BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F19 (1061 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 22 6.9 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 22 6.9 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 22.2 bits (45), Expect = 6.9 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +2 Query: 113 MSNTIFVVLYLIVLVRGQEEYIVSNLIEIDQTRSSPLESDTYL 241 M +FVV + EEY V I+ID+ + + YL Sbjct: 1 MFKVLFVVFACVQAYVYAEEYTVPQNIDIDEILKNDRLTKNYL 43 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 22.2 bits (45), Expect = 6.9 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -3 Query: 216 LDRV*SISIKFETIYSSCPLTKTIKYRTTN 127 +DRV +++I F I +SC L + K+R N Sbjct: 80 IDRVFTVAIPFVGIANSCILNQD-KWRLLN 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,431 Number of Sequences: 336 Number of extensions: 2283 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 58 effective length of database: 103,097 effective search space used: 30413615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -