BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F16 (898 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 7.2 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 9.5 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.8 bits (49), Expect = 7.2 Identities = 13/44 (29%), Positives = 18/44 (40%) Frame = -2 Query: 483 NRKGPILERCREXGDV*HHLMAWGLPWQQQSTVTQCCRPLISVV 352 N +GP RCR V M + P + + CR L+ V Sbjct: 782 NHRGPKTSRCRLLAAVADSTMRYAAPVWHGALTNRECRSLLKRV 825 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 9.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 85 LNFILKRILVLKSRTLNFLNQHSS 156 + F+ +R+ +LKS N NQ+S+ Sbjct: 287 VEFLEQRVNILKSSAQNICNQYSA 310 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,038 Number of Sequences: 2352 Number of extensions: 11521 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 96747534 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -