BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F18 (1013 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77655-1|CAB01137.1| 393|Caenorhabditis elegans Hypothetical pr... 30 2.3 AL034392-5|CAE17989.1| 134|Caenorhabditis elegans Hypothetical ... 29 7.0 >Z77655-1|CAB01137.1| 393|Caenorhabditis elegans Hypothetical protein C56A3.1 protein. Length = 393 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -2 Query: 805 CPXXXXVXXXVGGGGARGGXXXXXXXXXXXXXXXXXGGFVGXGGGGXXXVG 653 CP V GGGG GG GG G GGGG G Sbjct: 75 CPQVQPVYVQSGGGGCGGGGCGGGGGGCGGGGGCGGGGGGGCGGGGGGGCG 125 >AL034392-5|CAE17989.1| 134|Caenorhabditis elegans Hypothetical protein Y40B1A.5 protein. Length = 134 Score = 28.7 bits (61), Expect = 7.0 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +2 Query: 869 PXAXXPLXXPPSPTXAXHNLSPPXHARSFSLXPPPTRXXXPHPSP 1003 P + P PP P PP H + PPP P P P Sbjct: 56 PPSLPPSTMPPGPHGMPFMGGPPPHHQYHLQYPPPHGLGPPPPPP 100 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,047,025 Number of Sequences: 27780 Number of extensions: 235146 Number of successful extensions: 700 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2667870690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -