BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F18 (1013 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF525673-1|AAM82611.1| 60|Anopheles gambiae cecropin CecB prot... 35 0.003 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 26 1.6 >AF525673-1|AAM82611.1| 60|Anopheles gambiae cecropin CecB protein. Length = 60 Score = 35.1 bits (77), Expect = 0.003 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +2 Query: 209 PRWKLFKKIEKVGRNVRDGLIKAGPAIA 292 PRWK K++EK+GRNV KA P IA Sbjct: 27 PRWKFGKRLEKLGRNVFRAAKKALPVIA 54 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 26.2 bits (55), Expect = 1.6 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -3 Query: 180 ASTNAKTKLKIRTKFILPKFYSAGRIQNSKYNIV 79 A T A+ R ++P+F S GR+Q+ NI+ Sbjct: 335 AVTEAQQAYYRRLSDLMPEFTSVGRLQDDSSNII 368 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,005 Number of Sequences: 2352 Number of extensions: 10041 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 65 effective length of database: 411,099 effective search space used: 111818928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -