 GG G G GG GG G GG G G G G G G A G GG GG +G Sbjct: 47 GGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSG 105 Score = 36.3 bits (80), Expect = 0.041 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G G G GA G GGG G G GG GG G G G Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGG---GAGNGGGGGGAGNGGAAGAAGA 93 Query: 736 GXXXXGGGGXXG 701 G GGG G Sbjct: 94 GAGGNVGGGGSG 105 Score = 35.1 bits (77), Expect = 0.095 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG G G G GGG GGG G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAG 74 Score = 34.3 bits (75), Expect = 0.17 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = -1 Query: 907 GAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXX 728 G GG AG G GGG GGG GG G G GG Sbjct: 42 GGGNGGGAGNGVGAGGCGCGGGNDGGNG-GGGAGNGGGGGGAGNGGAAGAAGAGAGGNVG 100 Query: 727 XXGGGGXXG 701 G GG G Sbjct: 101 GGGSGGVGG 109 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/72 (27%), Positives = 20/72 (27%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G G G GA GG G G GG G G GG Sbjct: 43 GGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 Query: 736 GXXXXGGGGXXG 701 G GG G G Sbjct: 103 GSGGVGGNGGSG 114 Score = 32.3 bits (70), Expect = 0.67 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGG 786 GG G GG G A GA G G G G G G G Sbjct: 70 GGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G G G G G GG GG GG G GGG GG Sbjct: 47 GGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGG 106 Query: 447 GG 442 G Sbjct: 107 VG 108 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGG--GGXXG 701 G G GGG G GG G G GG GG GG G Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGG 70 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXG-GXGGXG 550 G GGGG G GGA G G GG G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCG 59 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 45.2 bits (102), Expect = 9e-05 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P + P PP PP P PPP P PP AP PP P PP PP Sbjct: 935 PPPGGSAPSQPP--PPGGNAPPPPPP-PGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 43.2 bits (97), Expect = 4e-04 Identities = 21/58 (36%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = +1 Query: 751 PAXAPPXA--PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P+ +PP PP PP PPP P P + PP P PP PP P P Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPP-PGGNAPPPPPPPGGSAPPP 966 Score = 42.7 bits (96), Expect = 5e-04 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 5/64 (7%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPA-----PXAXXPPXXXPPXXXP 909 P P P PP PP P PPP PP PP P PP PP Sbjct: 924 PPPGGNAPLPPP--PPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSA 981 Query: 910 PXPP 921 P PP Sbjct: 982 PPPP 985 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPPP PPP P PP PPP PPP P Sbjct: 953 PPPPPPPGGSAPPPGG--GAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 +P PP P PPP P P PP P P PP P PP Sbjct: 909 SPSASPPGGSVP--PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPP 956 Score = 37.5 bits (83), Expect = 0.018 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 8/64 (12%) Frame = +1 Query: 745 PXPAXAPPXAPP--------XXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPX 900 P PP PP PP P PPP PP PP A P PP Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPL 973 Query: 901 XXPP 912 PP Sbjct: 974 PPPP 977 Score = 35.9 bits (79), Expect = 0.055 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 437 GXPPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPP 616 G PPPPPP P PP P APP A PP Sbjct: 916 GGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPP 975 Query: 617 PP 622 PP Sbjct: 976 PP 977 Score = 35.9 bits (79), Expect = 0.055 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 5/74 (6%) Frame = +3 Query: 702 PXXPPPPXXXXP-PPXXPRXRPXXRPP----XXPPRPPPXXXPPPXPXXXXXXXXXXXXX 866 P PPPP P PP P +PP PP PPP P P Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGG 979 Query: 867 XXXAAPAXPPXXAP 908 P PP P Sbjct: 980 SAPPPPPPPPPPPP 993 Score = 35.1 bits (77), Expect = 0.095 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 6/70 (8%) Frame = +2 Query: 437 GXPPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPX------PPXXAPPXPXP 598 G PPPPPPP P PP P APP P P Sbjct: 917 GSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Query: 599 AXXXPPPPXP 628 PPP P Sbjct: 977 PGGSAPPPPP 986 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR 849 P P P PP PP P PPP P P P R Sbjct: 964 PPPGGGAPPLPP--PPGGSAPPPPPPPPPPPPPMR 996 Score = 32.3 bits (70), Expect = 0.67 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP P APP P P PPPP P Sbjct: 972 PLPPPPGGSAPPPPPP---PPPPPPP 994 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 714 PPPXXXXPP-PXXPRXRPXXRPPXXPPRPPP 803 PPP PP P P PP PP PPP Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 P P P P PP P PPPP Sbjct: 974 PPPPGGSAPPPPPPPPPPPPP 994 Score = 31.1 bits (67), Expect = 1.6 Identities = 20/70 (28%), Positives = 20/70 (28%), Gaps = 3/70 (4%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP---XPXXXXXXXXXXXXXXXXAAPA 887 PP PPP P PP P P PPP P A P Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPL 973 Query: 888 XPPXXAPAXP 917 PP A P Sbjct: 974 PPPPGGSAPP 983 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/76 (26%), Positives = 21/76 (27%), Gaps = 4/76 (5%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPP----XXPPRPPPXXXPPPXPXXXXXXXXXXXXXX 869 P PP PPP P PP P +PPP P P Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGG 969 Query: 870 XXAAPAXPPXXAPAXP 917 P P AP P Sbjct: 970 APPLPPPPGGSAPPPP 985 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = +2 Query: 437 GXPPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPP 616 G P PPPPP P PP PP PP Sbjct: 928 GNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPP 987 Query: 617 PPXP 628 PP P Sbjct: 988 PPPP 991 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Frame = +2 Query: 992 AXPXAPXPX---PXPPXPXPPPPP 1054 A P P P P PP P PPPPP Sbjct: 970 APPLPPPPGGSAPPPPPPPPPPPP 993 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPP 992 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPXPXXPXPPRXP--PAPXAXXPPXXXPPXXXPP 912 +P P P PP P PP P AP PP P PP Sbjct: 899 SPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPP 947 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 45.2 bits (102), Expect = 9e-05 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 GG GG GG GG G GG GG G G GGG G GG GG G Sbjct: 81 GGRGGGFGGGGGFGG----GGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 43.2 bits (97), Expect = 4e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GGG GG GG G G GGG GGGG Sbjct: 86 GFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG GG GG G G GGG GGGG G Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G G GG GG G G GGG G GG GG GG G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GGG GG G G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 857 GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG G G GGG G GG GG GG G G Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 878 GXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G G GG GG G GGG G GG GG GG G G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 35.5 bits (78), Expect = 0.072 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXA 753 GG GG G GG G GG GG G G G G G G A + A Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRARPASSNSNA 140 Score = 33.1 bits (72), Expect = 0.39 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGG 117 Score = 31.9 bits (69), Expect = 0.89 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGG 556 G GGGG G G GG GG GG Sbjct: 102 GGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 31.9 bits (69), Expect = 0.89 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 621 GGGGXXXAGXGXGGAXXGGXGGXG 550 GGGG G G GG GG GG G Sbjct: 103 GGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -1 Query: 907 GAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXR 752 G GG G G GGG GGG GG GG R R Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRAR 132 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGG G G GG GG GG G Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGG 113 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 100 GFGGGG--GGGFGGGGGGGGGFGGGG 123 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G G GG G G GGG G GG G GGA G G Sbjct: 248 GGGGGATGGG---GGATGGGGGATGGGGGATGGGGGATG---GGGGATGGGGGATGGGG 300 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G G GG G G GGG G GG G GGA G G Sbjct: 255 GGGGGATGGG---GGATGGGGGATGGGGGATGGGGGATG---GGGGATGGGGGATGGGG 307 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G G GG G G GGG G GG G GGA G G Sbjct: 269 GGGGGATGGG---GGATGGGGGATGGGGGATGGGGGATG---GGGGATGVGGGATGGGG 321 Score = 43.6 bits (98), Expect = 3e-04 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 2/61 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXX--GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGX 747 GG GG GG GG A G GG G G GGG GG GG G G Sbjct: 290 GGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGG 349 Query: 746 G 744 G Sbjct: 350 G 350 Score = 43.2 bits (97), Expect = 4e-04 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 A G GG GG GG G G GG G G GGG G GG GG G G G Sbjct: 274 ATGGGGGATGG--GGGATGGGGGATGGGGGATGGGGGATG--VGGGATGGGGGATGGGVG 329 Score = 43.2 bits (97), Expect = 4e-04 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 A G GG GG GG G G GG G G GGG G GG GG G G G Sbjct: 281 ATGGGGGATGG--GGGATGGGGGATGGGGGATGVGGGATG--GGGGATGGGVGATGGGGG 336 Score = 43.2 bits (97), Expect = 4e-04 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXG-GXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G GG G G A G GG G G GGG GG GG GGA G G Sbjct: 298 GGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGG-GGATGGGG 356 Score = 42.3 bits (95), Expect = 6e-04 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG GG G G GG G G GGG G GG G GGA G G Sbjct: 242 GGGGATGGG---GGATGGGGGATGGGGGATGGGGGATG---GGGGATGGGGGATGGGG 293 Score = 42.3 bits (95), Expect = 6e-04 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 A G GG GG GG G G GG G G GGG G GG GG G G G Sbjct: 309 ATGVGGGATGGG--GGATGGGVGATGGGGGATGGGGGVTGG--GGGATGGGGGPGSGGCG 364 Score = 41.9 bits (94), Expect = 8e-04 Identities = 32/117 (27%), Positives = 32/117 (27%), Gaps = 1/117 (0%) Frame = -1 Query: 1048 GRGAXXGGGGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXRXGXAGAXXGGXAGAAXX 869 G GA GGGG GG G G G G Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 302 Query: 868 XXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXX-GRXRGXXGGGXXXXGGGGXXG 701 GGG GGG G GG G G GGG GGGG G Sbjct: 303 TGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPG 359 Score = 41.1 bits (92), Expect = 0.001 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXX--GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGX 747 GG GG GG GG A G GG G G GGG G GG GGA G Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGG-GGATGGG 341 Query: 746 G 744 G Sbjct: 342 G 342 Score = 39.9 bits (89), Expect = 0.003 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G GA GG G A A G GG GGG G GG G GG Sbjct: 242 GGGGATGGG--GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 299 Query: 736 GXXXXGGGGXXG 701 G GGGG G Sbjct: 300 GGATGGGGGATG 311 Score = 38.3 bits (85), Expect = 0.010 Identities = 35/121 (28%), Positives = 35/121 (28%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXGXXXX 732 G GG GG A G GG G G GGG GG GG GGA G G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG-GGATGGGGGATG 297 Query: 731 XXXXXXXXXXXXXXXXGXXXXXXXXXXXXGRRXXXGXXAGGXGXRGXGXAGXXXXXGAXG 552 G G G GG G G G GA G Sbjct: 298 GGGGATGGGGGATGVGGGATGGGGGATGGG----VGATGGGGGATGGGGGVTGGGGGATG 353 Query: 551 G 549 G Sbjct: 354 G 354 Score = 37.9 bits (84), Expect = 0.014 Identities = 33/120 (27%), Positives = 33/120 (27%), Gaps = 2/120 (1%) Frame = -1 Query: 1054 GXGRGAXXGGGGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXRXGXAGAXXG--GXAG 881 G G GA GGGG GG G G G G G Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Query: 880 AAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 A A G G GGG G GG G GGG GG G G Sbjct: 308 GATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 814 GXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG G GG G GGG GGGG G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 276 Score = 32.3 bits (70), Expect = 0.67 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 860 AGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 + G GG G G GGG G GG G GGA G G Sbjct: 237 SNGRLGGGGATGGGGGATG---GGGGATGGGGGATGGGG 272 Score = 28.7 bits (61), Expect = 8.3 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 5/67 (7%) Frame = -2 Query: 627 GXGGGGXXXAG---XGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGG 457 G GGG G G GGA GG G G A GGG Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGG 342 Query: 456 G--GGGG 442 G GGGG Sbjct: 343 GVTGGGG 349 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 44.4 bits (100), Expect = 2e-04 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = +1 Query: 763 PPXAPPXXPP--AXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP PP PP + P PPP P P PP P + P P PP PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 39.5 bits (88), Expect = 0.004 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 8/65 (12%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPX----XPXPPRXPPAPXAXXPPXXXPP----XXX 906 P PP PP P PPP P P PP P A PP PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGL 753 Query: 907 PPXPP 921 PP PP Sbjct: 754 PPPPP 758 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXR--PPXXPPRPPPXXXPPPXP 827 P PPPP PP P +P PP PP PP PP P Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 Score = 36.7 bits (81), Expect = 0.031 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 5/56 (8%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXP-----XXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP PP PPP P P PP PP A PP PP P P Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPP-PPPPIDVPMKP 766 Score = 34.7 bits (76), Expect = 0.13 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPP 622 PPPPPP P P PP PP PP P A PPPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTL---PMPPPPP---PPPPGCAGLPPPPP 730 Query: 623 XP 628 P Sbjct: 731 SP 732 Score = 34.7 bits (76), Expect = 0.13 Identities = 21/73 (28%), Positives = 21/73 (28%), Gaps = 5/73 (6%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPP-----RPPPXXXPPPXPXXXXXXXXXXXXXXXXA 878 PPP PPP P PP PP PPP P P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGL 753 Query: 879 APAXPPXXAPAXP 917 P PP P P Sbjct: 754 PPPPPPIDVPMKP 766 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 2/64 (3%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXP--AXXXPP 616 PPPPPPPP P P PP P P PP Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPP 755 Query: 617 PPXP 628 PP P Sbjct: 756 PPPP 759 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP--XXXPPXPPA 924 P PP P PP P P PP PP PP PP PP+ Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPS 731 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 5/65 (7%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPP-----XPPXXAPPXPXPAXX 607 PPPPPPPP P P PP PP P A Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGL 753 Query: 608 XPPPP 622 PPPP Sbjct: 754 PPPPP 758 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 12/65 (18%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXP--------XXPXPPRXPPAPXAXXPPXXXPP----XXX 906 PP P + P PPP P P PP PP A PP P Sbjct: 680 PPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGL 739 Query: 907 PPXPP 921 PP PP Sbjct: 740 PPPPP 744 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 288 PPPPXPXPXTXAGXPPP 338 PPPP P P AG PPP Sbjct: 712 PPPPPPPPPGCAGLPPP 728 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 288 PPPPXPXPXTXAGXPPP 338 PPPP P P AG PPP Sbjct: 740 PPPPPPPPPGCAGLPPP 756 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 2/63 (3%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPP--AXX 730 PP PP PP PPPP P PPPP A Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGL 753 Query: 731 XPP 739 PP Sbjct: 754 PPP 756 Score = 28.7 bits (61), Expect = 8.3 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 437 GXPPPPPPPP 466 G PPPPPPPP Sbjct: 738 GLPPPPPPPP 747 Score = 26.2 bits (55), Expect(2) = 0.50 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 8/74 (10%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXX--------PPPXPXXXXXXXXXXXXX 866 PPPP PP PP PP PPP PPP P Sbjct: 677 PPPP----PPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Query: 867 XXXAAPAXPPXXAP 908 A PP P Sbjct: 733 QPGCAGLPPPPPPP 746 Score = 25.0 bits (52), Expect(2) = 0.50 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 1005 PPXPXPPPPXXAPRP 1049 PP P PPPP A P Sbjct: 740 PPPPPPPPPGCAGLP 754 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 44.4 bits (100), Expect = 2e-04 Identities = 24/60 (40%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXG---XGGGXXGXXXAGGXXGGAXGGAXAG 750 GG G GG GG G GG RGG G G GGG G GG G G +G Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSG 808 Score = 43.2 bits (97), Expect = 4e-04 Identities = 27/65 (41%), Positives = 27/65 (41%), Gaps = 6/65 (9%) Frame = -3 Query: 920 GGXGGXXXGGXXX------GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGA 759 GG GG GG GG GG RGG G G GGG G GG GG GG Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRG---GGGYGGGHRGGG 786 Query: 758 XAGXG 744 G G Sbjct: 787 GYGGG 791 Score = 37.1 bits (82), Expect = 0.024 Identities = 23/59 (38%), Positives = 25/59 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG GG GG G GG GG G G G +GG G+ GG G G Sbjct: 766 GGGGGGYRGGGGYGGGHR-GGGGYGGGGHRGGSYSGYRGSYKSGGYGQGS-GGYGQGSG 822 Score = 36.3 bits (80), Expect = 0.041 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 +GG GG GG RGG G G GGG G G GG G G Sbjct: 704 SGGYGGYNRSPQQYGGRGGWQKDYQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGG 763 Score = 36.3 bits (80), Expect = 0.041 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG GG GG G G G GGGG G Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRG 795 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G G GG RGG G G RG G G GGGG G Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGG 790 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 826 GXGGGXXXGG--GRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GG R GG G GGG GGGG G Sbjct: 731 GRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRG 774 Score = 29.5 bits (63), Expect = 4.7 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 826 GXGGGXXXGGGRG--GXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GGG G G GG G RG G G GG Sbjct: 777 GYGGGHRGGGGYGGGGHRGGSYSG-YRGSYKSGGYGQGSGG 816 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PPPP PPP P P +PP PP PP PPP Sbjct: 556 PPPPGVDIPPPLPPSEDP--KPPPPPPEPPEECPPPP 590 Score = 41.5 bits (93), Expect = 0.001 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPA-PXAXXPPXXXPPXXXPPXPP 921 P PA AP P PP PP P PP PP+ PP PP PP PP Sbjct: 540 PIPAVAPAVTPSEEPP--------PPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 31.9 bits (69), Expect = 0.89 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P P PP PPPPP Sbjct: 573 PKPPPPPPEPPEECPPPPP 591 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +2 Query: 989 PAXPXAPXPXPXPPX--PXPPPPP 1054 P P P P PP P PPPPP Sbjct: 556 PPPPGVDIPPPLPPSEDPKPPPPP 579 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP P PP P+ PPP P Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPP 579 Score = 28.7 bits (61), Expect = 8.3 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPP---PPP 1054 P P + P P PP P PP PPP Sbjct: 565 PPLPPSEDPKPPPPPPEPPEECPPP 589 Score = 28.7 bits (61), Expect(2) = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Frame = +2 Query: 551 PXPPXP-PXXAPPXPXPAXXXPPPP 622 P PP P PP P P PPPP Sbjct: 566 PLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 28.3 bits (60), Expect(2) = 1.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP P PPPP P Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPP 580 Score = 21.0 bits (42), Expect(2) = 1.5 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 443 PPPPPP 460 PPPPPP Sbjct: 554 PPPPPP 559 Score = 21.0 bits (42), Expect(2) = 1.9 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 Query: 446 PPPPPP 463 PPPPPP Sbjct: 554 PPPPPP 559 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/57 (38%), Positives = 26/57 (45%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG G GG GG A G G + G G G GGG G G GG+ G+ +G Sbjct: 110 GGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAG-GGGQEGGGQGGAQAGGSTSGSSSG 165 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/60 (35%), Positives = 23/60 (38%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 AGG G GG G A G G GGG G G G + GGA +G G Sbjct: 113 AGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGG 172 Score = 40.3 bits (90), Expect = 0.003 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXG-AGGXRGGXGXXGXGGGXX---GXXXAGGXXGGAXGGAXAG 750 G GG GG A G AGG GG G G G G GG GG GGA AG Sbjct: 99 GASTSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAG 156 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/60 (33%), Positives = 22/60 (36%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 AGG G GG GG G G G G G GG G+ G + AG G Sbjct: 127 AGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGG 186 Score = 35.5 bits (78), Expect = 0.072 Identities = 21/58 (36%), Positives = 23/58 (39%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 A G GG GG GG A G+ G GGG G GG+ GA AG Sbjct: 139 AAGGGGQEGGGQ--GGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAG 194 Score = 34.7 bits (76), Expect = 0.13 Identities = 22/59 (37%), Positives = 23/59 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G G GG A G GG GG G GG G +G GGA G G Sbjct: 124 GGQAGGQAGSQAGGG--AAGGGGQEGG----GQGGAQAGGSTSGSSSGGATSGGGGVSG 176 Score = 33.9 bits (74), Expect = 0.22 Identities = 23/68 (33%), Positives = 24/68 (35%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G AG GG AG GGG GGG+GG G G G G Sbjct: 111 GEAGGEAGGQAGGGGQAGGQAGSQAGGG--AAGGGGQEGGGQGGAQAG---GSTSGSSSG 165 Query: 736 GXXXXGGG 713 G GGG Sbjct: 166 GATSGGGG 173 Score = 33.9 bits (74), Expect = 0.22 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = -3 Query: 917 GXGGXXXG--GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG G G GG A G G GG G GG G G GG GG G Sbjct: 122 GGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGG--GGVSGSSG 179 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -1 Query: 820 GGGXXXGGGR-GGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG+ GG GG G G GGGG G Sbjct: 136 GGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSG 176 Score = 33.1 bits (72), Expect = 0.39 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = -3 Query: 920 GGXGGXXXGGXXXG---GXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXA 753 GG GG GG G G G GG G G GGG AG G A A Sbjct: 148 GGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAGATSAGGSSLAAA 206 Score = 31.9 bits (69), Expect = 0.89 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 AG G G G GG GG G AGG G GG AG G Sbjct: 84 AGHVFNVFANGTAQAGASTSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGG 143 Score = 31.9 bits (69), Expect = 0.89 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -3 Query: 908 GXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G G G A G G G G GGG G GGA GG G Sbjct: 94 GTAQAGASTSGGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGG 148 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXX-GGAXGGAXAGXG 744 G G GG GG AGG G G G G + G G A AG G Sbjct: 136 GGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAG 194 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GG GGG+ G G G G GGG GG G Sbjct: 115 GEAGGQAGGGGQAGGQAGSQAG--GGAAGGGGQEGGGQG 151 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG G G GG G G GG GGG G Sbjct: 109 GGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGG 148 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 37.9 bits (84), Expect = 0.014 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPP 846 PP PP PP P PPP P P PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 37.1 bits (82), Expect = 0.024 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPP 803 PPPP PPP P P PP PP PPP Sbjct: 1157 PPPPP---PPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 36.7 bits (81), Expect = 0.031 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRP 797 PPPP PPP P P PP PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 36.3 bits (80), Expect(2) = 2e-04 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP +P P P PPPP P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.5 bits (78), Expect(2) = 4e-04 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP P P P PPPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 35.5 bits (78), Expect = 0.072 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPP 846 PP PP PP+ P PPP P P P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.1 bits (77), Expect = 0.095 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 814 PPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 PPP P P PP P+P PP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 35.1 bits (77), Expect = 0.095 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 835 PXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP PP P + PP PP PP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 34.7 bits (76), Expect = 0.13 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 735 PPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPP P P P PP PPP PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP-PPPPPTP 1186 Score = 34.7 bits (76), Expect = 0.13 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P +P P P PP P PPP P Sbjct: 1165 PPPPSSPSPPPPPPPPPPPPTP 1186 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P P P PPPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPP 1179 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPP 1182 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPPP 1184 Score = 33.1 bits (72), Expect = 0.39 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXP 628 PP PP PP P PPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPP 1180 Score = 32.3 bits (70), Expect = 0.67 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXPP 882 P PPP P P P PP P PP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 32.3 bits (70), Expect(2) = 0.003 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP + P P P PPPP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPP-PPPPPP 1184 Score = 31.9 bits (69), Expect = 0.89 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXP 837 P PP PP P+ P PPP P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 31.9 bits (69), Expect = 0.89 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXPP 882 P PPP P P PP PP P P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXP 828 P P PP PP P P PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 31.5 bits (68), Expect = 1.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 835 PXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP PP P + P PP PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P P PPPPP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPP 1180 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P P PPPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPP 1181 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPP 1183 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +2 Query: 998 PXAPXPXPXPP--XPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPP 1177 Score = 26.6 bits (56), Expect(2) = 4e-04 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 1157 PPPPPPPP 1164 Score = 26.6 bits (56), Expect(2) = 0.003 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 1158 PPPPPPPP 1165 Score = 26.6 bits (56), Expect(2) = 2e-04 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 1159 PPPPPPPP 1166 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 43.6 bits (98), Expect = 3e-04 Identities = 32/127 (25%), Positives = 34/127 (26%), Gaps = 2/127 (1%) Frame = +1 Query: 547 APPXAPXXXXXPAXPXPRXPXPPAXXPXXXRRXXXXXXXXXXXXXXXXXXXXXXXXXXXX 726 APP P P P P P PP Sbjct: 193 APPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPL 252 Query: 727 XXXXXXPX-PAXAPPXAPPXXPPAXXXPXXP-PPXPXXPXPPRXPPAPXAXXPPXXXPPX 900 P P +P + P PP P P P P P P PPAP P P Sbjct: 253 PPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNP 312 Query: 901 XXPPXPP 921 PP PP Sbjct: 313 HIPPAPP 319 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPP--PXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P P+ P P PP+ P PP P P P PP P P A P P PP P Sbjct: 180 PAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPP---APPNP 236 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P PPA PP P P PP P AP P P P PPA Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPP-IPTAPPTPPMPETPLPPGSPHIPPA 223 Score = 37.5 bits (83), Expect = 0.018 Identities = 26/105 (24%), Positives = 28/105 (26%), Gaps = 1/105 (0%) Frame = +1 Query: 550 PPXAPXXXXXPAXPXPRXPXPP-AXXPXXXRRXXXXXXXXXXXXXXXXXXXXXXXXXXXX 726 PP +P PA P P P PP P Sbjct: 262 PPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNP 321 Query: 727 XXXXXXPXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPA 861 P P+ P P PPA P PP P PP P A Sbjct: 322 YIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATPNA 366 Score = 37.5 bits (83), Expect = 0.018 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +1 Query: 766 PXAPPXX--PPAXXXPXXPP--PXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P APP P A P PP P P P P P P A P P P PPA Sbjct: 297 PPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPA 353 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXP-PPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P AP P P P PP P P P P P P P P PP Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPP 231 Query: 922 A 924 A Sbjct: 232 A 232 Score = 36.7 bits (81), Expect = 0.031 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Frame = +1 Query: 745 PXPAXAPPXAP-PXXPPAXXXPXXP--PPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPX 915 P AP P P PPA P P PP P P P P +P PP P PP Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSP--HIPPAPLHP-HIPPA 232 Query: 916 PP 921 PP Sbjct: 233 PP 234 Score = 36.7 bits (81), Expect = 0.031 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 7/67 (10%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXX------PXPPRXP-PAPXAXXPPXXXPPXX 903 P P P P PPA P PP P P PP P P A P P Sbjct: 207 PMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASP 266 Query: 904 XPPXPPA 924 P PPA Sbjct: 267 NPSIPPA 273 Score = 36.7 bits (81), Expect = 0.031 Identities = 24/93 (25%), Positives = 24/93 (25%) Frame = +3 Query: 549 APXRPXXPRXPRPXXPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPXXPPPPXX 728 AP P P P P P P P PP P Sbjct: 273 APPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSI 332 Query: 729 XXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PP P P P PP PP PP P Sbjct: 333 PPAPPN-PSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 36.7 bits (81), Expect = 0.031 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 4/62 (6%) Frame = +1 Query: 751 PAXAPPXAPPXX--PPAXXXPXXP--PPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P + P APP PPA P PP P P P P P A P P P P Sbjct: 283 PNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIP 342 Query: 919 PA 924 PA Sbjct: 343 PA 344 Score = 36.3 bits (80), Expect = 0.041 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 8/68 (11%) Frame = +1 Query: 745 PXPAXAPPXAP-PXXPPAXXXPXXP-----PPXPXXPXPPRXPPAP--XAXXPPXXXPPX 900 P APP P P PP P P P P P P PPAP + PP Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPM 247 Query: 901 XXPPXPPA 924 P PPA Sbjct: 248 PETPLPPA 255 Score = 36.3 bits (80), Expect = 0.041 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR--XPPAPXAXXPPXXXPPXXXPPXPP 921 P+ P P PP P PP P PP PPAP P P PP P Sbjct: 306 PSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 35.9 bits (79), Expect = 0.055 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 6/65 (9%) Frame = +1 Query: 745 PXPAX-APPXAPPXXPPAXXXPXXPPP-----XPXXPXPPRXPPAPXAXXPPXXXPPXXX 906 P P+ APP P P A P PP P P P PPAP P P Sbjct: 275 PNPSIPAPPN--PSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSI 332 Query: 907 PPXPP 921 PP PP Sbjct: 333 PPAPP 337 Score = 33.9 bits (74), Expect = 0.22 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPX--PXXPXPPRXPPAPX-AXXPPXXXPPXXXPPXPP 921 P P P PP P PP P P P PPAP PP P PP PP Sbjct: 297 PPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPP-APPNPSIPPAPP 355 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP P P+ PP P P P PP P P P PP PP Sbjct: 291 PPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSI---PPAPPNPSIPPAPP 346 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P PP P P PP P A P P PP PP Sbjct: 162 PPVTETTTTKPETKPPKPPAPSTIPTPPTPPA---PPSPPIPTAPPTPP 207 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP--XXXPPXXXPPXP 918 P PP P PP P PP PPAP + P PP P P Sbjct: 156 PTITSKPPVTETTTTKPETKPPKPPAPSTIPTPP-TPPAPPSPPIPTAPPTPPMPETPLP 214 Query: 919 P 921 P Sbjct: 215 P 215 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 1/61 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP-XPP 921 P P PP P P P P P P + P P PP P PP Sbjct: 204 PTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPP 263 Query: 922 A 924 A Sbjct: 264 A 264 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PP P PP P P P PP PP P P Sbjct: 176 PPKPPAPSTIPTPPTPPAP-PSPPIPTAPPTPPMPETPLP 214 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 702 PXXPP-PPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXP--PPXP 827 P PP PP P P P P PP PP P PP P Sbjct: 268 PSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNP 312 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 720 PXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P P P P P P PP PP PP P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPP 207 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P AP P PP P PP P Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSP 197 Score = 29.5 bits (63), Expect = 4.7 Identities = 18/69 (26%), Positives = 18/69 (26%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAPAX 890 P PP PP P P P PP PP P A P Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNP 245 Query: 891 PPXXAPAXP 917 P P P Sbjct: 246 PMPETPLPP 254 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRP-PXXPPRPP-PXXXPPPXP 827 PP P PP P P P PP PP P PP P Sbjct: 245 PPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNP 285 Score = 28.7 bits (61), Expect = 8.3 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPP 622 PP PP PP P P P APP P A P PP Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPP-APPNPSKAIATPNPP 246 Query: 623 XP 628 P Sbjct: 247 MP 248 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 43.6 bits (98), Expect = 3e-04 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 3/62 (4%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXP---XXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPX 915 P +PP A P PP P P P P P PP PAP PP PP P Sbjct: 1029 PKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPP---PPSTSQPV 1085 Query: 916 PP 921 PP Sbjct: 1086 PP 1087 Score = 37.9 bits (84), Expect = 0.014 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPP-RXPPAPXAXXPPXXXPPXXXPPXP 918 P P P PP P P P P P P PP R PP P P PP P P Sbjct: 1040 PLPPPRKPSPPPSAVPIPP-PRKPSPPPSEPAPPPRQPPPPSTSQP--VPPPRQPDPIP 1095 Score = 37.5 bits (83), Expect = 0.018 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 5/63 (7%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXP---XXPPPXPXXPXPPRXPPAPXAXXP--PXXXPPXXXP 909 P PP P PP+ P PPP P PP P P P P PP Sbjct: 1051 PSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPK 1110 Query: 910 PXP 918 P P Sbjct: 1111 PTP 1113 Score = 37.1 bits (82), Expect = 0.024 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAPAXP 893 PPP PPP P +P P P P PP P PA P Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHP 1101 Query: 894 PXXAPAXP 917 P P Sbjct: 1102 TEPPPRQP 1109 Score = 36.3 bits (80), Expect = 0.041 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXX-PPXXXPPXPP 921 P P P +PP PA PPP P PP P P P PP P P Sbjct: 1055 PIPPPRKP-SPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTP 1113 Query: 922 A 924 A Sbjct: 1114 A 1114 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRP-XXRPPXXPPRPPPXXXPPP 821 PPP PP P P PP P PPP PPP Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 Score = 34.3 bits (75), Expect = 0.17 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPR-PPPXXXPPPXPXXXXXXXXXXXXXXXXAAPA 887 PPP PPP P P P PPR PPP P P P Sbjct: 1049 PPPSAVPIPPPRKPS--PPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPP 1106 Query: 888 XPPXXAPA 911 P PA Sbjct: 1107 RQPKPTPA 1114 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPPP P P + P P P PPP P P P Sbjct: 1073 PRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPP-RQPKPTP 1113 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P + P PP PP P P P P P PA PP P P Sbjct: 1062 PSPPPSEPAPPPRQPP-PPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAP 1115 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/59 (32%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXP-PAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P P+ + P PP P P P P P P P+ PAP P PP P Sbjct: 1077 PPPSTSQPVPPPRQPDPIPTNPAHPTEPP--PRQPKPTPAPRPRSWVESQPELHRPPPP 1133 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 PP P P P PPP P P P + P PP P P Sbjct: 1087 PPRQPDPIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQPELHRPPPPIKPKP 1138 Score = 32.7 bits (71), Expect = 0.51 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXP--PRXPPAPXAXXPPXXXPPXXXPPXP 918 P P P P P PP P P P PP + P PP PP P Sbjct: 1020 PGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 Score = 31.9 bits (69), Expect = 0.89 Identities = 20/60 (33%), Positives = 22/60 (36%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P PP P P PP P PPR P P + P PP P PP+ Sbjct: 1013 PVPHLKPP-GPTEQPVPPKRKASPPSAQPLP-PPRKPSPPPSAVP---IPPPRKPSPPPS 1067 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRP--XXRPPXXPPRPPPXXXPPP 821 PP PPP P P PP P PPP PP Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPP 1072 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPR---PPPXXXPPPXP 827 P PP P P + P P PPR PPP P P P Sbjct: 1015 PHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPP 1059 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P P PP PPP + P R P P P PP Sbjct: 1066 PSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPP 1105 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/67 (29%), Positives = 25/67 (37%), Gaps = 7/67 (10%) Frame = +1 Query: 745 PXPAXAPPXAPPXXP------PAXXXPXXPPPXP-XXPXPPRXPPAPXAXXPPXXXPPXX 903 P P +PP P P P PP P P PP+ +P + P PP Sbjct: 989 PIPHPSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQP---LPPPR 1045 Query: 904 XPPXPPA 924 P PP+ Sbjct: 1046 KPSPPPS 1052 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P P PP A P P P PPP P Sbjct: 1044 PRKPSPPPSAVPIPPPRKPSPPPSEP 1069 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P P PP PP P + PPP P Sbjct: 1066 PSEPAPPPRQPPPPSTSQPVPPPRQP 1091 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPR-PPPXXXPPPXP 827 P P PP PP P P PPR P P P P Sbjct: 1059 PRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHP 1101 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P P PPP P+ P RP P PPP Sbjct: 1093 PIPTNPAHPTEPPPRQPKPTPAPRPRSWVESQPELHRPPP 1132 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 35.5 bits (78), Expect = 0.072 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P P PPP P P PP PPP PPP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 35.1 bits (77), Expect = 0.095 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 745 PXP-AXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP 879 P P A PP PP PP PPP P PP PPA P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP--PPALNGGPP 231 Score = 33.9 bits (74), Expect(2) = 3e-04 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPP 622 P PP P APP P P PPPP Sbjct: 201 PPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 814 PPPXPXXPXPPRXPPAPX--AXXPPXXXPPXXXPPXPPA 924 P P P PP PP P PP PP PP PPA Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP-PPA 225 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P PPPP P Sbjct: 195 PPPPPPP---PPPGFPGGAPPPPPPP 217 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 276 GRVXPPPPXPXPXTXAGXPPP 338 G PPPP P P G PPP Sbjct: 193 GMPPPPPPPPPPGFPGGAPPP 213 Score = 28.7 bits (61), Expect(2) = 3e-04 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 437 GXPPPPPPPP 466 G PPPPPPPP Sbjct: 193 GMPPPPPPPP 202 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPX-XPXPPR 849 P P PP P PP P PP P PPR Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPPR 232 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 43.2 bits (97), Expect = 4e-04 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPX--PXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 PP PP PP PPP P P PP PP P P PP P P Sbjct: 1238 PPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP PP P P P P P PP PP PP PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPP--GPPGPP 1284 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = +3 Query: 702 PXXPP--PPXXXXPPPXXPRXRPXX-RPPXXPPRP---PPXXXPPPXP 827 P PP PP PP P RP +PP PP P PP PP P Sbjct: 1239 PAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPPP P P P P PP P PP PP P Sbjct: 1253 PPPPPGMRPMPPQPPFMPP--PPRMQPPGPPGPPGPPGP 1289 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 548 RPXPPXPPXXAPPXPXPAXXXPPPPXP 628 RP PP PP PP P PP P Sbjct: 1260 RPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 8/46 (17%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXR------PXXRP-PXXPP-RPPPXXXPPPXP 827 PPP PP P+ P RP P PP PPP PP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGP 1280 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXR--PPXXPPRPPPXXXPP 818 PPPP PP P P R PP P P P P Sbjct: 1254 PPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 43.2 bits (97), Expect = 4e-04 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P P P PPP P P +PP PP PP PPP P Sbjct: 157 PISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIP 198 Score = 43.2 bits (97), Expect = 4e-04 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P P P PPP P P +PP PP PP PPP P Sbjct: 170 PIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIP 211 Score = 42.7 bits (96), Expect = 5e-04 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP-PXPPA 924 P PP PP PP P PP P PP PP PP PP P P PA Sbjct: 177 PRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPP----IDPPRTQPPPIFPQPTTPA 231 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P P P PPP P P +PP PP PP PPP Sbjct: 183 PIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Score = 40.3 bits (90), Expect = 0.003 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = +1 Query: 745 PXPAXAPPXA---PPXXPPAXXXPXXPPPXPXXPXPPRXPP-APXAXXPPXXXPPXXXPP 912 P P PP + PP P P PP P PP PP PP P PP Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 209 Query: 913 XPP 921 PP Sbjct: 210 IPP 212 Score = 40.3 bits (90), Expect = 0.003 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP P PP P PP P PP PP PP PP P PP Sbjct: 164 PRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPP----IDPPRTQPPPIPPIDPP 216 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP 879 P PP PP PP P PP P PP P P P Sbjct: 190 PRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 35.1 bits (77), Expect = 0.095 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 745 PXPAXAPPXA-PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP 894 P P PP PP PP PPP P PPR P P P P Sbjct: 183 PIPPIDPPRTQPPPIPPIDPPRTQPPPIPPID-PPRTQPPPIFPQPTTPAP 232 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/69 (27%), Positives = 20/69 (28%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAPAX 890 P P PP P P +PP P PP PPP P Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQ 206 Query: 891 PPXXAPAXP 917 PP P P Sbjct: 207 PPPIPPIDP 215 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 778 PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P P PP P PP PP PP P PP Sbjct: 143 PVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPP 190 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPR--PPPXXXPPPXP 827 PPP P PR +P PP PPR PPP P P Sbjct: 194 PPPIPPIDP----PRTQPPPIPPIDPPRTQPPPIFPQPTTP 230 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRP-----PPXXXPPPXP 827 P PPP PP PR +P PP PPR PP P P Sbjct: 177 PRTQPPPI---PPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQP 220 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 42.7 bits (96), Expect = 5e-04 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P P APP PP P P PPP P P P + PP PP PP Sbjct: 2164 PSPLGAPPSVPP---PMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXP-PAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P P P P P P P PPP P P AP + PP PP PP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPP 2206 Score = 32.3 bits (70), Expect = 0.67 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP PA P P P PP PP A PP PP PP P Sbjct: 2151 PPPMGPARHSPSGPSPLGA---PPSVPPPMGA--PPSGPPPMGAPPSGP 2194 Score = 31.1 bits (67), Expect = 1.6 Identities = 21/67 (31%), Positives = 23/67 (34%), Gaps = 7/67 (10%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPX--PPRXPP---APXAXXPPXXXPPXXXP 909 P P P PP PP P P P P AP + PP PP P Sbjct: 2126 PMGQYGAPARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPP 2185 Query: 910 P--XPPA 924 P PP+ Sbjct: 2186 PMGAPPS 2192 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 751 PAXAPPX-APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP 879 P+ PP APP PP P P P PP PP + P Sbjct: 2181 PSGPPPMGAPPSGPPPMGTP--PSGHPPMGAPPMGPPPSGSHSP 2222 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 42.7 bits (96), Expect = 5e-04 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPA--PXAXXPPXXXPPXXXPPXP 918 P P P P PP P PP P P P PP P PP PP PP P Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPT--PPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPA--PXAXXPPXXXPPXXXPP 912 A P P PP P P P P PP P PP PP PP Sbjct: 18 ATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPP 70 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPP 818 P PP P P P P P PPP PP Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPP 55 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP P P P P P PP P Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSP 45 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG G G + GAGG GG G AG GGA GGA G Sbjct: 785 GSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/60 (35%), Positives = 23/60 (38%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 +GG G G G + GAGG GG AGG GGA GGA G Sbjct: 762 SGGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSG 821 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXX-AGGXXGGAXGGAXAGX 747 AG G GG A G G G G GG G AGG GGA GGA + Sbjct: 772 AGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSS 831 Query: 746 G 744 G Sbjct: 832 G 832 Score = 31.1 bits (67), Expect = 1.6 Identities = 22/70 (31%), Positives = 25/70 (35%) Frame = -1 Query: 910 AGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGX 731 AG+ GG +G A + G GG GG GG GG G G GG Sbjct: 772 AGSSSGGASGGAGGSSGGANGGAGSSSGGASGGA--GGSSGGASGG--AGGSSGGASGGA 827 Query: 730 XXXGGGGXXG 701 GG G Sbjct: 828 GSSSGGASGG 837 Score = 28.7 bits (61), Expect = 8.3 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G A GG +G A G GG GG GG GG G G Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGA--SGGAGGSSGGASGGAGSSSGGA 834 Query: 736 GXXXXGG 716 GG Sbjct: 835 SGGADGG 841 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 41.9 bits (94), Expect = 8e-04 Identities = 25/63 (39%), Positives = 27/63 (42%), Gaps = 4/63 (6%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXG----GAXGGAXA 753 GG GG GG GG + GG GG G G GGG G G G G+ GG Sbjct: 155 GGMGGMMGGGSMGGGMMSMAGGGMGGGMGG-GMGGGMEGGMGGGMMEGMQGMGSMGGGMM 213 Query: 752 GXG 744 G G Sbjct: 214 GGG 216 Score = 40.3 bits (90), Expect = 0.003 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGX-GXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG GG GG G GG GG G GGG AGG GG GG G Sbjct: 133 GMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSM--AGGGMGGGMGGGMGG 188 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG G GG GG GG G GG G GG GG GG G Sbjct: 142 GGMGGGMSMGGMGGGMGGMMGGGSMGG-GMMSMAGGGMGGGMGGGMGGGMEGGMGGG 197 Score = 36.3 bits (80), Expect = 0.041 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAG--GXXGGAXGGAXAGX 747 GG GG GG G G G G G GGG G G G G GG G Sbjct: 176 GGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGM 235 Query: 746 G 744 G Sbjct: 236 G 236 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG + G GG GG G GGG G G GG A G G Sbjct: 130 GEGGMGGGMSMG-GGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMG 179 Score = 32.3 bits (70), Expect = 0.67 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GG GG GG G G GGG GGG G Sbjct: 143 GMGGGMSMGG-MGGGMGGMMGG---GSMGGGMMSMAGGGMGG 180 Score = 31.9 bits (69), Expect = 0.89 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAX-GAGGXRGGXGXXGXGGG-XXGXXXAGGXXGGAXGG 762 GG GG GG G G G GG G GGG GG GG GG Sbjct: 184 GGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGG 238 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/69 (28%), Positives = 21/69 (30%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G G GG + G GG GGG GG G G GG Sbjct: 129 GGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGG 188 Query: 736 GXXXXGGGG 710 G GGG Sbjct: 189 GMEGGMGGG 197 Score = 30.7 bits (66), Expect = 2.1 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG G G GGG GGG G Sbjct: 133 GMGGGMSMGGGMGG-------GMSMGGMGGGMGGMMGGGSMG 167 Score = 30.3 bits (65), Expect = 2.7 Identities = 23/74 (31%), Positives = 24/74 (32%), Gaps = 2/74 (2%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGG--RXXGRXRGXX 743 G G GG G G GGG GGG G GG + G Sbjct: 151 GGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGM--GGGMEGGMGGGMMEGMQGMGSM 208 Query: 742 GGGXXXXGGGGXXG 701 GGG G GG G Sbjct: 209 GGGMMGGGMGGGMG 222 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/58 (39%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGA--GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG GG GG G+ GG GG G G GGG G GG GG+ G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 37.1 bits (82), Expect = 0.024 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG G GG GG G GGG G GG GG GG G G Sbjct: 184 GGGSQGGGYRSGGGGY-GGSSRGGYGGGRGG----GGYGGGRGGGGGYGGG 229 Score = 37.1 bits (82), Expect = 0.024 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGG 716 GGG G RGG GGR G G GGG GG Sbjct: 195 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGG 786 GG GG GG GG G GG RGG G G G G GG Sbjct: 197 GGYGGSSRGG-YGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 34.7 bits (76), Expect = 0.13 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG + G G GG G G G G GG GG GG G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGG 228 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 820 GGGXXXGGG-RGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG R G GG G RG GGG G GG G Sbjct: 183 GGGGSQGGGYRSG--GGGYGGSSRGGYGGGRGGGGYGGGRG 221 Score = 33.5 bits (73), Expect = 0.29 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -1 Query: 820 GGGXXXGGGR--GGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG G GG GR G GGG GGGG G Sbjct: 189 GGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGR--GGGGGYGG 228 Score = 32.3 bits (70), Expect = 0.67 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G GGG GG GG GG G R GGG GGG Sbjct: 206 GYGGGRGGGGYGGGRGGGGGYGGGRRDYGGG--SKGGG 241 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = -1 Query: 826 GXGGGXXXG--GGRGGXXGGRXXGR-XRGXXGGGXXXXGGGGXXG 701 G GG G GGRGG GG GR G GGG GGG G Sbjct: 198 GYGGSSRGGYGGGRGG--GGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -1 Query: 820 GGGXXXGG---GRGGXXGGRXXGRXRGXXGGGXXX-XGGGGXXG 701 GGG GG G GG G G G GGG GGGG G Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYG 227 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGG 556 G GGG G G GG+ GG GG Sbjct: 186 GSQGGGYRSGGGGYGGSSRGGYGG 209 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 P PA APP PP P PPP P P PP AP PP Sbjct: 294 PPPADGSAPAPPPPPPPGGAP--PPPPPPPPPPPGDGGAPPPPPPP 337 Score = 40.3 bits (90), Expect = 0.003 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPP----XXXPPPXP 827 P PPPP P P P PP PP PPP PPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P P PPP P PP PP P PP PP PP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPP---PPPPP 337 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP--XAXXPPXXXPP 897 P PP A P PPP P PP PP P PP PP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 36.3 bits (80), Expect = 0.041 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 AP PP + P PPP P PP PP P PP PP P Sbjct: 289 APVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPP----PPGDGGAPPPPPPP 337 Score = 36.3 bits (80), Expect = 0.041 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPP 803 P PPPP PPP P P PP PPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 35.5 bits (78), Expect = 0.072 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P P P PP P PPPPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPP 323 Score = 35.5 bits (78), Expect = 0.072 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP APP P P PPPP P Sbjct: 304 PPPPPPPGGAPPPPPP----PPPPPP 325 Score = 35.1 bits (77), Expect = 0.095 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PPP P PP P PP PP PP PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPP---PPPPP 325 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = +2 Query: 551 PXPPXPPXX----APPXPXPAXXXPPPPXP 628 P PP PP APP P P PPPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPP 319 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PPPP PPP P P PP PPP PPP Sbjct: 306 PPPPPGGAPPPPPP---PPPPPPGDGGAPPP--PPPP 337 Score = 33.5 bits (73), Expect(2) = 0.004 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXP 628 PP PP PP P PPPP P Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 31.5 bits (68), Expect(2) = 0.039 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPP 622 P PP PP PP A PPPP Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA AP P P PP PPPP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPP 317 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +2 Query: 551 PXPPX---PPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P PPP P Sbjct: 307 PPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 273 GGRVXPPPPXPXPXTXAGXPPP 338 G PPPP P P G PPP Sbjct: 312 GAPPPPPPPPPPPPGDGGAPPP 333 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = +2 Query: 992 AXPXAPXPXPXPP----XPXPPPPP 1054 A P P P P PP P PPPPP Sbjct: 313 APPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 273 GGRVXPPPPXPXPXTXAGXPPP 338 GG PPPP P P G PP Sbjct: 311 GGAPPPPPPPPPPPPGDGGAPP 332 Score = 28.7 bits (61), Expect = 8.3 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 437 GXPPPPPPPP 466 G PPPPPPPP Sbjct: 312 GAPPPPPPPP 321 Score = 25.4 bits (53), Expect(2) = 0.004 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 437 GXPPPPPPPP 466 G PPPPPPP Sbjct: 311 GGAPPPPPPP 320 Score = 23.8 bits (49), Expect(2) = 0.039 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 443 PPPPPPP 463 PPPPPPP Sbjct: 304 PPPPPPP 310 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 41.1 bits (92), Expect = 0.001 Identities = 36/128 (28%), Positives = 36/128 (28%), Gaps = 4/128 (3%) Frame = +1 Query: 550 PPXAPXXXXXP-AXPXPRXPXPPAXXPXXXRRXXXXXXXXXXXXXXXXXXXXXXXXXXXX 726 PP AP P P PR P P A P Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVP--PPGAPHPRVPPPGAPHPRVPPPGAPHPR 480 Query: 727 XXXXXXPXPAXAPPXAP--PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-P 897 P P PP AP PP P PPP P P P AP PP P P Sbjct: 481 VPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVP-PPGAPHPRVPPPGAPHP 539 Query: 898 XXXPPXPP 921 PP P Sbjct: 540 RVPPPGAP 547 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +1 Query: 745 PXPAXAPPXA--PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-PXXXPPX 915 P P PP A P PP P PPP P P P AP PP P P PP Sbjct: 537 PHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVP-PPGAPHPRVPPPGTPHPRVPPPG 595 Query: 916 PP 921 P Sbjct: 596 AP 597 Score = 39.9 bits (89), Expect = 0.003 Identities = 40/137 (29%), Positives = 40/137 (29%), Gaps = 13/137 (9%) Frame = +1 Query: 550 PPXAPXXXXXP-AXPXPRXPXPPAXXPXXXRRXXXXXXXXXXXXXXXXXXXXXXXXXXXX 726 PP AP P P PR P P A P Sbjct: 453 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVP--PPGAPHPRVPPPGAPHQRVPPPGAPHPR 510 Query: 727 XXXXXXPXPAXAPPXA--PPXXPPAXXXPXXPP---PXPXXPXP----PRXPP--APXAX 873 P P PP A P PP P PP P P P P PR PP AP Sbjct: 511 VPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPR 570 Query: 874 XPPXXXP-PXXXPPXPP 921 PP P P PP P Sbjct: 571 VPPPGAPHPRVPPPGTP 587 Score = 39.1 bits (87), Expect = 0.006 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +1 Query: 745 PXPAXAPPXA--PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-PXXXPPX 915 P P PP A P PP P PPP P P P P PP P P PP Sbjct: 547 PHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVP-PPGTPHPRVPPPGAPHPKVPPPG 605 Query: 916 PP 921 P Sbjct: 606 AP 607 Score = 36.7 bits (81), Expect = 0.031 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +1 Query: 745 PXPAXAPPXA--PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-PXXXPPX 915 P P PP A PP P PPP P P P AP PP P P PP Sbjct: 407 PHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFP-PPGAPHPRVPPPGAPHPRVPPPG 465 Query: 916 PP 921 P Sbjct: 466 AP 467 Score = 33.5 bits (73), Expect = 0.29 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-PXXXPPXPP 921 P P + P PP P P PPP R P AP PP P P PP P Sbjct: 392 PSPGASHPRVPP---PGAPHPRVPPPGASHQRV-RPPGAPHPRVPPPGAPHPRFPPPGAP 447 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP P PPP P P PP P PR PP P P Sbjct: 429 PRVPPPGAPHPRFPPPGAP--HPRVPPPGAPHPRVPPPGAPHP 469 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP P PPP P P PP P PR PP P P Sbjct: 439 PRFPPPGAPHPRVPPPGAP--HPRVPPPGAPHPRVPPPGAPHP 479 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP P PPP P P PP P PR PP P P Sbjct: 449 PRVPPPGAPHPRVPPPGAP--HPRVPPPGAPHPRVPPPGAPHP 489 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP P PPP P P PP P PR PP P P Sbjct: 489 PRVPPPGAPHQRVPPPGAP--HPRVPPPGAPHPRVPPPGAPHP 529 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP P PPP P P PP P PR PP P P Sbjct: 509 PRVPPPGAPHPRVPPPGAP--HPRVPPPGAPHPRVPPPGAPHP 549 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPP-APXAXXPPXXXPPXXXP 909 P PP AP P P P P P P PP AP PP P P Sbjct: 559 PRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLP 612 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP P PPP P P PP P PR PP P P Sbjct: 559 PRVPPPGAPHPRVPPPGAP--HPRVPPPGTPHPRVPPPGAPHP 599 Score = 33.1 bits (72), Expect = 0.39 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = +1 Query: 751 PAXAPPXAP-PXXPPAXXXPXXPPPXPXXPXPPRXPP-APXAXXPPXXXP-PXXXPPXPP 921 P PP AP P PP P P P P PP AP PP P P PP P Sbjct: 399 PRVPPPGAPHPRVPPPGASHQRVRP-PGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAP 457 Score = 32.7 bits (71), Expect = 0.51 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP P PPP P R PP P PR PP P P Sbjct: 479 PRVPPPGAPHPRVPPPGAPHQR--VPPPGAPHPRVPPPGAPHP 519 Score = 32.3 bits (70), Expect = 0.67 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP P PPP R RPP P PR PP P P Sbjct: 399 PRVPPPGAPHPRVPPPGASHQR--VRPPGAPHPRVPPPGAPHP 439 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXP 815 P PPP P PPP P P PP P PR PP P Sbjct: 459 PRVPPPGAPHPRVPPPGAP--HPRVPPPGAPHPRVPPPGAP 497 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +3 Query: 711 PPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 PPP P PPP P P PP P PR PP P P Sbjct: 502 PPPGAPHPRVPPPGAP--HPRVPPPGAPHPRVPPPGAPHP 539 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PR-PPPXXXPPPXP 827 P PPP P PPP P P PP P PR PPP P P Sbjct: 519 PRVPPPGAPHPRVPPPGAP--HPRVPPPGAPHPRVPPPGASHPRVP 562 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXR----PXXRPPXXPPRPPPXXXPPP 821 P PPP P PPP P R P PP PP PPP Sbjct: 589 PRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPP 634 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +1 Query: 745 PXPAXAPPXAP-PXXP-PAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP A P P P P PPP P P + PP P PP Sbjct: 377 PYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGA 436 Query: 919 P 921 P Sbjct: 437 P 437 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 735 PPPXX---PRXRPXXRPPXXPPRPPPXXXPPP 821 PPP PR RP R P PPP PPP Sbjct: 300 PPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPP 331 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP P PPP P P PP P R PP P P Sbjct: 469 PRVPPPGAPHPRVPPPGAPH--PRVPPPGAPHQRVPPPGAPHP 509 Score = 30.3 bits (65), Expect = 2.7 Identities = 29/124 (23%), Positives = 29/124 (23%), Gaps = 1/124 (0%) Frame = +1 Query: 550 PPXAPXXXXXP-AXPXPRXPXPPAXXPXXXRRXXXXXXXXXXXXXXXXXXXXXXXXXXXX 726 PP AP P P PR P P A P Sbjct: 523 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVP--PPGASHPRVPPPGAPHPRVPPPGAPHPR 580 Query: 727 XXXXXXPXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXX 906 P P PP AP P P P P PP P P P Sbjct: 581 VPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAPIQR 640 Query: 907 PPXP 918 P P Sbjct: 641 VPLP 644 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PPP P PPP P R P PR PP P P Sbjct: 529 PRVPPPGAPHPRVPPPGAPHPR-VPPPGASHPRVPPPGAPHP 569 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP P PPP P PP P PR PP P P Sbjct: 539 PRVPPPGAPHPRVPPPG--ASHPRVPPPGAPHPRVPPPGAPHP 579 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P PPP PPP P P PP P PR PP P P Sbjct: 549 PRVPPPGASHPRVPPPGAP--HPRVPPPGAPHPRVPPPGTPHP 589 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 702 PXXPPP--PXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXP 815 P PPP P PPP P P PP P P+ PP P Sbjct: 569 PRVPPPGAPHPRVPPPGTP--HPRVPPPGAPHPKVPPPGAP 607 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +1 Query: 778 PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP P P PP P P PP P PP P Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAP 344 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 P P PPP P P PP P PR PP P P Sbjct: 424 PGAPHPRVPPPGAP--HPRFPPPGAPHPRVPPPGAPHP 459 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP---XXXPPXXXPPXP 918 P PP PP PP PPP P P PP P PP PP PP P Sbjct: 451 PPQLPPNLPP--PPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 35.5 bits (78), Expect = 0.072 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPPP PPP P PP PPP PP P Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P P P PP P PPP P PPR P P P PP P Sbjct: 469 PPPPMGMYPPPRGFPPPPFGP--PPPFYRGPPPPRGMPPPPRQRMPSQGPPQVHYP 522 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRX-PPAPXAXXPPXXX--PPXXXPPXP 918 P P P P PP P P R PP P PP PP PP P Sbjct: 439 PRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPP 492 Score = 33.1 bits (72), Expect = 0.39 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPP--RXPPAPXA-XXPPXXXPPXXXPP 912 P P PP P PP P P PP R PP P PP P PP Sbjct: 459 PPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 Score = 31.9 bits (69), Expect = 0.89 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 711 PPPPXXXXPP-PXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PPPP PP P P P PP+ PP PPP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQG---GGPPQLPPNLPPPP 462 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 702 PXXPPPPXXXX---PPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPPP PPP P PP PPP PP P Sbjct: 456 PNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPP 500 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P P PPP R P PP PPP PPP Sbjct: 452 PQLPPNLPPPPGGMRGMP---PPPMGMYPPPRGFPPP 485 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 790 PAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 PA PPP P PR P P PP PP Sbjct: 421 PAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPP 461 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 APP P PP PPP P P PP P P PP PPA Sbjct: 340 APPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPA 394 Score = 36.3 bits (80), Expect = 0.041 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P PP+ PP P PP P PP P P PP Sbjct: 280 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPP 332 Score = 35.1 bits (77), Expect = 0.095 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P + PP PP P+ PP P P PP PP P P PP Sbjct: 209 PERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPA-PPPGENRPPPPMRGPTSGGEPPPP 266 Score = 35.1 bits (77), Expect = 0.095 Identities = 22/65 (33%), Positives = 24/65 (36%), Gaps = 7/65 (10%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXX--PPPXPX-XPXPPR----XPPAPXAXXPPXXXPPXXXP 909 P APP PP P PP P P PP+ PP P PP P Sbjct: 239 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 298 Query: 910 PXPPA 924 P PP+ Sbjct: 299 PLPPS 303 Score = 34.7 bits (76), Expect = 0.13 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 6/65 (9%) Frame = +1 Query: 745 PXPAXAPPXAP-----PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-PXXX 906 P A PP P P PP PPP P P AP PP P P Sbjct: 313 PLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAP--PPPPGRAPQPLGG 370 Query: 907 PPXPP 921 PP PP Sbjct: 371 PPPPP 375 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 5/64 (7%) Frame = +1 Query: 745 PXPAXAPPXAP-----PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P PP P PP+ PPP PP P PP P Sbjct: 282 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP 341 Query: 910 PXPP 921 P PP Sbjct: 342 PPPP 345 Score = 33.5 bits (73), Expect = 0.29 Identities = 20/71 (28%), Positives = 20/71 (28%), Gaps = 5/71 (7%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPP-----XXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXX 875 PPPP PPP P PP P PPP PP Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 369 Query: 876 AAPAXPPXXAP 908 P PP P Sbjct: 370 GPPPPPPGRRP 380 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPP-----PXXXPPPXP 827 P PPP PP P +P PP PP P PPP P Sbjct: 329 PLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP 375 Score = 32.7 bits (71), Expect = 0.51 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 7/57 (12%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPX----PXXPXPPRXPPAPXAXXPPXXXPP---XXXPPXPP 921 AP PP P PPP P P P R AP PP PP PP PP Sbjct: 307 APAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPP--PPISKPPTSTRSAPPPPP 361 Score = 32.3 bits (70), Expect = 0.67 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAPAX 890 PPP PPP P P R PP P P P P Sbjct: 207 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPP-- 264 Query: 891 PPXXAPAXP 917 PP AP P Sbjct: 265 PPKNAPPPP 273 Score = 32.3 bits (70), Expect = 0.67 Identities = 31/129 (24%), Positives = 32/129 (24%), Gaps = 13/129 (10%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPP----XXXPPP-----XPXXXXXXXXX 854 P PPP PPP PP PPP PPP P Sbjct: 239 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 298 Query: 855 XXXXXXXAAPAXPPXXAPAXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPP----XPXP 1022 APA PP P PP P Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPP 358 Query: 1023 PPPXXAPRP 1049 PPP AP+P Sbjct: 359 PPPGRAPQP 367 Score = 31.9 bits (69), Expect = 0.89 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +1 Query: 745 PXPAXAPP----XAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P PP APP P P PP P P R PP+ PP P P Sbjct: 343 PPPISKPPTSTRSAPPPPPGRAPQPLGGPP---PPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 8/67 (11%) Frame = +1 Query: 745 PXPAXAPPX---APPXXPPAXXXPXXPPPXPXXPXPPRXP-----PAPXAXXPPXXXPPX 900 P P P APP + P PP P P R P P P PP Sbjct: 218 PPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGS 277 Query: 901 XXPPXPP 921 PP PP Sbjct: 278 SNPPPPP 284 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRX-RPXXRPPXXPP--RPPPXXXPPPXP 827 PP PPP R +P PP PP RPP PP P Sbjct: 349 PPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPP 390 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/59 (27%), Positives = 19/59 (32%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P + + P P P PPP PP + P PP P PP Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Score = 31.1 bits (67), Expect = 1.6 Identities = 22/65 (33%), Positives = 24/65 (36%), Gaps = 5/65 (7%) Frame = +1 Query: 745 PXPAXAPPX-----APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P APP + P PP P P PP AP A PP P P Sbjct: 264 PPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAP-APPPPLNATP---P 319 Query: 910 PXPPA 924 P PP+ Sbjct: 320 PPPPS 324 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 702 PXXPP---PPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPP 818 P PP P PPP P RP PP PPP P Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPP 622 P PP PP PP P+ PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 754 AXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 A A P P PP PP P P PP P P P PP Sbjct: 114 AGAGPRGPALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPP 169 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 10/69 (14%) Frame = +2 Query: 446 PPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPX----------PPXXAPPXPX 595 PPPPPP RP PP PP APP P Sbjct: 215 PPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPK 274 Query: 596 PAXXXPPPP 622 PPPP Sbjct: 275 RGSSNPPPP 283 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 6/65 (9%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXP-----PRXPPAPXA-XXPPXXXPPXXX 906 P PP PP PPP P P + PP P + P PP Sbjct: 257 PTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNA 316 Query: 907 PPXPP 921 P PP Sbjct: 317 TPPPP 321 Score = 30.7 bits (66), Expect = 2.1 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 5/69 (7%) Frame = +2 Query: 437 GXPPPP---PPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXX--APPXPXPA 601 G PPPP PPPP PP PP AP P P Sbjct: 261 GEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQG------PPLPPSRDQAPAPPPPL 314 Query: 602 XXXPPPPXP 628 PPPP P Sbjct: 315 NATPPPPPP 323 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 711 PPPPXXXXPPPXX--PRXRPXXRPPXX---PPRPPPXXXPPP 821 PPPP P P P P RPP PP PPP P Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 PPP PPP + +P P PPP PPP Sbjct: 140 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPP 176 Score = 29.9 bits (64), Expect = 3.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGG 786 GG + G GG G G GGG G AGG Sbjct: 65 GGNLSSSSSSTGGGGGFSGGGGGSMGGGGLGGLFAGG 101 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR-XPPAPXAXXPPXXXPPXXXPP 912 P + P APP P P P PP+ PP P PP PP Sbjct: 233 PTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P PP P PP P PP PP PP P PP Sbjct: 280 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPP--PPLNATPPPPPPSRDQVPLPPPP 334 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPP PPP P R +P PPP P Sbjct: 133 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPP 170 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXX---PPRPPPXXXPPP 821 PPPP PPP R + P PP PP PPP Sbjct: 140 PPPPFGAPPPPD--RGGQLAKKPSQGSFPPPPPMGKPPPP 177 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPP 822 P PP PP P A P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXP 628 PP PP PP P A P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P P PP PPPPP Sbjct: 456 PASSSRGAPPPVPPSRGPPPPP 477 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 APP P PP PPP P P PP P P PP PPA Sbjct: 252 APPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPA 306 Score = 36.3 bits (80), Expect = 0.041 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P PP+ PP P PP P PP P P PP Sbjct: 192 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPP 244 Score = 35.1 bits (77), Expect = 0.095 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P + PP PP P+ PP P P PP PP P P PP Sbjct: 121 PERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPA-PPPGENRPPPPMRGPTSGGEPPPP 178 Score = 35.1 bits (77), Expect = 0.095 Identities = 22/65 (33%), Positives = 24/65 (36%), Gaps = 7/65 (10%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXX--PPPXPX-XPXPPR----XPPAPXAXXPPXXXPPXXXP 909 P APP PP P PP P P PP+ PP P PP P Sbjct: 151 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 210 Query: 910 PXPPA 924 P PP+ Sbjct: 211 PLPPS 215 Score = 34.7 bits (76), Expect = 0.13 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 6/65 (9%) Frame = +1 Query: 745 PXPAXAPPXAP-----PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-PXXX 906 P A PP P P PP PPP P P AP PP P P Sbjct: 225 PLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAP--PPPPGRAPQPLGG 282 Query: 907 PPXPP 921 PP PP Sbjct: 283 PPPPP 287 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 5/64 (7%) Frame = +1 Query: 745 PXPAXAPPXAP-----PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P PP P PP+ PPP PP P PP P Sbjct: 194 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP 253 Query: 910 PXPP 921 P PP Sbjct: 254 PPPP 257 Score = 33.5 bits (73), Expect = 0.29 Identities = 20/71 (28%), Positives = 20/71 (28%), Gaps = 5/71 (7%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPP-----XXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXX 875 PPPP PPP P PP P PPP PP Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 281 Query: 876 AAPAXPPXXAP 908 P PP P Sbjct: 282 GPPPPPPGRRP 292 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPP-----PXXXPPPXP 827 P PPP PP P +P PP PP P PPP P Sbjct: 241 PLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP 287 Score = 32.7 bits (71), Expect = 0.51 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 7/57 (12%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPX----PXXPXPPRXPPAPXAXXPPXXXPP---XXXPPXPP 921 AP PP P PPP P P P R AP PP PP PP PP Sbjct: 219 APAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPP--PPISKPPTSTRSAPPPPP 273 Score = 32.3 bits (70), Expect = 0.67 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAPAX 890 PPP PPP P P R PP P P P P Sbjct: 119 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPP-- 176 Query: 891 PPXXAPAXP 917 PP AP P Sbjct: 177 PPKNAPPPP 185 Score = 32.3 bits (70), Expect = 0.67 Identities = 31/129 (24%), Positives = 32/129 (24%), Gaps = 13/129 (10%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPP----XXXPPP-----XPXXXXXXXXX 854 P PPP PPP PP PPP PPP P Sbjct: 151 PLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGP 210 Query: 855 XXXXXXXAAPAXPPXXAPAXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPP----XPXP 1022 APA PP P PP P Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPP 270 Query: 1023 PPPXXAPRP 1049 PPP AP+P Sbjct: 271 PPPGRAPQP 279 Score = 31.9 bits (69), Expect = 0.89 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = +1 Query: 745 PXPAXAPP----XAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P PP APP P P PP P P R PP+ PP P P Sbjct: 255 PPPISKPPTSTRSAPPPPPGRAPQPLGGPP---PPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 8/67 (11%) Frame = +1 Query: 745 PXPAXAPPX---APPXXPPAXXXPXXPPPXPXXPXPPRXP-----PAPXAXXPPXXXPPX 900 P P P APP + P PP P P R P P P PP Sbjct: 130 PPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGS 189 Query: 901 XXPPXPP 921 PP PP Sbjct: 190 SNPPPPP 196 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRX-RPXXRPPXXPP--RPPPXXXPPPXP 827 PP PPP R +P PP PP RPP PP P Sbjct: 261 PPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPP 302 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/59 (27%), Positives = 19/59 (32%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P + + P P P PPP PP + P PP P PP Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Score = 31.1 bits (67), Expect = 1.6 Identities = 22/65 (33%), Positives = 24/65 (36%), Gaps = 5/65 (7%) Frame = +1 Query: 745 PXPAXAPPX-----APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P APP + P PP P P PP AP A PP P P Sbjct: 176 PPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAP-APPPPLNATP---P 231 Query: 910 PXPPA 924 P PP+ Sbjct: 232 PPPPS 236 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 702 PXXPP---PPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPP 818 P PP P PPP P RP PP PPP P Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 754 AXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 A A P P PP PP P P PP P P P PP Sbjct: 26 AGAGPRGPALKPPGFRTTAPPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPP 81 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 10/69 (14%) Frame = +2 Query: 446 PPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPX----------PPXXAPPXPX 595 PPPPPP RP PP PP APP P Sbjct: 127 PPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPK 186 Query: 596 PAXXXPPPP 622 PPPP Sbjct: 187 RGSSNPPPP 195 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 6/65 (9%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXP-----PRXPPAPXA-XXPPXXXPPXXX 906 P PP PP PPP P P + PP P + P PP Sbjct: 169 PTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNA 228 Query: 907 PPXPP 921 P PP Sbjct: 229 TPPPP 233 Score = 30.7 bits (66), Expect = 2.1 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 5/69 (7%) Frame = +2 Query: 437 GXPPPP---PPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXX--APPXPXPA 601 G PPPP PPPP PP PP AP P P Sbjct: 173 GEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQG------PPLPPSRDQAPAPPPPL 226 Query: 602 XXXPPPPXP 628 PPPP P Sbjct: 227 NATPPPPPP 235 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 711 PPPPXXXXPPPXX--PRXRPXXRPPXX---PPRPPPXXXPPP 821 PPPP P P P P RPP PP PPP P Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPP 821 PPP PPP + +P P PPP PPP Sbjct: 52 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPP 88 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/57 (29%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR-XPPAPXAXXPPXXXPPXXXPP 912 P + P APP P P P PP+ PP P PP PP Sbjct: 145 PTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P PP P PP P PP PP PP P PP Sbjct: 192 PPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPP--PPLNATPPPPPPSRDQVPLPPPP 246 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPP PPP P R +P PPP P Sbjct: 45 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPP 82 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXX---PPRPPPXXXPPP 821 PPPP PPP R + P PP PP PPP Sbjct: 52 PPPPFGAPPPPD--RGGQLAKKPSQGSFPPPPPMGKPPPP 89 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P P PP PPPPP Sbjct: 368 PASSSRGAPPPVPPSRGPPPPP 389 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPP 622 PPPP PPP A RP PP PP A P P PA PPPP Sbjct: 918 PPPPLPPPPPPIQTTRPTVPTTPTTQ-----ASTTRPTPP-PPTSALPPPIPATQVPPPP 971 Query: 623 XP 628 P Sbjct: 972 LP 973 Score = 39.1 bits (87), Expect = 0.006 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPAXX 730 P P P APP P P PPPP P PPPP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSA 957 Query: 731 XPP 739 PP Sbjct: 958 LPP 960 Score = 36.7 bits (81), Expect = 0.031 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 10/66 (15%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPP----------PXPXXPXPPRXPPAPXAXXPPXXXPPX 900 P PP PP P P P P P P PP P PP PP Sbjct: 916 PEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPL 975 Query: 901 XXPPXP 918 PP P Sbjct: 976 PPPPPP 981 Score = 36.3 bits (80), Expect = 0.041 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PPPP PPP P PP PP PPP PPP Sbjct: 951 PPPPTSALPPPIPATQVP---PPPLPPLPPP---PPP 981 Score = 35.5 bits (78), Expect = 0.072 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P P PP P PPP P P PP P P P PP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLP-PPPPPIQTTRPTVPTTPTTQASTTRPTPPP 953 Score = 35.1 bits (77), Expect = 0.095 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP 864 P APP P P P P P P PP PP P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +2 Query: 446 PPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPPPP 622 PPPPPP PP P PP P P PPPP Sbjct: 923 PPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 PA PP PP P PP P P P + P PP P P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPP 961 Score = 32.3 bits (70), Expect = 0.67 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +1 Query: 787 PPAXXXPXXPP--PXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P P P P P P PP PP P A PP PP PP P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPP--PPLPLAPEPP---PPLPPPPPP 928 Score = 32.3 bits (70), Expect = 0.67 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 4/64 (6%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP----XAXXPPXXXPPXXXPP 912 P P P P P P PPP P P P P P P PP Sbjct: 901 PKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPP 960 Query: 913 XPPA 924 PA Sbjct: 961 PIPA 964 Score = 32.3 bits (70), Expect = 0.67 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 548 RPXPPXPPXXAPPXPXPAXXXPPPPXP 628 +P P PP P P P PPPP P Sbjct: 902 KPTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 32.3 bits (70), Expect = 0.67 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 778 PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P PP PPP P PP PP P PP P PPA Sbjct: 949 PTPPPPTSA--LPPPIPATQVPP--PPLPPLPPPPPPVQTTTAPTLPPA 993 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +2 Query: 989 PAXPXAPXPXPX---PPXPXPPPPP 1054 P P P P P PP P PPPPP Sbjct: 903 PTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P P P P P P PP PP PPP P Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRP 934 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P P PPP P P PP PP PP P P Sbjct: 901 PKPTTPAPPPPLP-LAPEPPPPLPPPPPPIQTTRPTVP 937 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 APP P P P P P P P PP PP P P Sbjct: 893 APPTTPTTPK-PTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 P P P P PP P PPPP Sbjct: 908 PPPPLPLAPEPPPPLPPPPPP 928 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPPXP 827 P PPPP P P P P PP PPP P Sbjct: 921 PLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIP 963 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXP-XXPXPPRXPPA 861 P A PP PP P PPP P P PPA Sbjct: 954 PTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPPA 993 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PP P P P P P P PPP PPP Sbjct: 894 PPTTPTTPKPTTPAPPPPL--PLAPEPPPPLPPPPP 927 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +1 Query: 751 PAXAPPXA--PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 P PP + PP P P PP P P P + AP PP P Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAP--TLPPASCMP 997 Score = 27.9 bits (59), Expect(2) = 0.79 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP PP P P Sbjct: 1114 PPPPPPPTEIPPAQETFEGSPPCPSP 1139 Score = 22.6 bits (46), Expect(2) = 0.79 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 443 PPPPPPPP 466 P PPPPPP Sbjct: 1112 PLPPPPPP 1119 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/60 (35%), Positives = 23/60 (38%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P PP P P P PP P P PPR PP+P P P PP+ Sbjct: 266 PSPLRYPPIPPRYPPSLIRYPTLPPRYP--PSPPRYPPSPPRYPPSLHRYPQSPLRYPPS 323 Score = 36.7 bits (81), Expect = 0.031 Identities = 23/67 (34%), Positives = 25/67 (37%), Gaps = 8/67 (11%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXP---PPXPXX--PXPPRXPPAP---XAXXPPXXXPPX 900 P P PP P P P P PP P P P R PP+P + P P Sbjct: 294 PSPPRYPPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPP 353 Query: 901 XXPPXPP 921 PP PP Sbjct: 354 RYPPSPP 360 Score = 34.3 bits (75), Expect = 0.17 Identities = 21/53 (39%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPP-RXPPAPXAXXPPXXXPPXXXPPXPP 921 P +PP PP+ P PP P P R PP+P PP P PP PP Sbjct: 293 PPSPPRYPPSP--PRYPPSLHRYPQSPLRYPPSP-IRYPPL---PSRYPPSPP 339 Score = 32.3 bits (70), Expect = 0.67 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPP-RXPPAPXAXXPPXXXPPXXXPPXPPA 924 P +PP PP+ P P P P P R P+P P P P PP+ Sbjct: 349 PPSPPRYPPSP--PRYPSSHPRYPPSPLRYLPSPIRYPPSHSRYPSSHPRYPPS 400 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXP-PRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P +P PP PP P P PR PP+P P P P PP+ Sbjct: 321 PPSPIRYPPLPSR--YPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPS 372 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXX-RPPXXPPR-PPPXXXPPPXP 827 P PP P PP PR P R P PPR PP PP P Sbjct: 262 PRYPPSPLRY--PPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSP 303 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 711 PPPPXXXXP-PPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PP P P PP P P R P PPR PP PP P Sbjct: 328 PPLPSRYPPSPPRYPSSHP--RYPPSPPRYPP--SPPRYP 363 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 814 PPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P P P R PP P P P P PP+ Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPS 295 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P PP P PP P PP P P P P P P P PP PA Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFP-GPQGPNGPKGPPGLPGPPGPPGFQGPPGNPA 85 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPP P P P P + P P PP PP P Sbjct: 34 PYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP PP P PP P P P P PP P P P Sbjct: 111 PPGPPG-PPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPGNPGGP 160 Score = 32.3 bits (70), Expect = 0.67 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP P PP P PP P P P P PP P P P Sbjct: 275 PPGDMGPPGLP--GPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP 330 Score = 32.3 bits (70), Expect = 0.67 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP P PP P PP P P P P PP P P P Sbjct: 360 PLGDVGPPGLP--GPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP 415 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 3/65 (4%) Frame = +2 Query: 443 PPPPP---PPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXP 613 PPPPP PPP P PP PP P PA Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIG 89 Query: 614 PPPXP 628 PP P Sbjct: 90 PPGLP 94 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP P PP P PP P P P P PP P P P Sbjct: 445 PLGDVGPPGLP--GPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP 500 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP P PP P PP P P P P PP P P P Sbjct: 530 PLGDVGPPGLP--GPPGPQMPPGPPGLPGAPGPNGPPGINGPLGPPGEAGPPGNPGGP 585 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +1 Query: 787 PPAXXXPXXPP--PXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP PP P P P P PP P P P P PP Sbjct: 697 PPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +1 Query: 787 PPAXXXPXXPP--PXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP PP P P P P PP P P P P PP Sbjct: 782 PPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 2/59 (3%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPP--PXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P P PP PP P P P P PP P P P PP Sbjct: 175 PNGLPGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPP 233 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +3 Query: 711 PPPPXXXXPP----PXXPRXRPXXRPPXXP--PRPPPXXXPPPXP 827 PPPP PP P P P P P P+ PP PP P Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGP 74 Score = 29.9 bits (64), Expect = 3.6 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 10/64 (15%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP-XAXXPPXXXPP---------XXXPP 912 PP P PP P PP P P P+ PP P PP P PP Sbjct: 876 PPGLP--GPPGPASP-PSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTGGAGCQPAPP 932 Query: 913 XPPA 924 PPA Sbjct: 933 CPPA 936 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 PP P PP P PP P P P+ PP P P Sbjct: 791 PPGLP--GPPGPASP-PSPPGPPGPPGPKGPPGPNGPLGP 827 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 4/55 (7%) Frame = +1 Query: 745 PXPAXAPPXAPPXX----PPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 P A PP P PP PP P P P P P PP P Sbjct: 84 PAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGP 138 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP P P P PP P P P P PP P P P Sbjct: 190 PPGDMGPPGLP--GPQGPQMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNPGGP 245 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 PA P P PP+ P PP P P P P P P Sbjct: 621 PAGLPGPPGPASPPSPPGPPG-PPGPKGPPGPNGPLGPPGESGP 663 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P +P P PP P PP P Sbjct: 630 PASPPSPPGPPGPPGPKGPPGP 651 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P +P P PP P PP P Sbjct: 715 PASPPSPPGPPGPPGPNGPPGP 736 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P +P P PP P PP P Sbjct: 800 PASPPSPPGPPGPPGPKGPPGP 821 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P +P P PP P PP P Sbjct: 885 PASPPSPPGPPGPPGPKGPPGP 906 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +3 Query: 750 PRXRPXXRPPXXPPRPPPXXXPPPXP 827 PR RP PP PP PPP PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 37.1 bits (82), Expect = 0.024 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPPP Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPP 885 Score = 35.9 bits (79), Expect = 0.055 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 753 RXRPXXRPPXXPPRPPPXXXPPPXP 827 R RP R P PP PPP PPP P Sbjct: 859 RPRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 34.7 bits (76), Expect = 0.13 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 548 RPXPPXPPXXAPPXPXPAXXXPPPP 622 RP P PP PP P P PPPP Sbjct: 861 RPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 33.5 bits (73), Expect = 0.29 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPP 883 Score = 31.9 bits (69), Expect = 0.89 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 835 PXP-PRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P PR PP P PP PP PP PPA Sbjct: 860 PRPRPRRPPPP----PPPPPPPPPPPPPPPA 886 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 787 PPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 P P PPP P P PP PPA P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +1 Query: 778 PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P P PPP P P PP P + P P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVPSVGP 903 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 738 PPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PR P PP PP PPP PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPP--PPPP 885 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 560 PXPPXXAPPXPXPAXXXPPPPXP 628 P P PP P P PPPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPP 882 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 548 RPXPPXPPXXAPPXPXPAXXXPPPPXP 628 RP P P PP P P PPPP P Sbjct: 859 RPRPR--PRRPPPPPPPPPPPPPPPPP 883 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 1007 PXPXPXPPXPXPPPPP 1054 P P P P P PPPPP Sbjct: 860 PRPRPRRPPPPPPPPP 875 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP 864 P P P PP PP P PPP P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/59 (35%), Positives = 23/59 (38%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P APP APP P+ P P P PP PP+ A P PP PP Sbjct: 509 PTTVTAPPAAPP---PSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPP 564 Score = 36.3 bits (80), Expect = 0.041 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P P PP APP P+ P P P PP PP+ A P PP Sbjct: 531 PTPVTEPPPAPP---PSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTPATAPPP 583 Score = 32.7 bits (71), Expect = 0.51 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +1 Query: 745 PXPAXAPPXAPPXX---PPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P P APP APP P + P P P P P A PP P P Sbjct: 451 PTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVP 509 Score = 31.9 bits (69), Expect = 0.89 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +1 Query: 745 PXPAXAPPX---APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPX 915 P P APP A P P P P P P P A PP P P Sbjct: 375 PTPVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPT 434 Query: 916 PPA 924 P A Sbjct: 435 PVA 437 Score = 31.9 bits (69), Expect = 0.89 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +1 Query: 745 PXPAXAPPX---APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPX 915 P P APP A P P P P P P P A PP P P Sbjct: 433 PTPVAAPPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPT 492 Query: 916 PPA 924 P A Sbjct: 493 PVA 495 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 6/64 (9%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPP------RXPPAPXAXXPPXXXPPXXX 906 P P APP APP P+ P P P PP P P A PP Sbjct: 393 PTPVAAPPPAPP---PSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSG 449 Query: 907 PPXP 918 P P Sbjct: 450 VPTP 453 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/58 (25%), Positives = 16/58 (27%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP P P + P P P PP P P P P P Sbjct: 326 PSSTVTPPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPP 383 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P PA APP PP+ P P PP + P PP PP Sbjct: 351 PTPATAPPPV-VAPPPSVFASSSGVPTPVKAPPPSVFASSSGVPTPVAAPPPAPPP 405 Score = 29.1 bits (62), Expect = 6.3 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 5/63 (7%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXX---PPPXPXXPXP--PRXPPAPXAXXPPXXXPPXXXP 909 P P APP P P+ P PPP P P AP A PP P Sbjct: 473 PTPVAAPP--PSVFAPSSGVPTPVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGV 530 Query: 910 PXP 918 P P Sbjct: 531 PTP 533 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +1 Query: 751 PAXAPPX--APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 PA PP AP P P P P P P P PP P P Sbjct: 516 PAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAP 570 Score = 28.7 bits (61), Expect = 8.3 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 5/65 (7%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPP-----RXPPAPXAXXPPXXXPPXXXP 909 P APP + PPA P PP P P P P PP Sbjct: 333 PVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPPSVFASSSGV 392 Query: 910 PXPPA 924 P P A Sbjct: 393 PTPVA 397 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/55 (29%), Positives = 18/55 (32%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P APP P P+ P P P P P+ P PP P Sbjct: 491 PTPVAAPP--PSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPP 543 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 G GG GG G G GGG G GG GG GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 39.1 bits (87), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 G GG GG G G GGG G GG GG GG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 38.7 bits (86), Expect = 0.008 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG GG GG G G GGG GGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGDG 168 Score = 38.3 bits (85), Expect = 0.010 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXG 804 GG GG GG GG G GG GG G G GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGG--GGGGGGGGGGGGDG 168 Score = 38.3 bits (85), Expect = 0.010 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 854 GXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG G G GGG G GG GG GG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 37.9 bits (84), Expect = 0.014 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GGG GG GG G G GGG GGGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG----GGGG 166 Score = 37.9 bits (84), Expect = 0.014 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 857 GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG G G GGG G GG GG GG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 36.7 bits (81), Expect = 0.031 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 G GG GG G G GGG G GG GG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 36.3 bits (80), Expect = 0.041 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 G GG GG G G GGG G GG GG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 35.9 bits (79), Expect = 0.055 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXG 777 GG G GG GG G G GGG G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 35.9 bits (79), Expect = 0.055 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 878 GXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGG 774 G G GG GG G G GGG G GG GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 35.9 bits (79), Expect = 0.055 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXG 777 GG G GG GG G G GGG G GG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 35.5 bits (78), Expect = 0.072 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGG 774 GG G GG GG G G GGG G GG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 35.1 bits (77), Expect = 0.095 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGG 786 GG GG G GG GG G G GGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGG 157 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 32.7 bits (71), Expect = 0.51 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGG 716 G GGG GGG GG GG G G G G G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGG 816 GG GG GG GG G GG GG G G Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGA 759 AGG GG G AGG G G G G G GG GG+ GGA Sbjct: 416 AGGSSAGASGGGHKGAGGGSAAGGGTGS-GSTGNGNAGNGGAGGGGAGGGSTGGA 469 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/58 (37%), Positives = 23/58 (39%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 A GG G G A G GG G G G G AGG GGA GG+ G Sbjct: 413 ASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGG--GGAGGGSTGG 468 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = -3 Query: 908 GXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G G G A AGG G G G G GG G+ G AG G Sbjct: 400 GTSPSGGSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNG 454 Score = 33.9 bits (74), Expect = 0.22 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAG-GXXG-GAXGGAXAGXG 744 G G GG A +GG G G GG G G G G G GG AG G Sbjct: 405 GGSSSGTGASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGG 786 G GG GG G G G GG G G GGG G + G Sbjct: 430 GAGGGSAAGGGTGSGSTGNGNAG-NGGAGGGGAGGGSTGGASSSG 473 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG G G G GG G G GGGG G Sbjct: 422 GASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGG 463 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GGG G G G GGG GG Sbjct: 430 GAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGG 468 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGA 771 GG G G GG + G G G G GGG G G G+ Sbjct: 426 GGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAG-GGGAGGGSTGGASSSGS 474 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 39.1 bits (87), Expect = 0.006 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGR--XRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GGR GR G GGG GGG G Sbjct: 314 GRGGGYRSGGG-GGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 38.3 bits (85), Expect = 0.010 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = -3 Query: 908 GXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG G GG GG G GGG G GG GG GG G G Sbjct: 89 GERGGGGSQGGGYRSGGGGY-GGSSRGGYGGGRGG----GGYGGGRGGGGSYGGG 138 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/48 (41%), Positives = 21/48 (43%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGG 774 G GG GG GG G+ RGG G GGG G GG GG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSS--RGGYGGGRGGGGYGGGRGGGGSYGG 137 Score = 37.1 bits (82), Expect = 0.024 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGG 716 GGG G RGG GGR G G GGG GG Sbjct: 104 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 36.7 bits (81), Expect = 0.031 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGA 771 GG GG GG G GG RGG G G GG GGA Sbjct: 99 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGGA 145 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 820 GGGXXXGGG-RGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG R G GG G RG GGG G GG G Sbjct: 92 GGGGSQGGGYRSG--GGGYGGSSRGGYGGGRGGGGYGGGRG 130 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXG 819 GG GG GG GG G GG RGG G G G Sbjct: 106 GGYGGSSRGGYG-GGRGGGGYGGGRGGGGSYGGG 138 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -1 Query: 820 GGGXXXGGGRGG-XXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GG GGG GG GG GR G GGG GGGG G Sbjct: 99 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGG---RGGGGSYG 136 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 857 GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG RGG G GGG G G GG GG Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGG 343 Score = 32.3 bits (70), Expect = 0.67 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGG 774 GG GG GG G GG GG G G GG GG G Sbjct: 312 GGGRGGGYRSGGGGGYG-GGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG GG + G GG GG G GG G GG+ G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGG 813 GG GG G G GG RGG G GGG Sbjct: 317 GGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGG 352 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 802 GGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGGRGG G G GGG GG G G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGG 345 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGG 816 GG GG G GG G GG RG G G GG Sbjct: 313 GGRGGGYRSG--GGGGYGGGRGGGRGYGGGRGGGG 345 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGG 556 G GGG G G GG+ GG GG Sbjct: 95 GSQGGGYRSGGGGYGGSSRGGYGG 118 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G GGG GG GG GG G R GG Sbjct: 115 GYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPP-APXAXXPPXXXP-PXXXPPXP 918 P P PP P P P P P P P PP P PP P P PP Sbjct: 58 PIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNT 117 Query: 919 P 921 P Sbjct: 118 P 118 Score = 37.5 bits (83), Expect = 0.018 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +1 Query: 745 PXPAXAPPXAP-PXXPPA-XXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-PXXXPPX 915 P P PP P P PP P PPP P P P P PP P P PP Sbjct: 48 PIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDP-PPNTPIPGNPPPNTPIPGDPPPN 106 Query: 916 PP 921 P Sbjct: 107 TP 108 Score = 35.5 bits (78), Expect = 0.072 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPP-APXAXXPPXXXP-PXXXPPXPP 921 P PP P P P P P P P PP P PP P P PP P Sbjct: 40 PGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTP 98 Score = 33.5 bits (73), Expect = 0.29 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +1 Query: 745 PXPAXAPPXAP-PXXPPA-XXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P PP P P PP P PPP P P P P PP P P Sbjct: 68 PIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDP-PPNTPIPGDPPPNTPIQGDP 123 Score = 33.1 bits (72), Expect = 0.39 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 8/67 (11%) Frame = +1 Query: 745 PXPAXAPPXAPP-------XXPPAXXXPXXPPP-XPXXPXPPRXPPAPXAXXPPXXXPPX 900 P P P APP PP P PPP P PP P P PP P Sbjct: 23 PPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIP-GDPPPNTPIPG 81 Query: 901 XXPPXPP 921 PP P Sbjct: 82 DPPPNTP 88 Score = 32.3 bits (70), Expect = 0.67 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +1 Query: 751 PAXAPPX-APPXXPPA-XXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-PXXXPPXPP 921 P PP A P PP P PPP P R P P PP P P PP P Sbjct: 10 PGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPG-DRPPNTPIPGDPPPNIPIPGNPPPNTP 68 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP 894 P P PP P P P P P P P PP P P Sbjct: 78 PIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDPLTIP 127 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 787 PPAXXXPXXPPPXPXXP-XPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P PPP P PP P A PP P PP P Sbjct: 4 PPNTAIPGDPPPNTAIPGDPPPNTTIPRA-PPPNTAIPGDRPPNTP 48 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 38.7 bits (86), Expect = 0.008 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXA-GGXXGGAXGGA 759 GG GG G GG GG G G GGG G GG G GG+ Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGS 121 Score = 33.9 bits (74), Expect = 0.22 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -1 Query: 820 GGGXXXGGGR---GGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG GG GG G G GGG GGG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G G GG G G GGG G GG GG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G GGG GGG GG GG G GGG GG Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 31.9 bits (69), Expect = 0.89 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGG---XXGGAXGGAXAG 750 GG G GG GG G G GG G GG GG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 31.9 bits (69), Expect(2) = 0.038 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 621 GGGGXXXAGXGXGGAXXGGXGGXG 550 GGGG G G GG GG GG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 31.9 bits (69), Expect = 0.89 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXG 804 GG GG GG G GG GG GGG G Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXG 559 G GGGG G G GG GG G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGG 105 Score = 28.7 bits (61), Expect = 8.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G GG GG G Sbjct: 87 GGGGGGGVGGGGGGGGGG---GDDCEDGGGDDGEDGGSDNDG 125 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 618 GGGXXXAGXGXGGAXXGGXGGXG 550 GGG G G GG GG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGG 96 Score = 23.4 bits (48), Expect(2) = 1.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 465 GGGGGGGG 442 GGGGGGGG Sbjct: 95 GGGGGGGG 102 Score = 23.4 bits (48), Expect(2) = 0.038 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 465 GGGGGGGG 442 GGGGGGGG Sbjct: 97 GGGGGGGG 104 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 38.7 bits (86), Expect = 0.008 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXX---GXGGGXXGXXXAGGXXGGAXGGAXAGX 747 G G GG GG G GG G G G GG G GG GG+ GG Sbjct: 149 GDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGND 208 Query: 746 G 744 G Sbjct: 209 G 209 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXA-GGXXGGAXGGAXAGXG 744 G G G G G G GG G GGG G G GG GG G G Sbjct: 137 GDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGG 195 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGG 786 + G GG GG GG G+GG G G GGG G GG Sbjct: 172 SNGSGGGDDGGD--GGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 32.7 bits (71), Expect = 0.51 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXX--AXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 G GG GG G + G+GG G GGG G GG GG G Sbjct: 153 GDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGG 206 Score = 31.9 bits (69), Expect = 0.89 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GG GGG G GG G G G GGGG G Sbjct: 170 GGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDG 209 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GG GG G G GG GGG G Sbjct: 153 GDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGG 194 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 38.7 bits (86), Expect = 0.008 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXG--XGGGXXGXXXAGGXXGGAXGG 762 AGG GG GG G G GG RGG G G GG G GG G GG Sbjct: 186 AGGRGG--RGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGG 239 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -1 Query: 814 GXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGRGG GGR R RG GG GG G Sbjct: 185 GAGGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYG 219 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 869 AXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 A G GG G G G G G GG GG GG+ G G Sbjct: 186 AGGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYG 227 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GAGG RGG G G GGG GG GG G G G Sbjct: 185 GAGG-RGGRG--GRGGGRGAPRGRGGPRGGGGGSGGYGGG 221 Score = 32.3 bits (70), Expect = 0.67 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -1 Query: 817 GGXXXGGGRGGXXGG-RXXGRXRGXXGGGXXXXGGGGXXG 701 GG GGRGG G R G RG GGG GGG G Sbjct: 187 GGRGGRGGRGGGRGAPRGRGGPRG-GGGGSGGYGGGSYGG 225 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GRGG GG G G GGG GG G G Sbjct: 194 GRGGGRGAPRGRGGPRGG---GGGSGGYGGG--SYGGYGNYG 230 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 38.7 bits (86), Expect = 0.008 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 6/60 (10%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPP------APXAXXPPXXXPPXXXPPXPPA 924 P P PPA P PPP P P PP PP P PP PPA Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPA 147 Score = 36.3 bits (80), Expect = 0.041 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 7/79 (8%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXP-----RXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXX 866 P PPPP PPP P P PPP PPP P Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQTQVVHS 161 Query: 867 XXXAA--PAXPPXXAPAXP 917 A P PP PA P Sbjct: 162 VQLHASPPGPPPAPMPAPP 180 Score = 35.1 bits (77), Expect = 0.095 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P AP P P PP P PPPPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPP 117 Score = 35.1 bits (77), Expect = 0.095 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P P P PP P PPPPP Sbjct: 97 PACCAPPPPPPPPPPPPPPPPP 118 Score = 35.1 bits (77), Expect = 0.095 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P A P PP P PPPPP Sbjct: 93 PACPPACCAPPPPPPPPPPPPP 114 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXP 592 PPPPPPPP P PP PP AP P Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMP 151 Score = 33.5 bits (73), Expect = 0.29 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAPAXPP 896 PP PPP PP PP PPP PPP P AP PP Sbjct: 96 PPACCAPPP----------PPPPPPPPPP---PPPPPPITLHHEQHVVSHVMHPAPPPPP 142 Query: 897 XXAPA 911 PA Sbjct: 143 PPPPA 147 Score = 33.5 bits (73), Expect(2) = 0.017 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 992 AXPXAPXPXPXPPXPXPPPP 1051 A P P P P PP P PPPP Sbjct: 101 APPPPPPPPPPPPPPPPPPP 120 Score = 32.7 bits (71), Expect = 0.51 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPAXXXP 736 P PP P P P PPPP P PPPPA P Sbjct: 93 PACPPACCAPPPPPPPP-PPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMP 151 Query: 737 P 739 P Sbjct: 152 P 152 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +1 Query: 751 PAXAPPXAPPXXP--PAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP 894 PA PP PP P P PP PPAP PP P Sbjct: 136 PAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAPMPAPPPMVVP 185 Score = 29.5 bits (63), Expect = 4.7 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 12/72 (16%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXX------------APP 586 PPPPPPPP P P PP +PP Sbjct: 110 PPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPP 169 Query: 587 XPXPAXXXPPPP 622 P PA PPP Sbjct: 170 GPPPAPMPAPPP 181 Score = 23.8 bits (49), Expect(2) = 5.6 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +1 Query: 547 APPXAPXXXXXPAXPXPRXPXPPAXXP 627 AP P P P P P PP P Sbjct: 92 APACPPACCAPPPPPPPPPPPPPPPPP 118 Score = 23.8 bits (49), Expect(2) = 5.6 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 12/51 (23%) Frame = +1 Query: 745 PXPAXAPPXAP-PXXPPAXXX-----------PXXPPPXPXXPXPPRXPPA 861 P P PP P P PP P PPP P PP P+ Sbjct: 136 PAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAPMPAPPPMVVPS 186 Score = 23.0 bits (47), Expect(2) = 0.017 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 1028 PXPXPPPPP 1054 P P PPPPP Sbjct: 136 PAPPPPPPP 144 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 38.7 bits (86), Expect = 0.008 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 P P P P + P PPP P PP PP P + PP PP Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPP--PPEPTSELPPPPPPP 329 Score = 35.9 bits (79), Expect = 0.055 Identities = 22/64 (34%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXP--AXXXPP 616 PPPPPPPP + +P PP P APP P P PP Sbjct: 280 PPPPPPPPSNTPGMFA---------------SSGFQPPPPPPTDFAPPPPPPEPTSELPP 324 Query: 617 PPXP 628 PP P Sbjct: 325 PPPP 328 Score = 35.5 bits (78), Expect = 0.072 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP PP P P PP PP A PP P PP PP Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPP--PPTDFAPPPPPPEPTSELPPPPP 327 Score = 31.9 bits (69), Expect = 0.89 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPP 791 PPPP PPP P PP PP Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 9/51 (17%) Frame = +3 Query: 702 PXXPPPPXXXX---------PPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPPP PPP P PP PP P PPP P Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPP---TDFAPPPPPPEPTSELPPPPPP 328 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P P P PPPPP Sbjct: 311 PPPPPPEPTSELPPPPPPP 329 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 APP PP PA P PP P P R P P P PP PP Sbjct: 776 APPPPPPPTKPAT--PRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 33.5 bits (73), Expect = 0.29 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 745 PXPAXAPPXAPPXXP--PAXXXPXXPPPXPXXPXPPRXPPAP 864 P A P PP P P P PPP P P P P P Sbjct: 782 PPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLP 823 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PPPP P P P RPP P PPP PPP Sbjct: 779 PPPPPTKPATPRVPPNIP-SRPPGARPTPPP---PPP 811 Score = 31.9 bits (69), Expect = 0.89 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPPP PPP P P PP P RPP PP P Sbjct: 777 PPPP----PPPTKPAT-PRV-PPNIPSRPPGARPTPPPP 809 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 793 AXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 A P PPP P P PR PP + P P PP P Sbjct: 773 ALGAPP-PPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP 814 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 437 GXPPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPP 616 G PPPPPPP RP PP PP P P P Sbjct: 775 GAPPPPPPPTKPATPRVPPNIPSRPPGA---------RPTPPPPPPGKPTKPTKPSLPPV 825 Query: 617 PP 622 PP Sbjct: 826 PP 827 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 702 PXXPPPPXXXXP--PPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PPP P PP P P RP PP PPP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARP--TPPPPPPGKPTKP 817 >SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 38.3 bits (85), Expect = 0.010 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GG G RGG GG G+ RG GG GGGG G Sbjct: 431 GGRGGFRGNRGGFRGGNERGQRRGGRGGHGPPRGGGGFSG 470 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = -3 Query: 920 GGXGGXXXG-GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAG 789 GG GG G GG G RGG G GGG G G Sbjct: 431 GGRGGFRGNRGGFRGGNERGQRRGGRGGHGPPRGGGGFSGPRGGG 475 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 38.3 bits (85), Expect = 0.010 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Frame = +1 Query: 745 PXPAXAPPXA----PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P P PP A PP PP PP P P PP P P PP PP Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPP-PPLPPAMPAMDDLLPPEVLSPP---PP 338 Query: 913 XPPA 924 PP+ Sbjct: 339 PPPS 342 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +1 Query: 754 AXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP-PXXXPPXXXPPXPP 921 A PP PP P P P P PP PP P A PP P PP Sbjct: 282 APVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPP 338 Score = 32.7 bits (71), Expect = 0.51 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PP P P P P P P PP PPP P Sbjct: 298 PPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPP 339 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPP PPP P P P PP PP PP P Sbjct: 286 PMTPPPAVVTAPPPAPP--LPNFTSPSPPPPPP---LPPAMP 322 Score = 28.7 bits (61), Expect = 8.3 Identities = 19/70 (27%), Positives = 20/70 (28%), Gaps = 8/70 (11%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXA--------PPXPXP 598 PPP PPP + P PP P A PP P Sbjct: 247 PPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLPNF 306 Query: 599 AXXXPPPPXP 628 PPPP P Sbjct: 307 TSPSPPPPPP 316 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 37.5 bits (83), Expect = 0.018 Identities = 21/62 (33%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXX--PPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P + PP PP PP P P P P PP P PP P PP P Sbjct: 243 PPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQP---PPPP 299 Query: 919 PA 924 P+ Sbjct: 300 PS 301 Score = 35.1 bits (77), Expect = 0.095 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPP--XPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P P + P PPP P PP P PP PP PP Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPP 290 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 APP P PP P PP P + PP PP PP Sbjct: 214 APPIQTSTSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPP 260 Score = 31.9 bits (69), Expect = 0.89 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 5/62 (8%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXP-----XPPRXPPAPXAXXPPXXXPPXXXPPX 915 P APP PP P PP P PP PP PP P Sbjct: 237 PMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPP 296 Query: 916 PP 921 PP Sbjct: 297 PP 298 Score = 31.1 bits (67), Expect = 1.6 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 9/62 (14%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPA--PXAXXPP-------XXXPPXXXPPX 915 PP PP PPP P P PP P PP PP PP Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPM 283 Query: 916 PP 921 PP Sbjct: 284 PP 285 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 7/49 (14%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXP---RXRPXXRPPXXPP----RPPPXXXPPPXP 827 P PPP PPP P P PP P PPP PP P Sbjct: 237 PMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPP 858 P P PP P PP P PPP PP Sbjct: 275 PPPGMPPPMPPGGMPPNMEQPPPPPPSSGVSNSGMMPP 312 Score = 29.5 bits (63), Expect = 4.7 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = +3 Query: 702 PXXPPP---PXXXXPPPXXPRXR---PXXRPPXXPP--RPPPXXXPPPXP 827 P PPP P PP P P PP PP PP PPP P Sbjct: 250 PGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PP PP P P PP P PPP PPP Sbjct: 225 PMIPPVGMLGHPPMGAP-PPPHSMPP--PGMPPPGMMPPP 261 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 37.5 bits (83), Expect = 0.018 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G GGGG G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 35.1 bits (77), Expect = 0.095 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG G GG GG G G GG GG G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 34.7 bits (76), Expect = 0.13 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG G G GG GGG G Sbjct: 46 GGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGA 771 GG GG GG GG G G G GGG G G G A Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDGDA 93 Score = 33.1 bits (72), Expect = 0.39 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXA 753 GG GG GG GG G G G GGG G GG G G A Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGG----GGGDGDGDGDGDA 93 Score = 31.9 bits (69), Expect = 0.89 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 A GG GG G GG GG G G G G G A GG GG G G Sbjct: 37 ANADGG--------GGGGGGGGGGGGGGGGGDGDGDG-DGDANANADGGGGGGGGGDGDG 87 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -1 Query: 820 GGGXXX-GGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG GG GG G G GGGG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGG 81 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GG G G G GGG G G G Sbjct: 50 GGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 37.5 bits (83), Expect = 0.018 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGX--GXXGXGGGXXGXXXAGGXXGGAXGGAXAGX 747 GG GG G G GG GG G G G G G GG G GG G Sbjct: 52 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Query: 746 G 744 G Sbjct: 112 G 112 Score = 36.7 bits (81), Expect = 0.031 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = -1 Query: 910 AGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGX 731 +G GG G G GGG GGG G GG G GGG Sbjct: 47 SGGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGG 106 Query: 730 XXXGGG 713 GGG Sbjct: 107 GDGGGG 112 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXG-AGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGX 747 +GG GG G G G GG G GGG G GG G GG G Sbjct: 47 SGGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGG 106 Query: 746 G 744 G Sbjct: 107 G 107 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXG 719 G GG GGG G GG G G GGG G Sbjct: 82 GGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXG 819 GG G GG GG G GG GG G G Sbjct: 84 GGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 37.5 bits (83), Expect = 0.018 Identities = 20/53 (37%), Positives = 21/53 (39%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP PP P PPP P P P P P + P PP P PP Sbjct: 452 PSDEPPPLPPDEEKPP-PPPAPALPPLPLPPELPGS---PGDSPPATSPKQPP 500 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +1 Query: 745 PXPAXAPPXAPP-----XXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P+ PP PP PPA P P P P PPA PP P Sbjct: 450 PLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGP 509 Query: 910 P 912 P Sbjct: 510 P 510 Score = 31.9 bits (69), Expect = 0.89 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRP---PPXXXP--PPXP 827 P PP PPP P P PP P P PP P PP P Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLP 502 Score = 31.1 bits (67), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXP 628 PP PP P P PA PP P P Sbjct: 457 PPLPPDEEKPPPPPAPALPPLPLP 480 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 7/44 (15%) Frame = +3 Query: 711 PPPPXXXXPP-------PXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PPPP PP P P P P PP PP PP Sbjct: 467 PPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPP 510 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXP 628 PP P PP P PPPP P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAP 472 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 37.5 bits (83), Expect = 0.018 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGX--GXXGXGGGXXGXXXAGGXXGGAXGGAXAGX 747 GG GG G G GG GG G G G G G GG G GG G Sbjct: 67 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Query: 746 G 744 G Sbjct: 127 G 127 Score = 36.7 bits (81), Expect = 0.031 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = -1 Query: 910 AGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGX 731 +G GG G G GGG GGG G GG G GGG Sbjct: 62 SGGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGG 121 Query: 730 XXXGGG 713 GGG Sbjct: 122 GDGGGG 127 Score = 35.9 bits (79), Expect = 0.055 Identities = 21/61 (34%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXG-AGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGX 747 +GG GG G G G GG G GGG G GG G GG G Sbjct: 62 SGGDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGG 121 Query: 746 G 744 G Sbjct: 122 G 122 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXG 719 G GG GGG G GG G G GGG G Sbjct: 97 GGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXG 819 GG G GG GG G GG GG G G Sbjct: 99 GGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 37.5 bits (83), Expect = 0.018 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 G G G GG G GG GG G G GG G GG GG GG Sbjct: 433 GCSSGVGDGRGGDGGGDG-GGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 36.7 bits (81), Expect = 0.031 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGG-XGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG G + G G RGG G G GGG G G GG GG G Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGG 475 Score = 35.1 bits (77), Expect = 0.095 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG G G G GGG GGG G Sbjct: 444 GDGGGDGGGGGDGGGDG--IDGGDGGGDGGGDGGGDGGGDGG 483 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 878 GXXAXGAGGXRGGXGXXGXGGGXXGXXXAG--GXXGGAXGGAXAG 750 G G GG GG G G G G G G G GG GG G Sbjct: 439 GDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGG 483 Score = 32.3 bits (70), Expect = 0.67 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGG 734 G GGG GG GG GG G G GGG Sbjct: 454 GDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG GGG G G G G GG GGG G Sbjct: 443 GGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 37.5 bits (83), Expect = 0.018 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG G GG GG G GG GG G GGG G GG GG Sbjct: 92 GGGGRRERGGRGGGG--GYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 36.7 bits (81), Expect = 0.031 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG G GGR G G G GGGG G Sbjct: 101 GRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 35.1 bits (77), Expect = 0.095 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGRGG G G G GGG GGGG G Sbjct: 93 GGGRRERGGRGGGGG---YGGGGGYGGGGRSYGGGGGGGG 129 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG G GG GG G G G G GG + GG G Sbjct: 93 GGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGA--XXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 101 GRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 37.5 bits (83), Expect = 0.018 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 6/62 (9%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXP--PPXPXXPXP----PRXPPAPXAXXPPXXXPPXXX 906 P P APP P PP P P P P P P P PPAP P PP Sbjct: 759 PKPP-APPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPPVAR 817 Query: 907 PP 912 P Sbjct: 818 KP 819 Score = 36.7 bits (81), Expect = 0.031 Identities = 23/65 (35%), Positives = 25/65 (38%), Gaps = 5/65 (7%) Frame = +1 Query: 745 PXPAXAPPXAPPXXP-PAXXXPXXPPPXPXXPXPPRX---PPAPX-AXXPPXXXPPXXXP 909 P P+ +PP P P P P P P PP PP P A PP P P Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP 797 Query: 910 PXPPA 924 PPA Sbjct: 798 HLPPA 802 Score = 33.9 bits (74), Expect = 0.22 Identities = 23/70 (32%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = +3 Query: 702 PXXPPPPXXXXP-PPXXPRXRPXXRPPXXPPRPPPXXXP-PPXPXXXXXXXXXXXXXXXX 875 P PP P P PP P+ P PP P P P P PP P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVP-PPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNIS 806 Query: 876 AAPAXPPXXA 905 A P PP A Sbjct: 807 AEPPPPPPVA 816 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPX-XPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P APP P PP P P PP P A P PP PP Sbjct: 754 PPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPP 813 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP P P PPP P P P P A P P PP P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAP--HLPPAP 803 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPP 622 P PP PP P P P P PP Sbjct: 749 PAPPLPPKVTPKPPAPPQFAPVPP 772 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPAXX 730 P PP PP A P P P PP P PPPP Sbjct: 759 PKPPAPPQFA-PVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPPVAR 817 Query: 731 XP 736 P Sbjct: 818 KP 819 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 37.1 bits (82), Expect = 0.024 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPPP Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPP 622 P P PP PP P P PPPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPP 82 Score = 32.3 bits (70), Expect = 0.67 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 59 PTVPIPPTLPPPPPPPPPP 77 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 762 PXXRPPXXPPRPPPXXXPPP 821 P PP PP PPP PPP Sbjct: 64 PPTLPPPPPPPPPPLPPPPP 83 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P PP PP P PP PP PP PP+ Sbjct: 59 PTVPIPPTLPPPP----PP---PPPPLPPPPPS 84 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PP PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPP 80 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 790 PAXXXPXXPPPXPXXPXPPRXPPAP 864 P P PP P P PP PP P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 787 PPAXXXPXXPPPXPXXPXPP 846 PP P PPP P P PP Sbjct: 64 PPTLPPPPPPPPPPLPPPPP 83 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 37.1 bits (82), Expect = 0.024 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PA PP P PP P P P P P+ PP P P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLP-GPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGP 1715 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPP-PXXXPPP 821 P PPPP P P P P + P P PP P P P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P P PP P P P PP P P P PP PP Sbjct: 1793 PKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 4/62 (6%) Frame = +1 Query: 745 PXPAXAPPXAPPXX----PPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P PA PP P P PP P P P P P A P PP Sbjct: 1666 PPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDGPMGPP 1725 Query: 913 XP 918 P Sbjct: 1726 GP 1727 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P P PA P P P P P P P P P P P P Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 28.7 bits (61), Expect(2) = 0.29 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP PP PP P P P P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGP 1687 Score = 23.4 bits (48), Expect(2) = 0.29 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 443 PPPPPPPP 466 P PPPPPP Sbjct: 1660 PAPPPPPP 1667 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 37.1 bits (82), Expect = 0.024 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 PP PP P PPP P PP PP P P PP Sbjct: 663 PPPPPPGGQAGGAPPPPPPPLPGGAAPP--PPPPIGGGAPPPPPP 705 Score = 36.3 bits (80), Expect = 0.041 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +2 Query: 437 GXPPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPP 616 G PPPPPPPP P PP P APP P P P Sbjct: 659 GPPPPPPPPPGGQAGGAPPP------------------PPPPLPGGAAPPPPPPIGGGAP 700 Query: 617 PPXP 628 PP P Sbjct: 701 PPPP 704 Score = 35.1 bits (77), Expect = 0.095 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPP PPP P + PP PP P PPP P Sbjct: 656 PEAGPPP----PPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 A P PP PP PPP P PP P PP P P PP Sbjct: 658 AGPPPPPPPPPGGQAGGAPPPPP--------PPLPGGAAPPPPPPIGGGAPPPP 703 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 702 PXXPPPP----XXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PPPP PPP P PP PP P PPP P Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPP--PPPPIGGGAPPPPP 704 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 267 GXGGRVXPPPPXPXPXTXAGXPPP 338 G G PPPP P P A PPP Sbjct: 670 GQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 271 PEXGSXPXPRXPPRXRXXARPPPXXXPXRG 360 PE G P P PP + PPP P G Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPG 685 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 37.1 bits (82), Expect = 0.024 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P P PP P PPPPP Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 32.7 bits (71), Expect = 0.51 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPP 622 P P PP PP P P PPPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPP 306 Score = 32.3 bits (70), Expect = 0.67 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 283 PTVPIPPTLPPPPPPPPPP 301 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 762 PXXRPPXXPPRPPPXXXPPP 821 P PP PP PPP PPP Sbjct: 288 PPTLPPPPPPPPPPLPPPPP 307 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 826 PXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P PP PP P PP PP PP PP+ Sbjct: 283 PTVPIPPTLPPPP----PP---PPPPLPPPPPS 308 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PP PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPP 304 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 790 PAXXXPXXPPPXPXXPXPPRXPPAP 864 P P PP P P PP PP P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 787 PPAXXXPXXPPPXPXXPXPP 846 PP P PPP P P PP Sbjct: 288 PPTLPPPPPPPPPPLPPPPP 307 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 37.1 bits (82), Expect = 0.024 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P+ A P P P P P P P PP P A PP PP P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 36.3 bits (80), Expect = 0.041 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP P APP P A PPPP P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 34.7 bits (76), Expect = 0.13 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 817 PPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P P PPA A PP P PP PP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PP P P P P PP P PPP PPP Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPP--PPPP 249 Score = 33.5 bits (73), Expect = 0.29 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPP-PXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P A P A P PP P P PP P AP PP PP PP P Sbjct: 200 PSAAAPKQQKAT--PVNPPEPDYLEPTPP-PPAAPAPPPPPAAAPPPPPPPPP 249 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPA 861 P P P PP PA P P P P PP PA Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKPA 254 Score = 33.1 bits (72), Expect = 0.39 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +2 Query: 989 PAXPXAPXPXPXP---PXPXPPPPP 1054 P P AP P P P P P PPPPP Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPA 861 P PP AP PP P PPP P P + P A Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPP----PPPVKKPAA 255 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPP 818 PPPP PPP P PP PP PPP P Sbjct: 225 PPPPAAPAPPPP-----PAAAPP--PPPPPPPVKKP 253 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPP 619 P PP PP APP P P PPP Sbjct: 231 PAPPPPPAAAPPPPPP----PPP 249 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 738 PPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PP P PP P PPP PP P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPP 244 Score = 29.5 bits (63), Expect = 4.7 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPP--RXPPAPXAXXPPXXXP 894 P A P PP P P PPP P PP PP P PP P Sbjct: 205 PKQQKATPVNPPE--PDYLEPTPPPPAAPAPPPPPAAAPP-PPPPPPPVKKP 253 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPP 622 PP P P P PA PPPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPP 236 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXP 815 P PP P P P P PP PP PPP P Sbjct: 223 PTPPPPAAPAPPPP---PAAAPPPPPP-PPPVKKP 253 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 37.1 bits (82), Expect = 0.024 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXR--GXXGGGXXXXGGGG 710 GGG GG RGG GG GR R G GGG G GG Sbjct: 142 GGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGG 180 Score = 35.5 bits (78), Expect = 0.072 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -1 Query: 826 GXGG--GXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG G GG RGG GGR G G G G GGG G Sbjct: 142 GGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSG 185 Score = 34.3 bits (75), Expect = 0.17 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG RGG GG G GG GG GG G G Sbjct: 142 GGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGG 181 Score = 34.3 bits (75), Expect = 0.17 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG-GAXAGXG 744 G GG G GG G GG G G G G GG GG G G G G Sbjct: 153 GYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYG 212 Score = 33.5 bits (73), Expect = 0.29 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG GG GG G G G G GG G GG G+ G G Sbjct: 166 GGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGY--GGGQGYGSYSGGGGG 220 Score = 29.5 bits (63), Expect = 4.7 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG GG RGG GGG G G GG G G Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDR---GGGYGGGGEGGYGMGGGDYSGGCGYG 190 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 817 GGXXXGGG-RGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG RGG GG G G GG GG G G Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYG 177 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 37.1 bits (82), Expect = 0.024 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 6/64 (9%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPX--PXXPXPPRXPPAPXAXXPP----XXXPPXXX 906 P P P PP PA P PPP P PP P P A PP PP Sbjct: 362 PPPPIIP--IPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSV 419 Query: 907 PPXP 918 PP P Sbjct: 420 PPPP 423 Score = 36.3 bits (80), Expect = 0.041 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +3 Query: 711 PPPPXXXXPPPXXP-RXRPXXRPPXXPP--RPPPXXXPPP 821 PPPP PPP P P PP P PPP PPP Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPP 401 Score = 34.7 bits (76), Expect = 0.13 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP---XAXXPPXXXPPXXXPPX 915 P PA P P PP P PP P P P P P PP PP P Sbjct: 370 PPPAM-PAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIGVPN 428 Query: 916 PPA 924 P+ Sbjct: 429 RPS 431 Score = 31.9 bits (69), Expect = 0.89 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPP---PXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PPP P PPP P + PP PP PPP Sbjct: 380 PHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPP 422 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPP--APXAXXPPXXXPPXXXPPXPP 921 PP PP P PP P P PP P PP PP PP Sbjct: 354 PPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPP 408 Score = 25.0 bits (52), Expect(2) = 6.3 Identities = 19/75 (25%), Positives = 19/75 (25%), Gaps = 3/75 (4%) Frame = +3 Query: 702 PXXPPPPXX--XXPPPXXPRXRPXXRPPXXPPR-PPPXXXPPPXPXXXXXXXXXXXXXXX 872 P PPP PPP P P P PPP P P Sbjct: 349 PVIVPPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPP 408 Query: 873 XAAPAXPPXXAPAXP 917 PP P P Sbjct: 409 TMIQTLPPPSVPPPP 423 Score = 22.2 bits (45), Expect(2) = 6.3 Identities = 9/16 (56%), Positives = 9/16 (56%), Gaps = 1/16 (6%) Frame = +3 Query: 1005 PPXPXPPPPXXAP-RP 1049 PP PPPP P RP Sbjct: 415 PPPSVPPPPIGVPNRP 430 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 33.1 bits (72), Expect = 0.39 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 1007 PXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 54 PPPPPPPPPPPPPPPP 69 Score = 33.1 bits (72), Expect = 0.39 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 1007 PXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 55 PPPPPPPPPPPPPPPP 70 Score = 33.1 bits (72), Expect = 0.39 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 1007 PXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 56 PPPPPPPPPPPPPPPP 71 Score = 32.3 bits (70), Expect = 0.67 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPP 1051 P P P P PP P PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 31.9 bits (69), Expect = 0.89 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 774 PPXXPPRPPPXXXPPPXP 827 PP PP PPP PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 814 PPPXPXXPXPPRXPPAPXAXXP 879 PPP P P PP PP P + P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXP 879 P PPP P P PP PP+ P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect(2) = 0.028 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPP 622 P PP PP PP P P P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 26.6 bits (56), Expect(2) = 0.028 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 54 PPPPPPPP 61 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 36.7 bits (81), Expect = 0.031 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRP--PPXXXPPPXP 827 PPP PPP P P PP P P PP PP P Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAP 164 Score = 35.5 bits (78), Expect = 0.072 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 PP PP P PPP P P PP P P PP PP P Sbjct: 122 PP--PPPTGTLPPPPVTPPPGPETPPPPDTPAPPV---PPTEAPPTAPP 165 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P P P P PP P PPP P P PP P PP PP A Sbjct: 124 PPPTGTLPPPPVTPPPG---PETPPP-PDTPAPPVPPTEAPPTAPPTGGSCVSKPPYKSA 179 Score = 31.1 bits (67), Expect = 1.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXP 815 PPPP P P P PP P PP P Sbjct: 131 PPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPP 803 P PPP PPP P P P PP PP Sbjct: 134 PVTPPPGPETPPPPDTPA--PPVPPTEAPPTAPP 165 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +3 Query: 702 PXXPPPPXXXXPPP---XXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PPP PPP P P PP PP PP Sbjct: 133 PPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 36.3 bits (80), Expect = 0.041 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P + P P P P PP PP P PP PP PP PP Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPP--TPPPTEPPTPP 1051 Score = 36.3 bits (80), Expect = 0.041 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P PP P P PP PP PPP P P P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPP 1052 Score = 35.9 bits (79), Expect = 0.055 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PP PP P P PP PP PPP PP P Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTD-PPTQP 1059 Score = 35.1 bits (77), Expect = 0.095 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPP 803 P PP PPP P P PP PP PP Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 35.1 bits (77), Expect = 0.095 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP P P PP PP P PP PP PP P Sbjct: 1024 PTEPPTDPPTP-PPTEPPTPPPTEPP--TPPPTDPPTQP 1059 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 P P PP PP PP PPP PP PP P PP Sbjct: 1018 PLPTD-PPTEPPTDPPT------PPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 32.3 bits (70), Expect = 0.67 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P P PP P P PP PP PP P P Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 31.9 bits (69), Expect = 0.89 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP P P P PP PP PP P PP Sbjct: 1020 PTDPPTEP--PTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPP 622 PP PP PP P P PPP Sbjct: 1031 PPTPPPTEPPTPPPTEPPTPPP 1052 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXP 788 P PPP PPP P P PP P Sbjct: 1031 PPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPP 800 P PP PP P P PP PP P Sbjct: 1027 PPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 36.3 bits (80), Expect = 0.041 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG G GG GG A G GG G GGG G +GG G A G Sbjct: 274 GGAGEGSTGGP--GGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATG 324 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 AGG GG G G G GG G G +GG G G G Sbjct: 289 AGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCTNQYGGSGGIASSTIGACAGGGG 348 Score = 29.5 bits (63), Expect = 4.7 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGRXXXAXXXXXXXXXXXXXXXXXXXXXXXGGGGGG 448 G GG AG G GG G G A GGGGGG Sbjct: 345 GGGGSSNCQAGNGGNSCQRGGQSG-GAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGG 403 Query: 447 GG 442 GG Sbjct: 404 GG 405 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXG 804 GG GG G + G GG GG G GG G Sbjct: 378 GGGGGLQFGNQDYTSRLSYGGGGGGGGGSAFGIEGGRGG 416 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 36.3 bits (80), Expect = 0.041 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 814 PPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 PPP P P PPAP PP PP P PPA Sbjct: 179 PPPAPPGVLAP--PPAPPGVLPPPPAPPGALIPPPPA 213 Score = 34.7 bits (76), Expect = 0.13 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXP 855 P PA APP PP P PP P PP P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPXPXXPXPPRXPPA-PXAXXPPXXXPP 897 APP PP P PP P PP PPA P A PP PP Sbjct: 178 APPPAPPGVLAP---PPAPPGVLPP--PPAPPGALIPPPPAPP 215 Score = 33.1 bits (72), Expect = 0.39 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXP 628 PP PP P P P PPPP P Sbjct: 180 PPAPPGVLAPPPAPPGVLPPPPAP 203 Score = 32.3 bits (70), Expect = 0.67 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 557 PPXPPXXAPPXP-XPAXXXPPPPXP 628 PP PP PP P P PPPP P Sbjct: 190 PPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PP PPP P P PP PP PPP Sbjct: 181 PAPPGVLAPPPAPPGVLP------PPPAPPGALIPPP 211 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 PA P P P PP PPPP Sbjct: 181 PAPPGVLAPPPAPPGVLPPPP 201 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 33.9 bits (74), Expect = 0.22 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG GG GG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 31.9 bits (69), Expect = 0.89 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGG 556 G GGGG G G GG GG GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 31.9 bits (69), Expect(2) = 0.042 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 621 GGGGXXXAGXGXGGAXXGGXGGXG 550 GGGG G G GG GG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAG 789 GG G GG GG G G GGG G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 845 GGXGXXGXGGGXXGXXXAGGXXGGAXG 765 GG G G GGG G GG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 857 GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG GG G G GGG G GG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGG 734 G GGG GGG GG GG G G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGG 813 GG G GG GG G G GGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GGG GG GG G G GG Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGG 94 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 802 GGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GG GG G GGG GGGG G Sbjct: 53 GGGGGGGGGG-------GGGGGGGGGGGGGGGDG 79 Score = 23.4 bits (48), Expect(2) = 0.042 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 465 GGGGGGGG 442 GGGGGGGG Sbjct: 70 GGGGGGGG 77 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 35.9 bits (79), Expect = 0.055 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P P P P P+ P PP PP PPP PPP Sbjct: 335 PSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPP--TPPP 372 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P + + P PA P P P P+ P P PP PP PP Sbjct: 312 PESSNKSSEPDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPP 368 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +1 Query: 772 APPXXPPAXXXPXXP-PPXPXXPXP-PRXPPAPXAXXPPXXXPP 897 APP P+ P P PP P P P+ P P PP PP Sbjct: 329 APPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P P P P P P P PP PP PP PP Sbjct: 321 PDSTPATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPP--PPPPPPPPTPP 371 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P P PP P P PPPP P Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPPP 365 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 735 PPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P P P P P PP PPP P P P Sbjct: 343 PQPPTPTT-PKTHPQLGPPPPPPPPPPTPPP 372 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +2 Query: 989 PAXPXAPXPXPX--PPXPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 345 PPTPTTPKTHPQLGPPPPPPPPPP 368 Score = 28.7 bits (61), Expect(2) = 0.17 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 437 GXPPPPPPPP 466 G PPPPPPPP Sbjct: 358 GPPPPPPPPP 367 Score = 24.2 bits (50), Expect(2) = 0.17 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 557 PPXPPXXAPPXPXP 598 PP PP PP P P Sbjct: 359 PPPPPPPPPPTPPP 372 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 35.9 bits (79), Expect = 0.055 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 817 PPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 PP P P PP PP P P PP P PPA Sbjct: 95 PPPPATPPPPTMPPTP--PPPQTPAPPGPDTPAPPA 128 Score = 34.3 bits (75), Expect = 0.17 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPP PPP P P PP P P P PP P Sbjct: 95 PPPPATPPPPTMP---PTPPPPQTPAPPGPDTPAPPAP 129 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPP 846 P PA PP P PP P PP P P PP Sbjct: 96 PPPATPPPPTMPPTPPPPQTP--APPGPDTPAPP 127 Score = 31.9 bits (69), Expect = 0.89 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPP-RXPPAPXA 870 PP PP PP P PPP P P PP PAP A Sbjct: 95 PP--PPATPPPPTMPPTPPP-PQTPAPPGPDTPAPPA 128 Score = 31.9 bits (69), Expect = 0.89 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 PP PPA P PP P P P PP P PP Sbjct: 95 PP--PPATPPPPTMPPTPPPPQTPA-PPGPDTPAPP 127 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 814 PPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 PP P P P PP P PP P PP P Sbjct: 97 PPATPPPPTMPPTPPPPQTPAPP--GPDTPAPPAP 129 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPP-XPXXPXPPR-XPPAP 864 PP A P PP P PPP P P P PPAP Sbjct: 96 PPPATP--PPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 PA P P P PP P P PP Sbjct: 98 PATPPPPTMPPTPPPPQTPAPP 119 Score = 27.5 bits (58), Expect(2) = 0.71 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP P PP PA P P P Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAP 126 Score = 23.4 bits (48), Expect(2) = 0.71 Identities = 9/12 (75%), Positives = 9/12 (75%), Gaps = 2/12 (16%) Frame = +2 Query: 437 GXPPPP--PPPP 466 G PPPP PPPP Sbjct: 93 GDPPPPATPPPP 104 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 35.9 bits (79), Expect = 0.055 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P P PPP P P P AP A P PP P PP Sbjct: 218 PPQNHPLTNYPA-PPPQGYAPPPGGYPGAPPAGGYPGAPPPGGYPGGPP 265 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXP----PRPPPXXXPPP 821 PPP PPP P+ P P P PPP PP Sbjct: 199 PPPGGYAPPPYVPQEGGGIPPQNHPLTNYPAPPPQGYAPP 238 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPP--XPXXPXPPRXP 855 PP P PPA P PPP P P P P Sbjct: 238 PPGGYPGAPPAGGYPGAPPPGGYPGGPPPANYP 270 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 35.9 bits (79), Expect = 0.055 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +1 Query: 778 PXXPPAXXXPXXPP-PXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP P P P P PP P PP PP PP P Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQP 162 Score = 34.7 bits (76), Expect = 0.13 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P P A P PPP P P PP+ P P A PP P P P Sbjct: 105 PTSQPVAYGYPTGPPP-PYSPIPPQV-PYPGAAGPPMPHPTASVYPPP 150 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPP--PXPXXPXPPRXPPA--PXAXXPPXXXPPXXXPP 912 P P + P PP P P P P PP+ PP P PP PP P Sbjct: 140 PHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGPYP 199 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P A P P P PP P P P P PP P P P Sbjct: 130 PYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYP 188 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXX--PPPXPXXPXPPRX--PPAPXAXXPPXXXPPXXXPPXP 918 P P A PP P P P P P P + P P P PP PP Sbjct: 137 PPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTG 196 Query: 919 P 921 P Sbjct: 197 P 197 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 2/61 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPA--PXAXXPPXXXPPXXXPPXP 918 P P +P P A P P P P PP P P P PP P Sbjct: 118 PPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQP 177 Query: 919 P 921 P Sbjct: 178 P 178 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXX--PPRPPPXXXPPP 821 PPP P P+ P P PP+PPP P P Sbjct: 148 PPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQP 185 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 702 PXXPPPPXXXXPP--PXXPRXRPXXRPPXXPPRPPPXXXPP 818 P PPPP PP P P P PPP PP Sbjct: 115 PTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPP 155 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 31.5 bits (68), Expect(2) = 0.062 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P PP P PP P P PPP P Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 P +P P P PPP P PP PP PP Sbjct: 182 PGSPTEDTPWTSVPPPPPPGPGG-IPPPPPPIRGGVPPP 219 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 826 PXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP PP P PP PP PP Sbjct: 190 PWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 23.0 bits (47), Expect(2) = 0.062 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPP P Sbjct: 195 PPPPPPGP 202 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 32.3 bits (70), Expect = 0.67 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 P AP P P PP P PPPP Sbjct: 274 PPPLCAPPPPPPPPPPPPPPP 294 Score = 32.3 bits (70), Expect = 0.67 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 276 PLCAPPPPPPPPPPPPPPP 294 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 275 PPLCAPPPPPPPPPPPPPP 293 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 566 PPXXAPPXPXPAXXXPPPP 622 PP APP P P PPPP Sbjct: 275 PPLCAPPPPPPPPPPPPPP 293 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPP--RXPPAPXA 870 A A PP P PPP P P PP + P P A Sbjct: 266 AKSMAAATPPPLCAPPPPPPPPPPPPPPPGAKKPDDPVA 304 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 754 AXAPPXAPPXXPPAXXXPXXPPPXPXXPXPP 846 A PP P PP P PPP P P Sbjct: 272 ATPPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPP PPP PP PP PPP P P Sbjct: 274 PPPLCAPPPPP---------PPPPPPPPPPGAKKPDDP 302 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 992 AXPXAPXPXPXPPXPXPPPPP 1054 A P P PP P PPPPP Sbjct: 272 ATPPPLCAPPPPPPPPPPPPP 292 Score = 27.9 bits (59), Expect(2) = 0.065 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPP 622 PP PP PP P P P P Sbjct: 281 PPPPPPPPPPPPPPGAKKPDDP 302 Score = 26.6 bits (56), Expect(2) = 0.065 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 280 PPPPPPPP 287 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 32.3 bits (70), Expect = 0.67 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 P AP P P PP P PPPP Sbjct: 73 PPPLCAPPPPPPPPPPPPPPP 93 Score = 32.3 bits (70), Expect = 0.67 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 75 PLCAPPPPPPPPPPPPPPP 93 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P PP P PPPPP Sbjct: 74 PPLCAPPPPPPPPPPPPPP 92 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 566 PPXXAPPXPXPAXXXPPPP 622 PP APP P P PPPP Sbjct: 74 PPLCAPPPPPPPPPPPPPP 92 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPP--RXPPAPXA 870 A A PP P PPP P P PP + P P A Sbjct: 65 AKSMAAATPPPLCAPPPPPPPPPPPPPPPGAKKPDDPVA 103 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 754 AXAPPXAPPXXPPAXXXPXXPPPXPXXPXPP 846 A PP P PP P PPP P P Sbjct: 71 ATPPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPP PPP PP PP PPP P P Sbjct: 73 PPPLCAPPPPP---------PPPPPPPPPPGAKKPDDP 101 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 992 AXPXAPXPXPXPPXPXPPPPP 1054 A P P PP P PPPPP Sbjct: 71 ATPPPLCAPPPPPPPPPPPPP 91 Score = 27.9 bits (59), Expect(2) = 0.067 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPP 622 PP PP PP P P P P Sbjct: 80 PPPPPPPPPPPPPPGAKKPDDP 101 Score = 26.6 bits (56), Expect(2) = 0.067 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 79 PPPPPPPP 86 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 35.5 bits (78), Expect = 0.072 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 APP PP P PP PP PP + PP P PP Sbjct: 274 APPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPP 323 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PPP PPP R P P RPPP PPP Sbjct: 296 PPPNF--PPPDFSRPPPNFNDPAFQGRPPPFVRPPP 329 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 P PP P P PPP P P PA PP PP Sbjct: 280 PRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPP 328 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 35.5 bits (78), Expect = 0.072 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 P PPP PP P P PP P PPP PPP Sbjct: 213 PGLMPPPGMLPPPGGMP---PGRMPPQGLPFPPPGPIPPP 249 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 PP PP P P P P R PP PP PP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPP 248 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 35.5 bits (78), Expect = 0.072 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGA--GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG GG GG GG G G GGG G GG GGA G +G Sbjct: 464 GGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGG---GGGFSGGACGDFTSG 519 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GGG GG GG G G GGGG Sbjct: 490 GGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGGG 528 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 35.5 bits (78), Expect = 0.072 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 G G GG RGG G GGG GG GG GG Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGG 80 Score = 34.7 bits (76), Expect = 0.13 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G G G GGGRGG GG G + GGG GGG Sbjct: 45 GGGRGGPRGGGRGGGRGG--GGGFKSPRGGGRGGGRGGG 81 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG RGG G GGG G GG GG G Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGG 80 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGG-RXXGRXRGXXGGGXXXXGGGGXXG 701 G G G GRGG GG R GR G GGG GG G Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRG 75 Score = 33.1 bits (72), Expect = 0.39 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 814 GXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGGRGG GG G G GGG GGG G Sbjct: 41 GAGRGGGRGGPRGGGRGGGRGG--GGGFKSPRGGGRGG 76 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGG 813 GG GG GG G G RGG G GGG Sbjct: 46 GGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGG 81 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 G G G GG GG GG G GGG GG GG GG Sbjct: 33 GRPGFSPRGAGRGGGRGGPRGGGRGGGRG----GGGGFKSPRGGGRGGGRGGG 81 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 35.1 bits (77), Expect = 0.095 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 860 AGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 A G RGG G G GGG G GG GG G Sbjct: 195 ADGGRGGYGGRGRGGGGRGGYGGGGGYGGYGG 226 Score = 32.7 bits (71), Expect = 0.51 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXG-XGGGXXGXXXAGGXXGGAXG 765 GG GG GG GG G GG G G GGG G + G GG G Sbjct: 200 GGYGGRGRGGGGRGGYG--GGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGG 250 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 799 GGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 GGRGG G G RG GGG G GG Sbjct: 197 GGRGGYGGRGRGGGGRGGYGGGGGYGGYGG 226 Score = 31.5 bits (68), Expect = 1.2 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG G GG GG G G GGG G GG GG Sbjct: 200 GGYGGRGRGG--GGRGGYGGGGGYGGYGGYDQYSGGGYGG 237 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG GGGRGG GG G GG GGG G Sbjct: 201 GYGGRGRGGGGRGGYGGGGGYGGY-----GGYDQYSGGGYGG 237 Score = 30.3 bits (65), Expect = 2.7 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G G GG RGG G G GG G G G G + G Sbjct: 197 GGRGGYGGRGRGGGG-RGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYG 246 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 35.1 bits (77), Expect = 0.095 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXG--XXXAGGXXG-GAXGGAXAGX 747 G G G GG G G RGG G GGG GG G G GG AG Sbjct: 32 GMGRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGE 91 Query: 746 G 744 G Sbjct: 92 G 92 Score = 33.5 bits (73), Expect = 0.29 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 3/61 (4%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXG-GGXXGXXXAGGXX-G-GAXGGAXAGX 747 G GG G GG G G RGG G G GG G GG G G GG AG Sbjct: 104 GGGGMAGEGMSRGGIAGEGMG--RGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGE 161 Query: 746 G 744 G Sbjct: 162 G 162 Score = 32.7 bits (71), Expect = 0.51 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G GG G G RGG G GGG GG GG G G G Sbjct: 116 GGIAGEGMGRGGMAGEGMG--RGGMAGEGMGGGGMAGEGMGG--GGMAGEGMGGGG 167 Score = 32.3 bits (70), Expect = 0.67 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 3/61 (4%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXG--XXXAGGXXGGAXG-GAXAGX 747 G G G GG G G RGG G GGG GG G G G AG Sbjct: 72 GMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGMAGE 131 Query: 746 G 744 G Sbjct: 132 G 132 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXG-AGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG G GG G GG G G G G G G G GGA G Sbjct: 124 GRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGGAIFG 180 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGA 771 G GG G GG G GG G G GGG G +GG GA Sbjct: 134 GRGGMAGEGMGGGGMAGEGMGGG-GMAGEGMGGGGIAGEGISGGAIFGA 181 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GG G GRGG GGR G G G G G G Sbjct: 26 GGMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGG 65 Score = 29.9 bits (64), Expect = 3.6 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 5/63 (7%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXG-GGXXGXXXAGGXXGG---AXGG-AXA 753 G GG G GG G GG GG G G GG G GG G GG A Sbjct: 44 GGGGMAGEGMGRGGMAGEGMGG--GGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGE 101 Query: 752 GXG 744 G G Sbjct: 102 GMG 104 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G GG GGG G GR G GGG G G Sbjct: 37 GIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMG 74 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 34.7 bits (76), Expect = 0.13 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXP 837 PA P PP PPA P PPP P P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMP 105 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 790 PAXXXPXXPPPXPXXPXPPRXPPAPXAXXP 879 PA P PPP P P PP P P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +2 Query: 989 PAXPXAPXPXPXPPX---PXPPPPP 1054 PA P P P PP P PPPPP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPP 101 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 267 GXGGRVXPPPPXPXPXTXAGXPPP 338 G + PPPP P P + PPP Sbjct: 76 GPAAVIPPPPPPPPPASNVPAPPP 99 Score = 26.6 bits (56), Expect(2) = 0.22 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 83 PPPPPPPP 90 Score = 25.8 bits (54), Expect(2) = 0.22 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPP 619 P PP PP P P P PP Sbjct: 84 PPPPPPPASNVPAPPPPPPVMPP 106 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 34.7 bits (76), Expect = 0.13 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGX---GXXGXGGGXXGXXXAGGXXGGAXGGA 759 G GG A GAGG G G GGG G GG GG GGA Sbjct: 440 GSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGA 493 Score = 31.5 bits (68), Expect = 1.2 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 3/62 (4%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXG--AGGXRGGXGXXGXGGGXXG-XXXAGGXXGGAXGGAXAG 750 GG GG GG GG GG G G GGG G +GG G G Sbjct: 445 GGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGG 504 Query: 749 XG 744 G Sbjct: 505 GG 506 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 4/59 (6%) Frame = -3 Query: 923 AGGXGGXXXG----GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGA 759 AGG GG G GG GAGG GG G G GG G G+ Sbjct: 454 AGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAGS 512 Score = 30.7 bits (66), Expect = 2.1 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -1 Query: 916 GXAGAXXGGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G G GG AG G GG GG GG G GG Sbjct: 416 GDNGYSGGGGAGLNSNGRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGG 475 Query: 736 GXXXXGGGGXXG 701 GGGG G Sbjct: 476 PNGAGGGGGGGG 487 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -1 Query: 895 GGXAGAAXXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGG 716 GG G + G GGG GGG GG GG R GGG G Sbjct: 455 GGAGGRSNQNDVEGGFGGGGGPNGAGGG---GGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 GGG G G GG GG G G G GGGG Sbjct: 472 GGGGPNGAGGGGGGGGGYSG---GASGSRSNSCGGGG 505 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 34.7 bits (76), Expect = 0.13 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGX--GGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG G+GG GG G G GGG G GG G GG G Sbjct: 78 GGCEGGG----GSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVG 124 Score = 32.3 bits (70), Expect = 0.67 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGG 786 GG GG GG G G G GG G G GG GG Sbjct: 84 GGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGG 128 Score = 30.7 bits (66), Expect = 2.1 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -1 Query: 817 GGXXXGGGRGGXXGGRXXGRXRGXXGGG--XXXXGGGGXXG 701 GG GGG GG GG G G GGG GGGG G Sbjct: 78 GGCEGGGGSGGCEGG---GGCVGCEGGGGCVGCEGGGGCVG 115 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = -3 Query: 863 GAGGXRGGXGXX--GXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG GG G GGG G GG G GG G Sbjct: 76 GCGGCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVG 115 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 34.7 bits (76), Expect = 0.13 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 P P PP P P P P P P P P P P PP Sbjct: 2603 PPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPP 2648 Score = 32.3 bits (70), Expect = 0.67 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P P PP P PP PP P P P P PP PP Sbjct: 2592 PMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLP-LPPPGLPMQPEAPVQPPPLPP 2647 Score = 31.5 bits (68), Expect = 1.2 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +1 Query: 751 PAXAPPXAPP-XXPPAXXXPXXP---PPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P P PP PP P P PP P PP P P A P PP P P Sbjct: 2596 PFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLP-PPGLPMQPEAPVQPPPLPPPGGPFPP 2654 Query: 919 PA 924 A Sbjct: 2655 VA 2656 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 34.7 bits (76), Expect = 0.13 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGG 786 GG GG GG GG G GG GG G G G G Sbjct: 14 GGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDGDG 58 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G G GGG GG GG G G GGG G G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDG 42 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G G GG GGG G G GG+ GG G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEG 44 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -3 Query: 893 GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG +GG G G G GGG G G G G G Sbjct: 9 GDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDGDG 58 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXX--GGRXXGRXRGXXGGGXXXXGGG 713 G GG GGRGG GGR G RG GGG G G Sbjct: 342 GGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAGPQGEG 381 Score = 32.3 bits (70), Expect = 0.67 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = -3 Query: 857 GGXRGGXGXXGXGGGXXGXXXAGG-XXGGAXGGAXAGXG 744 GG RGG G GG G +GG GG GG G G Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGAG 376 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRG-GXGXXGXGGG 813 GG G G GG GA G RG G G G GGG Sbjct: 338 GGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGG 374 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 814 GXXXGGGRGGXXG--GRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGGRGG G GR RG GG G GG G Sbjct: 334 GDSRGGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGG 373 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GG GRGG GGR RG GG GG G G Sbjct: 339 GGRGGRGGRPGRGG-RGGRGASGGRGRGGGRGGFGGGAGPQG 379 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGA 771 G GG G RGG G G GG GG GGA Sbjct: 334 GDSRGGGRGGRGGRPGRGGRGGRGASGGRGRGGGRGGFGGGA 375 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 34.3 bits (75), Expect = 0.17 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXX-PXPPRXPP---APXAXXPPXXXPPXXXPPXPP 921 PP PP P P PPP P P PP P PP P PP PP Sbjct: 386 PP--PPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPP 440 Score = 33.1 bits (72), Expect = 0.39 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PPPP P P P PP PP+ P PPP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPP--PPKTIPSTLPPP 341 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP 879 P PA + P A PP P P P PP P A A P Sbjct: 308 PPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 31.1 bits (67), Expect = 1.6 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 8/65 (12%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPX---PXXPXPPRXPPAP-----XAXXPPXXXPPXXX 906 P PP P P A P PPP P P PP P PP P Sbjct: 367 PVQRPPGMRP--PGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYI 424 Query: 907 PPXPP 921 PP PP Sbjct: 425 PPPPP 429 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXP-PRXPPAPXAXXPPXXXPPXXXP 909 P P PP PP PP P P PP PP PP P Sbjct: 393 PGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAP 446 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP--XXXPPXP 918 P P P PP PP PPP P+ + PP PP P P Sbjct: 329 PPPKTIPSTLPP--PPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGAGNGPGGP 386 Query: 919 P 921 P Sbjct: 387 P 387 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 34.3 bits (75), Expect = 0.17 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 920 GGXGGXXXG--GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGA 759 GG GG G G GG GG RG G G GGG G G GG+ Sbjct: 421 GGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSGGYRDDYGYGGGS 476 Score = 31.9 bits (69), Expect = 0.89 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 8/48 (16%) Frame = -1 Query: 820 GGGXXXG---GGRGGXXGGRXXGRXRGXXG-----GGXXXXGGGGXXG 701 GGG G GGRGG GG G RG G GG G GG G Sbjct: 493 GGGPPRGGPRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGGRGGRGG 540 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 34.3 bits (75), Expect = 0.17 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP 894 P PP A P PP P PP P PP PA PP P Sbjct: 206 PRSGPLPPTAAPPPPPTTGAP---PPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 33.9 bits (74), Expect = 0.22 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXP 628 PP PP P P P PPPP P Sbjct: 217 PPPPPTTGAPPPTPVTNKPPPPRP 240 Score = 31.9 bits (69), Expect = 0.89 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXP 815 PPPP PPP +P P PPP P Sbjct: 218 PPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PPPP PP P +PP PPRP PPP Sbjct: 217 PPPPPTTGAPPPTP---VTNKPP--PPRPATTQAPPP 248 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPP 622 PP P PP P PA PPP Sbjct: 227 PPTPVTNKPPPPRPATTQAPPP 248 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 814 PPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 PPP P PP P P PP P P P A Sbjct: 217 PPPPPTTGAPP---PTPVTNKPPPPRPATTQAPPPTA 250 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.3 bits (75), Expect = 0.17 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -3 Query: 893 GXXXGGXXAXGAGGXRGGXGXXGX-GGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG GG GG G GGG G GG GGA G G G Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 31.1 bits (67), Expect = 1.6 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 G GG G G A G GG G GGG G AGG GG Sbjct: 53 GDGGDDCGDDGGAGGGAGGDDDDGGGISGCGDGGG--GGGGAGGDDDDGGGG 102 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GG G G G GG GGGG Sbjct: 64 GAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 >SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 34.3 bits (75), Expect = 0.17 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGX-RGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 G G GG GG G GG +GG G G GG G G G G Sbjct: 30 GDGQAGQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGDGPG 81 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGG-GXXGXXXAGGXXGGAXGGAXAGXG 744 G A G +GG G G GG G G AG G G AG G Sbjct: 30 GDGQAGQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQG 76 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG GG G GG GG G G GGG G G G G Sbjct: 25 GGGGHGGGHGYG-GGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSG 68 Score = 29.5 bits (63), Expect(2) = 0.17 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 618 GGGXXXAGXGXGGAXXGGXGGXG 550 GGG G G GG GG GG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGG 47 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 848 RGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 R G G G G G G GG GG GG Sbjct: 23 RDGGGGHGGGHGYGGGPNGGGGGGGGGGG 51 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 796 GRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GG GG G GGG GGGG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 27.5 bits (58), Expect(2) = 0.63 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGG G GG GG GG G Sbjct: 27 GGHGGGHGYGGGPNGGGGGGGGGGGG 52 Score = 23.4 bits (48), Expect(2) = 0.63 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 465 GGGGGGGG 442 GGGGGGGG Sbjct: 46 GGGGGGGG 53 Score = 23.4 bits (48), Expect(2) = 0.17 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 465 GGGGGGGG 442 GGGGGGGG Sbjct: 47 GGGGGGGG 54 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P P P PPP P P P PP P + P P P Sbjct: 510 PPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 31.5 bits (68), Expect = 1.2 Identities = 20/63 (31%), Positives = 23/63 (36%), Gaps = 3/63 (4%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP--PXXXP-PXXXPPX 915 P P+ PP P P A P P P P PP + P P P P PP Sbjct: 188 PTPSSYPPTQPSYPPTAPSYP--PTPSSYPPIAASYPPTAPSYNPTAPSYPPTPSSYPPT 245 Query: 916 PPA 924 P+ Sbjct: 246 QPS 248 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 805 PXXPPPXPXXPXP-PRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP P P P PP P + P P P PP Sbjct: 170 PSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPP 209 Score = 28.7 bits (61), Expect = 8.3 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPP-PXPXXPXPPRXPP-APXAXXPPXXXPP--XXXPPXPPA 924 P P PP P PP P P P PP AP P PP PP P+ Sbjct: 173 PPTQPFYPPT--QPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPS 227 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXP-PPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P PP P P P P P P PP + P P P PP Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPP 559 Score = 28.7 bits (61), Expect = 8.3 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 702 PXXPPPPXXXXPP-PXXPRXRPXXRPPXXPPRPP-PXXXPPPXP 827 P PP P P P P +P PP P PP P PP P Sbjct: 514 PSYPPTPSSYLPTQPYYPPPQPY--PPTQPSYPPTPSSYPPTQP 555 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 33.9 bits (74), Expect = 0.22 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGG 734 G G G GGGRGG GGR GR G G G Sbjct: 368 GGGRGGGRGGGRGGFRGGR-GGRGGGGRGAG 397 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 802 GGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 GGGRGG GG RG GG GGGG Sbjct: 368 GGGRGGGRGG-----GRGGFRGGRGGRGGGG 393 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 33.9 bits (74), Expect = 0.22 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP---PXXXPPXXXPPX 915 P P PP P PP PP P P P P + P P PP PP Sbjct: 19 PRPGAPPPM--PQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPP 76 Query: 916 P 918 P Sbjct: 77 P 77 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 33.9 bits (74), Expect = 0.22 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 548 RPXPPXPPXXAPPXPXPAXXXPPPPXP 628 RP PP PP P P P P PP P Sbjct: 1359 RPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 735 PPPXXPRXRPXX--RPPXXPPRPPPXXXPPPXP 827 P P PR RP RPP PRPP PP P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTP 1385 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 P P P P P PP P P PP Sbjct: 1363 PTPPRPPTPRPRPPTPRPGPP 1383 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXP-PXXXPPXXXP 909 P P P P PPR PP P P P PP P Sbjct: 1353 PIPSTPRPRPPTPPR-PPTPRPRPPTPRPGPPTPRP 1387 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP 864 P P PP P P P P P P PP P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRP--GPPTP 1385 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 33.9 bits (74), Expect = 0.22 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGG 737 G GG GGGRG GGR GR G GG Sbjct: 404 GRGGYRGRGGGRGYYRGGRGGGRGGGGRGG 433 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 863 GAGGXRGGXGXXG-XGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG RG G G G G GG GG GG G G Sbjct: 395 GRGGYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRG 435 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 796 GRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GRGG G R G RG GG GGG G Sbjct: 401 GRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRG 432 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 33.9 bits (74), Expect = 0.22 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 Query: 848 RGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 RGG G G GGG G GG G GG + G Sbjct: 336 RGGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = -3 Query: 857 GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G RGG G G GGG G GG GG G + G G Sbjct: 338 GSGRGGGGGGGGGGGGGG---GGGGRGGGGGFSSRGRG 372 Score = 32.3 bits (70), Expect = 0.67 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 817 GGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 GG GGG GG GG G G GGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G G GGG GG GG G RG GGG G G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRG-GGGGFSSRGRG 372 Score = 31.9 bits (69), Expect = 0.89 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGG 734 G GGG GGG GG GGR G G G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 31.9 bits (69), Expect = 0.89 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGG 556 G GGGG G G GG GG GG Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGG 816 G G GG GG G GG RGG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGG 813 GG GG GG G GG GG G G GGG Sbjct: 337 GGSGRGGGGGGG----GGGGGGGGGGGRGGGGG 365 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 863 GAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 G GG GG G G GGG G GG G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXG 550 G GGGG G G GG G GG G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXG 804 GG G GG GG G G GGG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGG 362 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGGXGR 547 G GGGG G G GG GG G R Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGGFSSR 369 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 618 GGGXXXAGXGXGGAXXGGXGGXGR 547 GG G G GG GG GG GR Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGR 360 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 33.9 bits (74), Expect = 0.22 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXX-AGGXXGGA-XGGAXAGX 747 G GG GG GG G G G GGG G GG GG GG G Sbjct: 338 GDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGG 397 Query: 746 G 744 G Sbjct: 398 G 398 Score = 31.9 bits (69), Expect = 0.89 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGA--GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 G GG GG GG G GG G G G GG G GG GG G Sbjct: 348 GDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHG-GGDHGGGDHGGGDHGGGDYG 401 Score = 29.5 bits (63), Expect = 4.7 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG G G G GG G G G GG G GG GG G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPG-GGDPGGGDHGGGDHGGGDHG 376 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = -1 Query: 826 GXGGGXXXGGG--RGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G GG GGG RGG GGR R RG G GGG Sbjct: 195 GGFGGPGFGGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGG 234 Score = 31.5 bits (68), Expect = 1.2 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 13/66 (19%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRG-----------GXGXXGXGG--GXXGXXXAGGXX 780 GG GG GG G G GG RG G G G GG G G Sbjct: 195 GGFGGPGFGGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGGRGGFGGDFGGDGGRFDASNM 254 Query: 779 GGAXGG 762 GGA GG Sbjct: 255 GGATGG 260 Score = 31.5 bits (68), Expect = 1.2 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 6/48 (12%) Frame = -1 Query: 826 GXGGGXXXGG---GRGGXXG-GRXXGRXRGXXGGGXXXXGG--GGXXG 701 G GGG GG GRGG G G GR G GGG GG GG G Sbjct: 201 GFGGGPMRGGPMGGRGGPRGRGMQRGRG-GPRGGGRGGFGGDFGGDGG 247 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 33.5 bits (73), Expect = 0.29 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP 879 P A PP A P PP P P PP PPAP P Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPVPPTNP--PVPPTNPPAPPTNPP 257 Score = 31.9 bits (69), Expect = 0.89 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXX-PXXPPPXPXXPXPPRXPPAP 864 P PP P PP P PP P P PP PP P Sbjct: 221 PPTTQTPPTKAPTDPPVPPTNPPVPPTNP--PAPPTNPPKP 259 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP-PXXXPP 897 P P AP PP P P P PP PP P P P PP Sbjct: 209 PGNGVVPTQAP--RPPTTQTPPTKAP-TDPPVPPTNPPVPPTNPPAPPTNPP 257 >SB_57911| Best HMM Match : Drf_FH1 (HMM E-Value=2.3) Length = 169 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 6/51 (11%) Frame = +1 Query: 787 PPAXXXPXXP----PPXPXXPXPP--RXPPAPXAXXPPXXXPPXXXPPXPP 921 PP+ P P PP P PP PP+ PP PP P PP Sbjct: 30 PPSESRPRPPYDDRPPSESRPRPPYDERPPSESRPRPPYERPPSESRPRPP 80 >SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1680 Score = 33.5 bits (73), Expect = 0.29 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP 894 P P A AP P P P P P PP PAP PP P Sbjct: 726 PAPTQAQNPAPTPAPTQAQNPA-PTPAPTQAQPPVPSPAPTQAQPPAPSP 774 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 745 PXPAXAPPXAP---PXXPPAXXXPXXPPPXPXXPXPPRXPPAP 864 P P AP A P P P P P P PP PAP Sbjct: 734 PAPTPAPTQAQNPAPTPAPTQAQPPVPSPAPTQAQPPAPSPAP 776 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP-PXXXPPXPPA 924 P A AP P P P P P P PAP PP P P P P+ Sbjct: 716 PTQAQNPAPTPAPTQAQNPA-PTPAPTQAQNPAPTPAPTQAQPPVPSPAPTQAQPPAPS 773 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 33.5 bits (73), Expect = 0.29 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXG-GGXXGXXXAGGXXGGAXGG 762 G GG G G G G RG G G G GG G GG G GG Sbjct: 11 GSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG 63 Score = 31.5 bits (68), Expect = 1.2 Identities = 27/90 (30%), Positives = 28/90 (31%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXGXXXXXXXXXXXXXXXXXX 647 G GGG G G GG G+ G RG GGG GGG Sbjct: 11 GSGGGWGQGPG-GGWGRGQGGGMGRGP-GGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQ 68 Query: 646 XXXXXXXXXXXXGXGXGGXXGRGXRGXXGR 557 G G GG GR G GR Sbjct: 69 GGGMGRGPGGGLGRGPGGGWGRMQEGGMGR 98 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXG-XGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG G G G G RG G G GG G GG GG G G Sbjct: 19 GPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPG 77 Score = 29.9 bits (64), Expect = 3.6 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G GG G G G +GG G GGG G GG GG G G Sbjct: 6 GGWGRGSGGGWGQGPGGGWGRG--QGGGMGRGPGGG-WGRGSGGGWGRMQGGGMGRGPG 61 Score = 29.9 bits (64), Expect = 3.6 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXG-GAXGGAXAGXG 744 G GG G G G G R G G G G GG G G GG G G Sbjct: 27 GQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPG 85 Score = 29.5 bits (63), Expect = 4.7 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXGXXXXXXXXXXXXXXXXXX 647 G G G G GG G G RG GGG GGG Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQ-GGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGP 60 Query: 646 XXXXXXXXXXXXGXGXGGXXGRGXRGXXGR 557 G G GG GRG G GR Sbjct: 61 GGGWGRMQGGGMGRGPGGGLGRGPGGGWGR 90 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 33.5 bits (73), Expect = 0.29 Identities = 22/60 (36%), Positives = 23/60 (38%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 AGG GG G G GG GG G GG G +GG G G A G G Sbjct: 207 AGGMNSGYNGGPAPGAVGGFGGGG--GGSEDNGASGG--GGGYSGGGSGTHSGQAGGGGG 262 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/54 (35%), Positives = 21/54 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGA 759 GG GG GG + G GG G G G G AGG G GG+ Sbjct: 216 GGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHS-GQAGGGGGSYCGGS 268 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXG-XXGXGGGXXGXXXAGGXXGGAXGG 762 GG GG GG G G G GG G G GG G G GG Sbjct: 224 GGFGGG-GGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGGSSCSAVTGG 276 Score = 29.9 bits (64), Expect = 3.6 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG G G G G G GGG A G GG GG Sbjct: 204 GGRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGG 248 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 33.5 bits (73), Expect = 0.29 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPXPXXPX--PPRXPPAPXAXXPPXXXPPXXXPPXPP 921 AP P PPP P P PP PP P P P PP PP Sbjct: 842 APTTKTDRPLSPSAPPPLPPRPVGAPPSLPPRPRTRPLP---PKSDTPPPPP 890 Score = 32.7 bits (71), Expect = 0.51 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = +3 Query: 735 PPPXXPRXRPXXRPPXXPPRP-----PPXXXPPPXP 827 PPP PR P PP PPRP PP PP P Sbjct: 856 PPPLPPR--PVGAPPSLPPRPRTRPLPPKSDTPPPP 889 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P APP PP PP P PPR P P PP Sbjct: 863 PVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPP 915 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR--XPPAP 864 P APP PP P P PP P PP+ PP P Sbjct: 850 PLSPSAPPPLPPR--PVGAPPSLPPRPRTRPLPPKSDTPPPP 889 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/60 (30%), Positives = 18/60 (30%), Gaps = 1/60 (1%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXP-XXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P APP PP P PP P P P P PP PP Sbjct: 861 PRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKP--PPPPPP 918 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 702 PXXPPPPXXXXPP-PXXPRXRPXXRPPXXPPRPP 800 P PP P P P PR RP PP PP Sbjct: 857 PPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPP 890 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 33.1 bits (72), Expect = 0.39 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXG-GGXXGXXXAGGXXGGAXGG 762 G GG G G G G RG G G G GG G GG G GG Sbjct: 255 GSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG 307 Score = 33.1 bits (72), Expect = 0.39 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGX-GXXGXG-GGXXGXXXAGGXXGGAXGGAXAGXG 744 G G G GG G GG G G G G GG G GG G GG G G Sbjct: 285 GRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPG 344 Score = 32.3 bits (70), Expect = 0.67 Identities = 29/96 (30%), Positives = 30/96 (31%), Gaps = 6/96 (6%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGG------GGXXGXXXXXXXXXXXX 665 G GGG G G GG G+ G RG GG GG GG G Sbjct: 255 GSGGGWGQGPG-GGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQG 313 Query: 664 XXXXXXXXXXXXXXXXXXGXGXGGXXGRGXRGXXGR 557 G G GG GRG G GR Sbjct: 314 GMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWGR 349 Score = 30.7 bits (66), Expect = 2.1 Identities = 30/115 (26%), Positives = 31/115 (26%) Frame = -1 Query: 1054 GXGRGAXXGGGGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXRXGXAGAXXGGXAGAA 875 G G+G G G G G G G GG G Sbjct: 244 GMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRG 303 Query: 874 XXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G G G GGG G GG G RG GGG GGG Sbjct: 304 PGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGG---GLGRGP-GGGWGRMQGGG 354 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG G G G G RG G G G G GG GG G G Sbjct: 279 GPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPG 336 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 33.1 bits (72), Expect = 0.39 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 893 GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG G GG GG G G GGG G G G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGG-DGDGDGDGDGDGDGDGDGDGDG 352 Score = 31.9 bits (69), Expect = 0.89 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 627 GXGGGGXXXAGXGXGGAXXGGXGG 556 G GGGG G G GG GG GG Sbjct: 306 GDGGGGGDGGGGGGGGGGGGGDGG 329 Score = 31.9 bits (69), Expect = 0.89 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GGG GG GG G G G G G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDG 346 Score = 31.5 bits (68), Expect = 1.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 GGG GGG GG GG G G G G G G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG GGG GG GG G G G G G G Sbjct: 306 GDGGGGGDGGGGGGGGGG--GGGDGGGDGDGDGDGDGDG 342 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 GGG GGG GG GG G G G G G Sbjct: 315 GGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G G GGG G GG G G GGG G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG GGG GG GG G G G G G G Sbjct: 312 GDGGGGGGGGGGGGGDGG-GDGDGDGDGDGDGDGDGDGDGDG 352 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G G GG GG G G GGG GG GG G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGG-------GGDGGGDGDGDGDGDG 340 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 621 GGGGXXXAGXGXGGAXXGGXGGXG 550 GGGG G G GG G GG G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDG 332 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 33.1 bits (72), Expect = 0.39 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGR 758 G GGG GGG GG GGR GR Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRGR 537 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -1 Query: 820 GGGXXXGGGRGGXXGGRXXGRXRG 749 GGG GGG GG GGR GR RG Sbjct: 514 GGGGGGGGGGGGGGGGR-GGRGRG 536 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 621 GGGGXXXAGXGXGGAXXGGXGGXGR 547 GGGG G G GG GG GG GR Sbjct: 514 GGGGGGGGGGGGGG---GGRGGRGR 535 Score = 25.8 bits (54), Expect(2) = 5.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 799 GGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G G R R RG GGG GGGG Sbjct: 498 GSSSGSSIVRRPRRRRGGGGGGGGGGGGGG 527 Score = 21.8 bits (44), Expect(2) = 5.4 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 820 GGGXXXGGGRGG 785 GGG GGG GG Sbjct: 455 GGGGGGGGGSGG 466 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 751 PAXAPPXAPPXXP--PAXXXPXXPPPXPXXPXPPRXPPAPXAXXP 879 P+ AP +P PA P P P P PPR PPA P Sbjct: 507 PSCAPTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSPPAAAPCNP 551 Score = 32.7 bits (71), Expect = 0.51 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P AP P P P P PP PP P PP PP P P Sbjct: 504 PCAPSCAPTYSPSCCGSYPAPQPPSPPAPPPKP---APPPRSPPAAAPCNP 551 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXP 894 AP AP P P P P P P PAP PP P Sbjct: 506 APSCAPTYSPSCCGS--YPAPQPPSPPAPPPKPAPPPRSPPAAAP 548 Score = 28.7 bits (61), Expect = 8.3 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 437 GXPPPPPPPP 466 G PPPPPPPP Sbjct: 456 GPPPPPPPPP 465 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 33.1 bits (72), Expect = 0.39 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPP 1051 P +P P P PP P PPPP Sbjct: 1308 PESPPPPPPPPPPPPPPP 1325 Score = 32.3 bits (70), Expect = 0.67 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 771 RPPXXPPRPPPXXXPPPXP 827 +PP PP PPP PPP P Sbjct: 1306 QPPESPPPPPPPPPPPPPP 1324 Score = 31.5 bits (68), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAP 864 P PPP P P PP PP P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 566 PPXXAPPXPXPAXXXPPPPXP 628 PP PP P P PPPP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLP 1327 Score = 31.1 bits (67), Expect = 1.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAP 864 P PPP P P PP PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLP 1327 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +3 Query: 759 RPXXRPPXXPPRPPPXXXPPPXP 827 +P PP PP PPP PPP P Sbjct: 1306 QPPESPPPPPP-PPPPPPPPPLP 1327 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPP 846 PP +PP PP P PPP P P P Sbjct: 1307 PPESPPPPPP----PPPPPPPPPLPPTP 1330 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPP 1051 P P P P P PP P P PP Sbjct: 1308 PESPPPPPPPPPPPPPPPLPP 1328 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.1 bits (62), Expect = 6.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPPXP 628 PP P PP P P P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 29.1 bits (62), Expect = 6.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPP 1051 P P P P PP P PP P Sbjct: 1313 PPPPPPPPPPPPPLPPTP 1330 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 750 PRXRPXXRPPXXPPRPPPXXXPPP 821 P P PP PP PPP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 33.1 bits (72), Expect = 0.39 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP-PXXXPPXXXPP 912 PP + P P P P P PP+ P P P P PP PP Sbjct: 117 PPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPR 849 P PP P P PPP P P PPR Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPPR 168 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.1 bits (72), Expect = 0.39 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 G GG GG GG G GG GG G GG G GG GG G Sbjct: 5 GGGGDGDGGDGDGG--GGGDGGGDGG-DCDGDGGDCDGGDDDGGDDGGDGG 52 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXX--GXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG G GG GG G G GG G GG G GG G Sbjct: 7 GGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDG-GDGGVDCERG 58 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G GGG GGG GG G G GG GG Sbjct: 15 GDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGG 52 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 33.1 bits (72), Expect = 0.39 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 P PP P P PP P P P PP PP PP Sbjct: 383 PRGMPPKEDWGPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPP 431 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 4/50 (8%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXP----PRXPPAPXAXXPP 882 P P P P P P PP P P P PR P P PP Sbjct: 394 PGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPP 443 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 A P P P PP P PP PP PP PP Sbjct: 642 ARPPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 817 PPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP P P PP PP PP P PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPP 678 Score = 26.6 bits (56), Expect(2) = 0.49 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 663 PPPPPPPP 670 Score = 24.6 bits (51), Expect(2) = 0.49 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPP 622 P PP PP P P PPPP Sbjct: 664 PPPPPPPGGGVPGPP----KPPPP 683 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 30.3 bits (65), Expect = 2.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 753 RXRPXXRPPXXPPRPPPXXXPPPXP 827 R R PP PP PPP PP P Sbjct: 137 RRRRNPPPPPPPPSPPPPCHPPALP 161 Score = 26.6 bits (56), Expect(2) = 0.50 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 443 PPPPPPPP 466 PPPPPPPP Sbjct: 142 PPPPPPPP 149 Score = 24.6 bits (51), Expect(2) = 0.50 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPA 601 P PP PP PP PA Sbjct: 143 PPPPPPPSPPPPCHPPA 159 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 32.7 bits (71), Expect = 0.51 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXP 815 PP PP P+ P P P RPPP P Sbjct: 653 PPLAPYPPKTSPKTTPKPHIPPAPSRPPPQLPP 685 Score = 30.3 bits (65), Expect = 2.7 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 9/65 (13%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPP--AXXXPXXPP----PXPXXPXPPRXPP--APXAXXPP-XXXPP 897 P P AP P PP P PP P P PP+ P P PP PP Sbjct: 621 PQPETAPKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPP 680 Query: 898 XXXPP 912 PP Sbjct: 681 PQLPP 685 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 32.7 bits (71), Expect = 0.51 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 6/68 (8%) Frame = +2 Query: 443 PPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPP------XPPXXAPPXPXPAX 604 PPPPP PP RP P PP P PA Sbjct: 373 PPPPPQPPPPNEQQVVDRTVEYSEQVIYDLRGRTIRPFPTPNRRRRRSLVQPPPPPPPAP 432 Query: 605 XXPPPPXP 628 PPPP P Sbjct: 433 LPPPPPPP 440 Score = 31.9 bits (69), Expect = 0.89 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPP P Sbjct: 425 PPPPPPAPLPPPPPPPPQP 443 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 735 PPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P P R R +PP PP P P PPP P Sbjct: 411 PTPNRRRRRSLVQPPPPPP-PAPLPPPPPPP 440 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 548 RPXPPXPPXXAPPXPXPAXXXPPPPXP 628 +P PP PP PP P PPPP P Sbjct: 423 QPPPPPPPAPLPPPP------PPPPQP 443 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 P PPP P PP PP P P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 32.7 bits (71), Expect = 0.51 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPP-APXAXXPPXXXPPXXXPP 912 PP P PP PPP P P AP PP PP PP Sbjct: 138 PPPGPQAPPPGSTV-HYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPP 187 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 702 PXXPPP-PXXXXPPPXXPRXRPXXRPPXXPP--RPPPXXXPPPXP 827 P PPP PPP P +P PP PPP PP P Sbjct: 142 PQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYP 186 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 P P PP + PP P P P PP P PP PP Sbjct: 140 PGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPP---APPPAYPP 187 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P P A P P P PPP P PP PP PP PP Sbjct: 156 PQTTMGYPSAQPGFAPPGNYP--PPPAP----PPAYPPVTQGYNMSQYPPPDVAPP 205 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 32.7 bits (71), Expect = 0.51 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPP 803 PPPP PPP P PP P PPP Sbjct: 511 PPPPPPASPPPPLP-AEEDNSPPPLPAGPPP 540 Score = 31.5 bits (68), Expect = 1.2 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +2 Query: 557 PPXPPXXAPPXPXPA-XXXPPPPXP 628 PP PP +PP P PA PPP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLP 535 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXP 855 P PP +PP PA PPP P P PP P Sbjct: 511 PPPPPPASPPPPLPAEED-NSPPPLPAGP-PPDEP 543 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 32.3 bits (70), Expect = 0.67 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 G G GG G G G G GGG G GG GG GG Sbjct: 198 GAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGG 250 Score = 32.3 bits (70), Expect = 0.67 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = -3 Query: 920 GGXGGXXX-----GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGA 759 GG GG GG GG GG GG G G G G GG G G+ Sbjct: 213 GGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSGS 271 Score = 31.1 bits (67), Expect = 1.6 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG G GG G G GG G GG GG G + G G Sbjct: 198 GAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSG 253 Score = 29.5 bits (63), Expect = 4.7 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 7/66 (10%) Frame = -3 Query: 920 GGXGGXXX---GGXXXGGXXAXGAGGXR----GGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 GG GG G GG G G + GG G G G GG G GG Sbjct: 181 GGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGG 240 Query: 761 AXAGXG 744 G G Sbjct: 241 GGGGGG 246 Score = 29.5 bits (63), Expect = 4.7 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGA--GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 GG GG GG GG GG G G GGG G GG GG G Sbjct: 203 GGEGGKAFLNGGVGGRSVWNGVPGGFGGGGGVWGNGGG--G-GGGGGYSGGGSG 253 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 32.3 bits (70), Expect = 0.67 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P AP PP P P PP P PP P P PP P PP+ Sbjct: 81 PVVTDAPTTVPP--PVVTDAPTTVPPPVVTDAPTTVPP-PVVTDAPTTVPPPVQPTEPPS 137 Score = 30.3 bits (65), Expect = 2.7 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 5/63 (7%) Frame = +1 Query: 745 PXPAXAP--PXAPPXXPPAXXX---PXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXP 909 P P AP PP PP+ PPP P P P P P PP Sbjct: 37 PEPTQAPVADTDPPTNPPSVVEVTTTQAPPPPPVVTEAPTTVPPPVVTDAPTTVPPPVVT 96 Query: 910 PXP 918 P Sbjct: 97 DAP 99 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +3 Query: 711 PPPPXXXXP---PPXXPRXRPXXRPPXXPPRPPPXXXPPP 821 PPP P PP P PP P PP PPP Sbjct: 103 PPPVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPPP 142 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPP 897 P AP PP P P PP P PP PP PP Sbjct: 93 PVVTDAPTTVPP--PVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPP 141 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 32.3 bits (70), Expect = 0.67 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +2 Query: 437 GXPPPPPPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPXPAXXXPP 616 G PPP PPPP A PP PP A P A PP Sbjct: 719 GPPPPAPPPPPLGRDSAAVFMLTWTPLTNTSSAAN----VPPPPPPPAVPGEG-ARPPPP 773 Query: 617 PPXP 628 PP P Sbjct: 774 PPPP 777 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXR-PPXXPPRPPPXXXPPPXP 827 P PPPP P P PP PP PPP P Sbjct: 687 PAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPP 729 Score = 29.1 bits (62), Expect = 6.3 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P+ APP PP PP P P PP PP PP PP PP Sbjct: 680 PSSAPP--PPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPP---PP--APPPPP 729 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 32.3 bits (70), Expect = 0.67 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXR 752 G GGG GGG GG GGR R R Sbjct: 1004 GGGGGGGGGGGGGGRRGGRGGARGR 1028 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 621 GGGGXXXAGXGXGGAXXGGXGG 556 GGGG G G GG GG GG Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 Score = 28.7 bits (61), Expect = 8.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 817 GGXXXGGGRGGXXGGRXXGR 758 GG GGG GG GGR GR Sbjct: 1003 GGGGGGGGGGGGGGGRRGGR 1022 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 32.3 bits (70), Expect = 0.67 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 841 PPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP PP P PP PP PP P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXP---PPPXP 628 PP PP PP P P P PPP P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 32.3 bits (70), Expect = 0.67 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 6/66 (9%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPP---XPXXPXPPRXP---PAPXAXXPPXXXPPXXX 906 P P+ P P P+ P PP P P P P P P P Sbjct: 582 PTPSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYPGTHTAPPAGGYPTGQH 641 Query: 907 PPXPPA 924 PP PPA Sbjct: 642 PPPPPA 647 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 32.3 bits (70), Expect = 0.67 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P P+ P P P PP P P PP PP PP P Sbjct: 59 PSCAPSYQPSCCQQQQPMMMPFPPPPPIYMPPPPVYMPP---PPVYMPPPMP 107 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXP 788 P PPPP PPP P PP P Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPPPMP 107 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +2 Query: 551 PXPPXPPXXAPPXP---XPAXXXPPPPXP 628 P PP PP PP P P PPP P Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPPPMP 107 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 31.9 bits (69), Expect = 0.89 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P + P PP PP P P PP PP + PP PP P Sbjct: 692 PIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPP--PPEEVSLPPPDESPPSSKHP 745 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/62 (30%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +1 Query: 745 PXPAXAPPXAP--PXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P P PP P P P PPP PP P P + PP P P Sbjct: 700 PLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESP-PSSKHPPTVSPSSSSAPPR 758 Query: 919 PA 924 P+ Sbjct: 759 PS 760 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/60 (28%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP--XPPA 924 P PP P + P PPP P P P PP PP PP+ Sbjct: 682 PLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPPS 741 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPP--RXPPAPXAXXPPXXXPPXXXPPXPP 921 PP PP P P P P P P P +P P PP PP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPP 735 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXR--PXXRPPXXPPRPPPXXXPP 818 P PPPP P P P PP PPP PP Sbjct: 700 PLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPP 740 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 31.9 bits (69), Expect = 0.89 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPPA 924 P + P PP PP PPP P PP A PP PP P P A Sbjct: 247 PSVKPSVPIPPPTKPPPRVASRRPPP----PLPPPDSSEAQAQQPP-LSPPVGKPVVPAA 301 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 548 RPXPPXPPXXAPPXPXPAXXXPPPPXP 628 +P P PP PP P A PPPP P Sbjct: 250 KPSVPIPPPTKPP-PRVASRRPPPPLP 275 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 31.5 bits (68), Expect = 1.2 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXG---GGXXGXXXAGGXXGGAXGGAXAG 750 G G G G G+GG GG G G G G GG+ GGA G Sbjct: 224 GAGHGRTAGVGAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGGSWGGAGGG 282 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 31.5 bits (68), Expect = 1.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +1 Query: 814 PPPXPXXPX----PPRXPPAPXAXXPPXXXPPXXXPPXP 918 PPP P P P PP P P PP PP P Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPPP 88 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPP 846 PP APP PP P PP P P PP Sbjct: 232 PPTAPPNTPP----PPVTPPPPNTPGPP 255 Score = 30.7 bits (66), Expect = 2.1 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 835 PXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P+ P AP PP PP P PP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXPP 882 P P P P PP PP P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 31.5 bits (68), Expect = 1.2 Identities = 30/114 (26%), Positives = 30/114 (26%) Frame = -1 Query: 1054 GXGRGAXXGGGGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXRXGXAGAXXGGXAGAA 875 G G GA GGGG G G G GA G A Sbjct: 444 GGGDGAI-GGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAIGGDNDDGA 502 Query: 874 XXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G GG GG GG G G GGG GGG Sbjct: 503 IGGDDGATVDGDDGAIG-GGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGGGG 555 Score = 30.3 bits (65), Expect = 2.7 Identities = 29/118 (24%), Positives = 29/118 (24%) Frame = -1 Query: 1054 GXGRGAXXGGGGXGXGGXXXXXXXXXXXXXXXXXXXXXXXXXXXRXGXAGAXXGGXAGAA 875 G G GA GGGG G G G GG GA Sbjct: 436 GIGDGAI-GGGGDGAIGGGGDGAIGSAIGDGVNSDDGAIGCDGGGGANVGGDIGGNNGAI 494 Query: 874 XXXXXXXXXXXXXAXXGXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G GGG G G G G G G GGG G Sbjct: 495 GGDNDDGAIGGDDGATVDGDDGAIGGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNG 552 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 31.5 bits (68), Expect = 1.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPP 818 P PPP P P P R P RPPP P Sbjct: 709 PSRAPPPVPNHPSPAVPLRREGDTKSFAPQRPPPPTRTP 747 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 31.5 bits (68), Expect = 1.2 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGG---GXXXXGGGG 710 G G GGG GG GG G G GG G GGGG Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGG 460 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G G GG GG GG G G G GGGG Sbjct: 423 GGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGG 461 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = -3 Query: 893 GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGA 771 G GG +GG GG GG G +GG GG+ Sbjct: 423 GGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGGS 463 Score = 29.9 bits (64), Expect = 3.6 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -3 Query: 893 GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGA 759 G GG G GG GG GG G GG GG+ Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGGS 463 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 31.1 bits (67), Expect = 1.6 Identities = 22/65 (33%), Positives = 24/65 (36%), Gaps = 8/65 (12%) Frame = +1 Query: 754 AXAPPXAPPXXPPAXXXPXXP--PPXPXXP------XPPRXPPAPXAXXPPXXXPPXXXP 909 A +PP PP + P P PP P P P R PP P P P Sbjct: 509 AESPPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNP--DTERRPP 566 Query: 910 PXPPA 924 P PPA Sbjct: 567 PLPPA 571 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 31.1 bits (67), Expect = 1.6 Identities = 15/47 (31%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 760 APPXAPPXXPPAXXXPXXPPPXPXXPXP-PRXPPAPXAXXPPXXXPP 897 +PP +P P P P P P P PP+P P PP Sbjct: 518 SPPTSPTQQSPLETTPVLPLPEKVTPEPGSTTPPSPPPDSPKSVAPP 564 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/57 (29%), Positives = 19/57 (33%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 GG GG GG + G GG G G G G GG G + G Sbjct: 346 GGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAGSSCKG 402 Score = 31.1 bits (67), Expect = 1.6 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXG-XXGXGGGXXGXXXAGGXXGGAXGG 762 GG GG GG G G G GG G GG G AG G GG Sbjct: 354 GGFGGG-GGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAGSSCKGVTGG 406 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXR-GGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 AGG G G + GG G G G GGG A G GG GG Sbjct: 324 AGGARAQGWVGGRAGNMNSGYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGG 378 Score = 28.7 bits (61), Expect = 8.3 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 AG GG G G GG GG G GG G +GG G A G G Sbjct: 337 AGNMNSGYNGGPSPGAVGGFGGGG--GGSEDNGASGG--GGGYSGGGSGITWNQAGGGGG 392 >SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 31.1 bits (67), Expect = 1.6 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G G G G G G G G GG G GG G G Sbjct: 212 GGDGNGDGEGEGEGEGDGDGDGDGNGDGDGGGGDGGGDGDGDDGGVGDGDG 262 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 31.1 bits (67), Expect = 1.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPP---PXXXPPPXP 827 PPPP PR P R PP PP PPP P Sbjct: 27 PPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPP 68 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P P PPP PR PP PPR PP P Sbjct: 40 PRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPP 81 Score = 23.8 bits (49), Expect(2) = 5.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 443 PPPPPPP 463 PPPPPPP Sbjct: 50 PPPPPPP 56 Score = 23.8 bits (49), Expect(2) = 5.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 446 PPPPPPP 466 PPPPPPP Sbjct: 78 PPPPPPP 84 >SB_128| Best HMM Match : SH3BP5 (HMM E-Value=3.3) Length = 410 Score = 31.1 bits (67), Expect = 1.6 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 772 APPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 APP PPP P P PPAP PP Sbjct: 285 APPKPQKYSKSAVQPPPAPVDEQQPGPPPAPSLLVPP 321 >SB_48645| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=0.17) Length = 373 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G G GGG G GG G GGG GGG G Sbjct: 206 GAFAGMIVGGGGGAMIGGTAFGPIGALVGGGLGLLGGGVIGG 247 >SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1054 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -3 Query: 893 GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG + G G GG GG G G GGA G G Sbjct: 490 GQEKGGTGSGGGHGGEGGPSSLAAGGAGYGSYLLPVHPGSGGGGASGGRG 539 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 30.7 bits (66), Expect = 2.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 754 AXAPPXAPPXXPPAXXXPXXPPPXP 828 A PP APP P A P PPP P Sbjct: 26 AANPPEAPPLPPFAPLPPPVPPPPP 50 Score = 28.7 bits (61), Expect = 8.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 793 AXXXPXXPPPXPXXPXPPRXPPAPXA 870 A P PP P P PP PP P A Sbjct: 26 AANPPEAPPLPPFAPLPPPVPPPPPA 51 Score = 28.7 bits (61), Expect = 8.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 989 PAXPXAPXPXPXPPXPXPPPPP 1054 P P P P PP P PPPPP Sbjct: 30 PEAPPLPPFAPLPP-PVPPPPP 50 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP---PXXXPP 897 P + P + P PPA P P P P PP P P P PP Sbjct: 38 PPSSVPVSYPGPPPAMYAVPGMPMPPAYPGMPTYPPQPMQFLPGTLPGMPPP 89 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXPPXXXP---PXXXPPXPP 921 P PPP PP P A PP P P PP PP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 711 PPPPXXXX--PPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPPP PPP PP P P PPP P Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 9/52 (17%) Frame = +1 Query: 751 PAXAPPXAPPXX-----PPAXXXPXXPPPXPXXPX----PPRXPPAPXAXXP 879 P PP PP PP P PP P P PP PP P P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPP--PXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P PP PP PP P PP PA PP PP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 Score = 29.5 bits (63), Expect = 4.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 992 AXPXAPXPXPXPPXPXPPPPP 1054 A P P P P P PPPPP Sbjct: 302 APPPPPLPAGVPAPPPPPPPP 322 >SB_47682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 30.7 bits (66), Expect = 2.1 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 6/66 (9%) Frame = +1 Query: 745 PXPAXAP-PXAPPXXP-PAXXXPXXPP----PXPXXPXPPRXPPAPXAXXPPXXXPPXXX 906 P P P P APP P P P P P P PP P A P P Sbjct: 108 PVPLAPPMPLAPPVQQAPCGAGPMQAPCAGQQMPLAPPMPLAPPVPLALPMPLAPPMPLA 167 Query: 907 PPXPPA 924 PP A Sbjct: 168 PPVQQA 173 >SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 30.7 bits (66), Expect = 2.1 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 AGG GG G G G G G G GG A G G G AG G Sbjct: 101 AGGGGGSDDDGYDAAG----GGGSDHDGYDAVGDGGSDDDGYDAAGGGGSDDDGDDAGGG 156 Score = 30.3 bits (65), Expect = 2.7 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -3 Query: 923 AGGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGG-XXGXXXAGGXXGGAXGGAXAGX 747 AGG GG G GG G G G G GG G AGG G AG Sbjct: 23 AGGGGGSDDDGYDAGG----GGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDHDGDDAAGG 78 Query: 746 G 744 G Sbjct: 79 G 79 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGG-XRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG G A G GG G G GG A G G G AG G Sbjct: 46 GYDAAGGGGSDDDGYDAAGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGGG 104 Score = 28.7 bits (61), Expect = 8.3 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGG--XXGXXXAGGXXGGAXGGAXAGXG 744 G GG G A G GG G GGG G AGG G AG G Sbjct: 124 GYDAVGDGGSDDDGYDAAGGGGSDDDGDDAGGGGGSDHDGDDAAGGGGSDDDGYDAAGGG 183 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 PP P P P P P PP P P PP P PP P Sbjct: 244 PPTPTPHTSIP--PTPTPHTSIPPT--PTPHTSIPPTPTPHTSIPPTP 287 Score = 30.7 bits (66), Expect = 2.1 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 775 PPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 PP P P P P P PP P P PP P PP P Sbjct: 254 PPTPTPHTSIP--PTPTPHTSIPPT--PTPHTSIPPTPTPHTSIPPTP 297 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 30.7 bits (66), Expect = 2.1 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G G G GGRGG GR GR G G G G Sbjct: 32 GHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSGQGYG 69 Score = 29.5 bits (63), Expect = 4.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGGXXG 701 G G G GRGG G GR RG G G G G Sbjct: 26 GRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSGQG 67 >SB_19556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 30.7 bits (66), Expect = 2.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 790 PAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PA PP P P P PP P A P P PP Sbjct: 47 PAPFDTTTPPNEPHAPNTPSLPPDPCAPPTLNTEPTRETTPTPP 90 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 30.7 bits (66), Expect = 2.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 814 GXXXGGGRGGXXGGRXXGRXRGXXGGG 734 G G G GG GGR GR G GGG Sbjct: 148 GPVRGRGGGGRGGGRGHGRGGGSGGGG 174 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 30.7 bits (66), Expect = 2.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 1013 PXPXPPXPXPPPPP 1054 P P PP P PPPPP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 1004 APXPXPXPPXPXPPPP 1051 A P P PP P PPPP Sbjct: 209 AKPPPPPPPPPPPPPP 224 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 30.7 bits (66), Expect = 2.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPPP 1054 P AP P PP P PPP P Sbjct: 372 PCAPFAPPPPPPPPPPPAP 390 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 835 PXPPRXPPAPXAXXP--PXXXPPXXXPPXPPA 924 P P PAP + P P PP PP PPA Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPA 389 Score = 29.9 bits (64), Expect = 3.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP 864 PP P P P P P PP PPAP Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 29.5 bits (63), Expect = 4.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP 864 P AP AP P P PPP P P PP P Sbjct: 357 PPSTPAPTPAPLSSTPCA--PFAPPPPPPPPPPPAPGSTP 394 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 735 PPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 P P P P P PPP PPP P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 25.4 bits (53), Expect(2) = 2.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -2 Query: 621 GGGGXXXAGXGXGGAXXGG 565 GGGG G G GG GG Sbjct: 320 GGGGGGGGGGGGGGGGGGG 338 Score = 23.4 bits (48), Expect(2) = 2.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -2 Query: 465 GGGGGGGG 442 GGGGGGGG Sbjct: 332 GGGGGGGG 339 >SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) Length = 264 Score = 30.3 bits (65), Expect = 2.7 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +1 Query: 778 PXXPPAXXXPXXP--PPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P P P P PP P P P+ PP P P PP P Sbjct: 86 PQEPHRPLEPHRPLEPPRPQEPHRPQEPPRPQEPHRPQEPHRPLEPPRP 134 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXG 804 G G GG RGG G G GGG G Sbjct: 148 GPMRGRGGGGRRGGRGRGGGGGGGEG 173 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 796 GRGGXXGGRXXGRXRGXXGGG 734 GRGG GGR GR RG GGG Sbjct: 152 GRGG--GGRRGGRGRGGGGGG 170 >SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 P+ + P PP PP+ P P PP PP+ + P Sbjct: 146 PSSSFPSVPPSSPPSSSSPSSSSPSVPPSSPPSSPPSSSSSSLP 189 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 826 GXGGGXXXGGGRG-GXXGGRXXGRXRGXXGGGXXXXGGGG 710 G GGG G G G G G G G GG GGGG Sbjct: 239 GDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGGGGGGG 278 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 30.3 bits (65), Expect = 2.7 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = -3 Query: 896 GGXXXGGXXAXGAG-GXRGGXGXXGXGG---GXXGXXXAGGXXGGAXGG 762 GG GG G G G GG G G GG G G GG GG GG Sbjct: 1265 GGSSGGGMHGGGGGYGNYGGYG--GYGGNPQGGYGFAGYGGQYGGPRGG 1311 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -1 Query: 799 GGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 GG GG R + RG GG GGGG Sbjct: 1249 GGGGGAFSSRDYRQHRGGSSGGGMHGGGGG 1278 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGG 734 G GGG G G GG GG + G GG Sbjct: 804 GGGGGYNRGYGSGGGYGGGGYNKRGGRYSGG 834 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 30.3 bits (65), Expect = 2.7 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +1 Query: 751 PAXAPPXAPPXXPP-AXXXPXXPPP--XPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P PP PP A P PPP P PPR P P P P P PP Sbjct: 354 PNHRPQGLPPGMPPMALSLPGMPPPGLLPPPGMPPRL-PIPGLGLPGMPLP--GMPGMPP 410 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 30.3 bits (65), Expect = 2.7 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 PP P P P P P PP PP + P PP P Sbjct: 862 PPDPPQRLPLVEACPGSPSVKPAIDWPPPPPPPATSNGDPSLLLTTNVPPPP 913 Score = 29.5 bits (63), Expect = 4.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPPXP 628 P P PP PP P A PPPP P Sbjct: 781 PTTP-PPEYPPPPPGLARPNPPPPNP 805 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPP 882 P PP PP PP P PPP P P + P PP Sbjct: 781 PTTPPPEYPPP-PPGLARPNPPPPNP----PLQVTSIPGEPAPP 819 >SB_45794| Best HMM Match : zf-CCCH (HMM E-Value=3.1e-27) Length = 527 Score = 30.3 bits (65), Expect = 2.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPP PP P P P P P P PP P Sbjct: 225 PPPNSSRLSPPLSPLNGPPSPPLTEPSSPLPTSLTPPSP 263 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXG 804 G G GG RGG G G GGG G Sbjct: 147 GPVCGRGGGGRRGGGGCCGGGGGGGG 172 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXG 804 G G GG RGG G G GGG G Sbjct: 64 GPVCGRGGGGRRGGGGCCGGGGGGGG 89 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 30.3 bits (65), Expect = 2.7 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +1 Query: 760 APPXAPPXX--PPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 APP P PPA P P P P P P P P P P Sbjct: 230 APPPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEP 284 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/43 (32%), Positives = 14/43 (32%), Gaps = 1/43 (2%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXP-PRPPPXXXPPPXP 827 P P P P P P P P P P P P P P Sbjct: 250 PVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEP 292 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPP-PXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P PP P A P P P P P P P P P P P Sbjct: 242 PAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEPEP 294 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 PA PP P P P P P P P P P P P P Sbjct: 242 PAKLPPRQPVAEPEPERQP-EPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEPEP 294 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAP 864 P PPP P PP PPAP Sbjct: 1166 PPQPPPVPSVQAPPAPPPAP 1185 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 30.3 bits (65), Expect = 2.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 881 GGXXAXGAGGXRGGXGXXGXGGGXXG 804 G G GG RGG G G GGG G Sbjct: 147 GPVCGRGGGGRRGGGGCCGGGGGGGG 172 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 25.4 bits (53), Expect(2) = 3.2 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 557 PPXPPXXAPPXPXPAXXXPPPP 622 PP PP A P PPPP Sbjct: 584 PPHPPPPAHHVNKPGVPPPPPP 605 Score = 23.0 bits (47), Expect(2) = 3.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 443 PPPPPPPP 466 PPP PPPP Sbjct: 583 PPPHPPPP 590 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.9 bits (64), Expect = 3.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 551 PXPPXPPXXAPPXPXPAXXXPPPP 622 P PP PP +PP P P PPP Sbjct: 363 PTPPPPP-HSPPPPLPVIQLNPPP 385 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 29.9 bits (64), Expect = 3.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXP-PAPXAXXP 879 P P P PP P P PP P P P P P P A P Sbjct: 36 PIP-HGPRPLPPLREPPTPAPTPPPALPSTPTLPLAPRPRPTASQP 80 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.9 bits (64), Expect = 3.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 1007 PXPXPXPPXPXPPPPP 1054 P P P PP P PPPP Sbjct: 75 PQPTPPPPRPPTPPPP 90 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 29.9 bits (64), Expect = 3.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 738 PPXXPRXRPXXRPPXXPPRPPPXXXP 815 PP P P +PP PP+PP P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 28.7 bits (61), Expect = 8.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 766 PXAPPXXPPAXXXPXXPPPXPXXPXP 843 P PP PP P PP P P P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPPQP 1284 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 25.8 bits (54), Expect(2) = 4.4 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 Query: 437 GXPPPPPPP 463 G PPPPPPP Sbjct: 133 GAPPPPPPP 141 Score = 22.2 bits (45), Expect(2) = 4.4 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 551 PXPPXPPXXAPP 586 P PP PP PP Sbjct: 135 PPPPPPPAVVPP 146 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 805 PXXPPPXPXXPXPPRXPPAPXAXXPP 882 P PPP P P PP+ P P PP Sbjct: 301 PQTPPP-PQTPPPPQTPAPPQTPAPP 325 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 29.5 bits (63), Expect = 4.7 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXX--AXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGG 774 GG G G G A AG GG G G GG G AGG GG Sbjct: 166 GGSTGAPSSGAMVGATTWSASSAGASAGGGGGVGTTGGSTGA--AGGGGGG 214 >SB_51555| Best HMM Match : ATP-cone (HMM E-Value=3.3) Length = 491 Score = 29.5 bits (63), Expect = 4.7 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 4/61 (6%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXR---GGXGXXGXG-GGXXGXXXAGGXXGGAXGGAXA 753 GG G GG G + G G GG G G GG G GG GGA G A Sbjct: 367 GGGGVQTLGGQTMQGVQSYGGGAGMQSFGGGGMAGMQFGGMQGFPSLGGGGGGA--GMMA 424 Query: 752 G 750 G Sbjct: 425 G 425 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 29.5 bits (63), Expect = 4.7 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGG 774 GG GG GG GG GG GG GGG G G GG Sbjct: 212 GGKGGWENGGFGGGGSAMAHPGGG-GGYS----GGGIEGSETTGSAGGG 255 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 29.5 bits (63), Expect = 4.7 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 2/61 (3%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXP--PXXXPPXXXPPXP 918 P P PP PPA P P P PP P P PP P Sbjct: 39 PAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGA 98 Query: 919 P 921 P Sbjct: 99 P 99 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPPRPPP 803 PP PP P P PP PP PP Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 738 PPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PP P P PP PP PP P P Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDPP 55 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 29.5 bits (63), Expect = 4.7 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +1 Query: 751 PAXAPPXAPPXX--PPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P APP PP P+ P P P P PP P + P P PP Sbjct: 918 PYQAPPTLPPTTLTTPSWSQPV-PVPSMYQPQPPGIMQPPTSIPPSQPMAPPSFPP 972 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +3 Query: 255 SGLXGXGGRVXPPPPX--PXPXTXAGXPPP 338 SG G G R PPP P P +G PPP Sbjct: 121 SGYGGYGDRYDRPPPDRRPPPPDRSGYPPP 150 >SB_16908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 355 Score = 29.5 bits (63), Expect = 4.7 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG GG G A GG GG G G G GG GA GGA G Sbjct: 178 GGAGGGAVTGVGTPDDGANTDGGGAGGGSVTGVGTPDDGANTDGG---GAAGGAVTVVG 233 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 GG G A GG GG G G G GG GA GG+ G G Sbjct: 159 GGGAVAGVGTADDGANTDGGGAGGGAVTGVGTPDDGANTDGG---GAGGGSVTGVG 211 >SB_9614| Best HMM Match : GBP (HMM E-Value=1e-31) Length = 708 Score = 29.5 bits (63), Expect = 4.7 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 911 GGXXXGGXXXGGXXAXGA-GGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG A G GG RG G GG AGG GGA G G Sbjct: 610 GTGRKGGHGGSQAEAGGMWGGARGYPGTGRKGGHGGSQAKAGGMWGGARGYPGTG 664 >SB_53724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1005 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 714 PPPXXXXPPPXXPRXRPXXRPPXXPP 791 PPP PPP P+ + +PP P Sbjct: 360 PPPPIAMPPPAPPKGKAMVKPPEQTP 385 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 29.5 bits (63), Expect = 4.7 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXX--AXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGG 774 GG G G G A AG GG G G GG G AGG GG Sbjct: 212 GGSTGAPSSGAMVGATTWSASSAGASAGGGGGVGTTGGSTGA--AGGGGGG 260 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 814 PPPXPXXPXPPRXPP-APXAXXPPXXXPPXXXPPXPP 921 PPP P P P P P P P PP PP Sbjct: 57 PPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPP 93 >SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 233 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PPPP PP P R +P +PPP P P Sbjct: 123 PPPPPGVFTPP--PPYRTTAKPKGPTKKPPPMMSLTPTP 159 >SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 1042 Score = 29.5 bits (63), Expect = 4.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 750 PRXRPXXRPPXXPPRPPPXXXPPPXP 827 PR P P PR PP PPP P Sbjct: 1000 PRHFPRAARPPDSPRDPPPITPPPPP 1025 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 29.5 bits (63), Expect = 4.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 814 PPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 PPP P PP PPA P P PP P Sbjct: 138 PPPAKEAPLPP--PPAQQEAVPDIPTSPPPVPPLP 170 Score = 29.1 bits (62), Expect = 6.3 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXPXXXXXXXXXXXXXXXXAAPAX 890 PPPP P P P + P P PPP PP P A A Sbjct: 137 PPPPAKEAPLPPPPAQQEAV--PDIPTSPPPV---PPLPTEPLQQTTTSAPSLISPAAAG 191 Query: 891 PPXXAP 908 P AP Sbjct: 192 SPSDAP 197 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 29.5 bits (63), Expect = 4.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 1004 APXPXPXPPXPXPPPPP 1054 +P P P PP PPPPP Sbjct: 161 SPPPQPPPPPLPPPPPP 177 Score = 24.2 bits (50), Expect(2) = 5.7 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 551 PXPPXPPXXAPPXP 592 P PP PP PP P Sbjct: 164 PQPPPPPLPPPPPP 177 Score = 23.4 bits (48), Expect(2) = 5.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 443 PPPPPPPP 466 PPP PPPP Sbjct: 162 PPPQPPPP 169 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -3 Query: 896 GGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGG 762 G GG GG G G GG G GG G+ GG Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGG 142 >SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 899 Score = 29.1 bits (62), Expect = 6.3 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = -3 Query: 893 GXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAG 750 G GG GG + G G G G GG GG GG G Sbjct: 139 GGPFGGPRFGRGGGDQFERRYRGGGRGPFGPVFGGGNFGGGFGGDFGG 186 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 754 AXAPPXAPPXXPPAXXXPXXPPPXPXXPXP 843 A APP +P P P PPP P P Sbjct: 442 ADAPPVSPTTATPPPPPPSQPPPQQFIPSP 471 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 857 GGXRGGXGXXGXGGGXXGXXXAGGXXGGA 771 GG GG G G GGG G G G A Sbjct: 3699 GGYGGGGGGYGGGGGGYGDGTGGAAFGSA 3727 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 332 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 368 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 339 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 375 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 346 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 382 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 360 PPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 396 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 367 PPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPP 403 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 353 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 389 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 826 PXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P P P PP PP PP PP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPP 230 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXP 918 P A P PP P PP P P P A PP PP P Sbjct: 148 PTEAPEPETVPPQPETVPPQPETVPPQPGSEEP---EPVSQAPEPPKPKTSAPEPPKP 202 Score = 29.1 bits (62), Expect = 6.3 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +3 Query: 711 PPPPXXXXPPPXXPRXRPXXRPPXXPPRPPPXXXPPPXP 827 PP P P P P + P PP+P PP P Sbjct: 165 PPQPETVPPQPGSEEPEPVSQAPE-PPKPKTSAPEPPKP 202 >SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) Length = 532 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 814 GXXXGGGRGGXXGGRXXGRXRGXXGGG 734 G G G GG GGR GR RG GGG Sbjct: 318 GPVRGRGGGGRGGGR--GRGRGGSGGG 342 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 29.1 bits (62), Expect = 6.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 548 RPXPPXPPXXAPPXPXPAXXXPPPPXP 628 R PP P P P PA PPP P Sbjct: 1462 RVPPPFPAERRTPAPDPAERRVPPPFP 1488 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 29.1 bits (62), Expect = 6.3 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G GG G + G G G G GG GG GG GG +G G Sbjct: 599 GSGGGSQWGSFGQAAPTSQSSGFGGQGGMFGTPGGQQSGFH-GGIGGGGMGGGFSGQG 655 >SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) Length = 154 Score = 29.1 bits (62), Expect = 6.3 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +1 Query: 745 PXPAXAP------PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAP 864 P PA +P P P PP P PP P P PP P P Sbjct: 79 PPPALSPQVYRGYPFQYPGTPPPPMYPAFPPSFPSSP-PPEYPGLP 123 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.1 bits (62), Expect = 6.3 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 3/39 (7%) Frame = +1 Query: 787 PPAXXXPXXPPPXPXXP---XPPRXPPAPXAXXPPXXXP 894 PP P PPP P P PP P P P P Sbjct: 423 PPGGGVPSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 98 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 134 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 105 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 141 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 112 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPP 148 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 126 PPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 162 Score = 29.1 bits (62), Expect = 6.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 133 PPHEPGRPPHEPGRPPYEPGRPPHEPGRPPHELGRPP 169 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 717 PPXXXXPPPXXPRXRPXX--RPPXXPPRPPPXXXPPP 821 PP PP P P RPP P RPP PP Sbjct: 119 PPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPP 155 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 29.1 bits (62), Expect = 6.3 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 7/69 (10%) Frame = +2 Query: 437 GXPPPP-------PPPPXXXXXXXXXXXXXXXXXXXXXXXAXXXRPXPPXPPXXAPPXPX 595 G PPPP PPPP A P PP PP P Sbjct: 534 GGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPPG 593 Query: 596 PAXXXPPPP 622 PPP Sbjct: 594 AGQGGGPPP 602 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 23.8 bits (49), Expect(2) = 6.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 446 PPPPPPP 466 PPPPPPP Sbjct: 1455 PPPPPPP 1461 Score = 23.4 bits (48), Expect(2) = 6.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 581 PPXPXPAXXXPPP 619 PP P PA PPP Sbjct: 1456 PPPPPPAPPCPPP 1468 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 25.4 bits (53), Expect(2) = 6.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 Query: 437 GXPPPPPPPP 466 G PPPPPPP Sbjct: 791 GITPPPPPPP 800 Score = 21.8 bits (44), Expect(2) = 6.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 551 PXPPXPPXXAPP 586 P PP PP PP Sbjct: 794 PPPPPPPPPPPP 805 >SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/54 (29%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +1 Query: 763 PPXAPPXXPPAXXXPXXPPPX-PXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 PP + P P PP P P P P P PP P PP Sbjct: 542 PPTSQPGGFQHQQRPGAPPTSQPGFPSPQMQEPMQLPTSQPGGFPPQQRPGAPP 595 >SB_52043| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 97 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G GGG GG GG G GGG GG Sbjct: 9 GGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGG 46 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 998 PXAPXPXPXPPXPXPPPP 1051 P P P PP P PPPP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 28.7 bits (61), Expect = 8.3 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +1 Query: 745 PXPAXAP-PXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P A P P PP PP P PP P PR P A P P PP P Sbjct: 138 PTSATTPIPQIPP--PPTYLHPSQYPPSPPPWELPRVPSANATLPPHLQYGP--PPPTSP 193 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 28.7 bits (61), Expect = 8.3 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXG 765 GG GG GG GG G G GG G G GGG G GG G Sbjct: 227 GGLGGL--GGL--GGVGGLGGVGGLGGIG--GLGGGGVIAGAGAGIGGGVIG 272 >SB_33199| Best HMM Match : Collagen (HMM E-Value=0.77) Length = 134 Score = 28.7 bits (61), Expect = 8.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGG 713 G GGG GG GG G GGG GG Sbjct: 49 GGGGGNDDDGGNDNDDGGGKDDGANGDDGGGGNDDDGG 86 >SB_27853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPP 800 P PP P P P P RP + P P PP Sbjct: 201 PLLPPSPEPV-PTPKAPASRPGTKRPASPSTPP 232 >SB_20539| Best HMM Match : VWA (HMM E-Value=5.1848e-44) Length = 262 Score = 28.7 bits (61), Expect = 8.3 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +1 Query: 763 PPXAPPXX-PPAXXXPXXPPPXPXXPXPPRXP-PAPXAXXPPXXXPP 897 PP PP PP P PP P P PAP P PP Sbjct: 213 PPTLPPLTFPPRTFAPLTQPPRPVTRRRDVPPTPAPTRRPPVFTLPP 259 >SB_20177| Best HMM Match : hATC (HMM E-Value=1e-04) Length = 618 Score = 28.7 bits (61), Expect = 8.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 702 PXXPPPPXXXXPPPXXPRXRPXXRPPXXPPRPP 800 P PP P P P P RP + P P PP Sbjct: 25 PLLPPSPEPV-PTPKAPASRPGTKRPASPSTPP 56 >SB_19890| Best HMM Match : Drf_FH1 (HMM E-Value=2.4) Length = 169 Score = 28.7 bits (61), Expect = 8.3 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +1 Query: 745 PXPAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPPXPP 921 P P PP P P + PP P P R PP P P PP Sbjct: 23 PRPKPRPPAKPLILPKSSTISTKPPIKP-KPAVRRVPPPAPKKAPEDATSPKRNEAAPP 80 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 28.7 bits (61), Expect = 8.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 774 PPXXPPRPPPXXXPPPXP 827 PP P PPP PPP P Sbjct: 198 PPSGAPPPPPIGAPPPPP 215 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 28.7 bits (61), Expect = 8.3 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -3 Query: 917 GXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXXAGGXXGGAXGGAXAGXG 744 G G GG G A GG G GG G A G GG GG G Sbjct: 226 GQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGGGAGGGGGYSG 283 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 28.7 bits (61), Expect = 8.3 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 Query: 437 GXPPPPPPPP 466 G PPPPPPPP Sbjct: 177 GAPPPPPPPP 186 >SB_51094| Best HMM Match : VWA (HMM E-Value=0) Length = 3544 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = -1 Query: 814 GXXXGGGRGGXXGGRXXGRX-RGXXGGGXXXXGGGGXXG 701 G G G GG GG G GG GGGG G Sbjct: 3193 GDEDGAGEGGGGGGESLAMTVTGLEAGGYSAGGGGGGAG 3231 >SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) Length = 549 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/54 (27%), Positives = 17/54 (31%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P+ PP + P P P PP P PP P P PP Sbjct: 378 PSNTPPVSTPSHTPPVSTPSHTPP---VSTPSHTPPVSTPSHTPPVSTPSHTPP 428 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/54 (27%), Positives = 17/54 (31%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P+ PP + P P P PP P PP P P PP Sbjct: 414 PSHTPPVSTPSHTPPVSTPSNTPP---VSTPSHTPPVSTPSHTPPVSTPSHTPP 464 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/54 (27%), Positives = 17/54 (31%) Frame = +1 Query: 751 PAXAPPXAPPXXPPAXXXPXXPPPXPXXPXPPRXPPAPXAXXPPXXXPPXXXPP 912 P+ PP + P P P PP P PP P P PP Sbjct: 450 PSHTPPVSTPSHTPPVSTPSHTPP---VSTPSHTPPVSTPSNTPPVFTPSHTPP 500 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 28.7 bits (61), Expect = 8.3 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = -3 Query: 920 GGXGGXXXGGXXXGGXXAXGAGGXRGGXGXXGXGGGXXGXXX-AGGXXGGAXGGAXAGXG 744 G GG GG G GG GG G G G GG GG G A G Sbjct: 137 GLVGGGDNGGVVDVVVEDDGHGGGDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGGADGG 196 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 28.7 bits (61), Expect = 8.3 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -1 Query: 802 GGGRGG-XXGGRXXGRXRGXXGGGXXXXGGGG 710 GGG GG GGR GR G G G GG Sbjct: 39 GGGHGGGHGGGRGRGRGHGHGGDVGGDDGDGG 70 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 826 GXGGGXXXGGGRGGXXGGRXXGRXRGXXGGGXXXXGGGG 710 G G G G G GG GG G G G GGGG Sbjct: 47 GGGRGRGRGHGHGGDVGG-DDGDGGNCDGDGYGDVGGGG 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.148 0.515 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,505,701 Number of Sequences: 59808 Number of extensions: 376481 Number of successful extensions: 18143 Number of sequences better than 10.0: 238 Number of HSP's better than 10.0 without gapping: 1186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9246 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3165923931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -