BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F18 (1013 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY084165-1|AAL89903.1| 525|Drosophila melanogaster RE39081p pro... 31 2.5 AE014296-1347|AAF50503.1| 525|Drosophila melanogaster CG8254-PA... 31 2.5 >AY084165-1|AAL89903.1| 525|Drosophila melanogaster RE39081p protein. Length = 525 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 884 PLXXPPSP--TXAXHNLSPPXHARSF-SLXPPPTRXXXPHPSPG 1006 PL P P T H+ PP H R + PPP PHP+ G Sbjct: 117 PLLVAPMPVGTGPPHSHPPPPHPRLYVEGFPPPHHVPHPHPALG 160 >AE014296-1347|AAF50503.1| 525|Drosophila melanogaster CG8254-PA protein. Length = 525 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/44 (38%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +2 Query: 884 PLXXPPSP--TXAXHNLSPPXHARSF-SLXPPPTRXXXPHPSPG 1006 PL P P T H+ PP H R + PPP PHP+ G Sbjct: 117 PLLVAPMPVGTGPPHSHPPPPHPRLYVEGFPPPHHVPHPHPALG 160 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,822,415 Number of Sequences: 53049 Number of extensions: 500574 Number of successful extensions: 1950 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1922 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 5160759156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -