BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F10 (976 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 41 0.008 BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein pr... 40 0.018 BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein ... 40 0.018 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 40 0.018 AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens ... 40 0.018 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 40 0.018 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 40 0.018 AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. 40 0.018 BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 39 0.024 AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr... 39 0.024 AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 39 0.024 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 39 0.024 AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. 39 0.024 Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfami... 39 0.032 X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. 39 0.032 U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. 39 0.032 U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. 39 0.032 EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfa... 39 0.032 D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. 39 0.032 BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. 39 0.032 BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. 39 0.032 BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. 39 0.032 BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfa... 39 0.032 AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. 39 0.032 AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. 39 0.032 AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341... 39 0.032 AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens ... 39 0.032 AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. 39 0.032 AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. 39 0.032 AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ... 38 0.042 U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. 38 0.073 BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. 38 0.073 BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 p... 38 0.073 AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 i... 38 0.073 AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 pro... 38 0.073 AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a pro... 38 0.073 D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. 30 0.092 BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, mem... 30 0.092 AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, mem... 30 0.092 AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. 30 0.092 AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens ... 37 0.097 AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens ... 37 0.097 BC065551-1|AAH65551.1| 440|Homo sapiens WAS/WASL interacting pr... 37 0.13 BC035907-1|AAH35907.1| 308|Homo sapiens USP51 protein protein. 37 0.13 AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific prot... 37 0.13 AJ431177-1|CAD24007.1| 440|Homo sapiens WIRE protein protein. 37 0.13 AB043786-1|BAB85113.1| 440|Homo sapiens WICH protein. 37 0.13 D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. 36 0.17 BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1... 36 0.17 AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. 36 0.17 AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase k... 36 0.17 BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 p... 36 0.22 BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. 36 0.22 BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding prote... 36 0.22 BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. 36 0.22 BC005174-1|AAH05174.1| 282|Homo sapiens activating transcriptio... 36 0.22 BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding prote... 36 0.22 AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens ... 36 0.22 AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens ... 36 0.22 AF305687-1|AAG22558.1| 282|Homo sapiens transcription factor AT... 36 0.22 AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding prot... 36 0.22 AB073613-1|BAD38650.1| 282|Homo sapiens activating transcriptio... 36 0.22 AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein N... 36 0.22 AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SE... 36 0.22 AB021663-1|BAA78477.2| 282|Homo sapiens leucine-zipper protein ... 36 0.22 AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. 36 0.22 X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. 36 0.30 X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. 36 0.30 M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. 36 0.30 D10250-1|BAA01095.1| 2783|Homo sapiens alpha-fetoprotein enhance... 36 0.30 AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. 36 0.30 AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens ... 36 0.30 AJ400879-3|CAC35389.1| 1214|Homo sapiens KIAA0298 protein protein. 36 0.30 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 36 0.30 AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant pr... 36 0.30 AB002296-1|BAA20758.2| 901|Homo sapiens KIAA0298 protein protein. 36 0.30 Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for ... 35 0.39 X70944-1|CAA50283.1| 707|Homo sapiens PTB-associated splicing f... 35 0.39 D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 35 0.39 CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. 35 0.39 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 35 0.39 BC051192-1|AAH51192.1| 707|Homo sapiens splicing factor proline... 35 0.39 BC027708-1|AAH27708.1| 525|Homo sapiens SFPQ protein protein. 35 0.39 BC008829-1|AAH08829.1| 355|Homo sapiens SHOX2 protein protein. 35 0.39 BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IM... 35 0.39 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 35 0.39 AL590434-2|CAI12467.1| 707|Homo sapiens splicing factor proline... 35 0.39 AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318... 35 0.39 AL583834-6|CAI14459.2| 2279|Homo sapiens zinc finger protein 318... 35 0.39 AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. 35 0.39 AF121141-1|AAD17298.1| 2099|Homo sapiens endocrine regulator pro... 35 0.39 AF090114-1|AAD47387.1| 2099|Homo sapiens unknown protein. 35 0.39 AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein. 35 0.39 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 35 0.39 AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. 35 0.39 EF055487-1|ABK56022.1| 456|Homo sapiens shootin1 protein. 35 0.52 DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activ... 35 0.52 BC032303-1|AAH32303.1| 558|Homo sapiens KIAA1598 protein protein. 35 0.52 BC008669-1|AAH08669.1| 360|Homo sapiens PRR11 protein protein. 35 0.52 AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens ... 35 0.52 AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens ... 35 0.52 AK001891-1|BAA91964.1| 360|Homo sapiens protein ( Homo sapiens ... 35 0.52 AK000296-1|BAA91064.1| 210|Homo sapiens protein ( Homo sapiens ... 35 0.52 AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activ... 35 0.52 AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activ... 35 0.52 AJ007041-1|CAB45385.1| 2715|Homo sapiens trithorax homologue 2 p... 35 0.52 AF186605-1|AAD56420.1| 2605|Homo sapiens MLL2 protein protein. 35 0.52 AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activ... 35 0.52 AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activ... 35 0.52 AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. 35 0.52 AB046818-1|BAB13424.1| 446|Homo sapiens KIAA1598 protein protein. 35 0.52 AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. 35 0.52 AB002344-1|BAA21572.2| 1682|Homo sapiens KIAA0346 protein. 35 0.52 AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. 35 0.52 AB002302-1|BAA20763.3| 2415|Homo sapiens KIAA0304 protein protein. 35 0.52 Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated ph... 34 0.68 X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated ph... 34 0.68 U47742-1|AAC50662.1| 2004|Homo sapiens monocytic leukaemia zinc ... 34 0.68 BC050283-1|AAH50283.1| 499|Homo sapiens WASF3 protein protein. 34 0.68 BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated ... 34 0.68 BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated ... 34 0.68 BC022464-1|AAH22464.1| 459|Homo sapiens FEZ family zinc finger ... 34 0.68 AL163538-1|CAH72487.1| 502|Homo sapiens WAS protein family, mem... 34 0.68 AL159978-1|CAI14691.1| 502|Homo sapiens WAS protein family, mem... 34 0.68 AK001004-1|BAA91464.1| 304|Homo sapiens protein ( Homo sapiens ... 34 0.68 AF454702-1|AAL51032.1| 502|Homo sapiens WAVE3 protein. 34 0.68 AF134305-1|AAD33054.1| 455|Homo sapiens Scar3 protein. 34 0.68 AB026543-1|BAA81796.1| 502|Homo sapiens WASP-family protein pro... 34 0.68 AB020707-1|BAA74923.2| 503|Homo sapiens KIAA0900 protein protein. 34 0.68 L32832-1|AAC14462.1| 3703|Homo sapiens zinc finger homeodomain p... 34 0.90 BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. 34 0.90 BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. 34 0.90 BC053992-1|AAH53992.1| 1312|Homo sapiens SR-related CTD-associat... 34 0.90 BC032638-1|AAH32638.1| 411|Homo sapiens methyl-CpG binding doma... 34 0.90 AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. 34 0.90 AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. 34 0.90 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 34 0.90 AK024444-1|BAB15734.1| 1343|Homo sapiens FLJ00034 protein protein. 34 0.90 AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein pr... 34 0.90 AF254411-1|AAF87552.1| 1312|Homo sapiens ser/arg-rich pre-mRNA s... 34 0.90 AF120993-1|AAD56597.1| 411|Homo sapiens methyl-CpG binding prot... 34 0.90 AF120989-1|AAD56596.1| 302|Homo sapiens testis-specific methyl-... 34 0.90 AF072242-1|AAC68871.1| 411|Homo sapiens methyl-CpG binding prot... 34 0.90 AC004943-1|AAC79153.1| 2553|Homo sapiens unknown protein. 34 0.90 Z11933-1|CAA77990.1| 443|Homo sapiens N-Oct 3 octamer DNA (ATGC... 33 1.2 X58964-1|CAA41730.1| 979|Homo sapiens MHC class II regulatory ... 33 1.2 X56597-1|CAA39935.1| 321|Homo sapiens fibrillarin protein. 33 1.2 X04106-1|CAA27726.1| 268|Homo sapiens protein ( Human mRNA for ... 33 1.2 U36561-1|AAA79948.1| 528|Homo sapiens fus-like protein protein. 33 1.2 U16371-1|AAB60346.1| 31|Homo sapiens androgen receptor protein. 33 1.2 M59849-1|AAA52453.1| 321|Homo sapiens fibrillarin protein. 33 1.2 M35851-1|AAA51772.1| 917|Homo sapiens androgen receptor protein. 33 1.2 M31511-1|AAA35646.1| 268|Homo sapiens protein ( Human calcium-a... 33 1.2 M27430-1|AAA51886.1| 919|Homo sapiens AR protein. 33 1.2 M23263-1|AAA51775.1| 918|Homo sapiens androgen receptor protein. 33 1.2 M21748-1|AAA51771.1| 917|Homo sapiens androgen receptor protein. 33 1.2 M20132-1|AAA51729.1| 919|Homo sapiens AR protein. 33 1.2 L38696-1|AAC28898.1| 291|Homo sapiens autoantigen p542 protein. 33 1.2 L37868-1|AAB59611.1| 443|Homo sapiens POU-domain transcription ... 33 1.2 L29496-1|AAA51770.1| 734|Homo sapiens AR protein. 33 1.2 CR457069-1|CAG33350.1| 321|Homo sapiens FBL protein. 33 1.2 BT020144-1|AAV38946.1| 321|Homo sapiens fibrillarin protein. 33 1.2 BT009775-1|AAP88777.1| 268|Homo sapiens calpain, small subunit ... 33 1.2 BT006830-1|AAP35476.1| 321|Homo sapiens fibrillarin protein. 33 1.2 BC132975-1|AAI32976.1| 914|Homo sapiens AR protein protein. 33 1.2 BC105018-1|AAI05019.1| 306|Homo sapiens RNA binding protein, au... 33 1.2 BC103753-1|AAI03754.1| 307|Homo sapiens RNA binding protein, au... 33 1.2 BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosop... 33 1.2 BC094799-1|AAH94799.1| 1222|Homo sapiens valosin containing prot... 33 1.2 BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. 33 1.2 BC064998-1|AAH64998.1| 268|Homo sapiens CAPNS1 protein protein. 33 1.2 BC051699-1|AAH51699.2| 443|Homo sapiens POU class 3 homeobox 2 ... 33 1.2 BC049826-1|AAH49826.1| 979|Homo sapiens regulatory factor X, 1 ... 33 1.2 BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. 33 1.2 BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 33 1.2 BC028050-1|AAH28050.1| 634|Homo sapiens CREB regulated transcri... 33 1.2 BC027713-1|AAH27713.1| 804|Homo sapiens heterogeneous nuclear r... 33 1.2 BC023643-1|AAH23643.1| 268|Homo sapiens calpain, small subunit ... 33 1.2 BC023614-1|AAH23614.2| 604|Homo sapiens CRTC1 protein protein. 33 1.2 BC021933-1|AAH21933.1| 268|Homo sapiens calpain, small subunit ... 33 1.2 BC019260-1|AAH19260.1| 321|Homo sapiens fibrillarin protein. 33 1.2 BC018931-1|AAH18931.1| 268|Homo sapiens calpain, small subunit ... 33 1.2 BC017308-1|AAH17308.1| 268|Homo sapiens calpain, small subunit ... 33 1.2 BC017075-1|AAH17075.2| 475|Homo sapiens CRTC1 protein protein. 33 1.2 BC014232-1|AAH14232.1| 756|Homo sapiens HNRPUL1 protein protein. 33 1.2 BC011903-1|AAH11903.1| 322|Homo sapiens CAPNS1 protein protein. 33 1.2 BC009988-1|AAH09988.2| 756|Homo sapiens HNRPUL1 protein protein. 33 1.2 BC007779-1|AAH07779.1| 268|Homo sapiens calpain, small subunit ... 33 1.2 BC002564-1|AAH02564.1| 856|Homo sapiens heterogeneous nuclear r... 33 1.2 BC000592-1|AAH00592.1| 268|Homo sapiens calpain, small subunit ... 33 1.2 AY789642-1|AAV40829.1| 268|Homo sapiens calpain, small subunit ... 33 1.2 AY360171-1|AAQ98856.1| 650|Homo sapiens transducer of regulated... 33 1.2 AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. 33 1.2 AY225517-1|AAO74854.1| 124|Homo sapiens acetylcholinesterase me... 33 1.2 AY225516-1|AAO74853.1| 153|Homo sapiens acetylcholinesterase me... 33 1.2 AY040323-1|AAK93832.1| 593|Homo sapiens mucoepidermoid suscepti... 33 1.2 AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosop... 33 1.2 AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosop... 33 1.2 AL356358-1|CAI40496.1| 920|Homo sapiens androgen receptor (dihy... 33 1.2 AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosop... 33 1.2 AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosop... 33 1.2 AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (od... 33 1.2 AL158016-1|CAI40853.1| 920|Homo sapiens androgen receptor (dihy... 33 1.2 AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein pr... 33 1.2 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 33 1.2 AL049564-2|CAI43080.1| 920|Homo sapiens androgen receptor (dihy... 33 1.2 AL031668-6|CAB43742.1| 290|Homo sapiens RNA binding protein, au... 33 1.2 AL031668-5|CAI22150.1| 306|Homo sapiens RNA binding protein, au... 33 1.2 AL031668-4|CAI22149.1| 237|Homo sapiens RNA binding protein, au... 33 1.2 AL022395-2|CAB37982.1| 443|Homo sapiens POU domain, class 3, tr... 33 1.2 AK222915-1|BAD96635.1| 307|Homo sapiens RNA binding protein (au... 33 1.2 AK127057-1|BAC86806.1| 752|Homo sapiens protein ( Homo sapiens ... 33 1.2 AK123671-1|BAC85674.1| 520|Homo sapiens protein ( Homo sapiens ... 33 1.2 AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens ... 33 1.2 AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens ... 33 1.2 AK021455-1|BAB13831.1| 390|Homo sapiens protein ( Homo sapiens ... 33 1.2 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 33 1.2 AJ007509-1|CAA07548.1| 856|Homo sapiens E1B-55kDa-associated pr... 33 1.2 AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin remod... 33 1.2 AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. 33 1.2 AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 pr... 33 1.2 AF321917-1|AAK09426.1| 531|Homo sapiens androgen receptor protein. 33 1.2 AF321916-1|AAK09425.1| 542|Homo sapiens androgen receptor protein. 33 1.2 AF321915-1|AAK09424.1| 539|Homo sapiens androgen receptor protein. 33 1.2 AF321914-1|AAK09423.1| 544|Homo sapiens androgen receptor protein. 33 1.2 AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. 33 1.2 AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. 33 1.2 AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein. 33 1.2 AF148457-1|AAF04487.1| 306|Homo sapiens heterogeneous nuclear r... 33 1.2 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 33 1.2 AD001527-4|AAB51183.1| 268|Homo sapiens calcium-dependent prote... 33 1.2 AC018730-1|AAX88973.1| 500|Homo sapiens unknown protein. 33 1.2 AC006950-1|AAD15623.1| 227|Homo sapiens FBRL_HUMAN [AA 1- 227] ... 33 1.2 AC006123-1|AAC97072.1| 414|Homo sapiens KIAA0616 protein protein. 33 1.2 AC005393-3|AAC28913.1| 318|Homo sapiens FBRL_HUMAN protein. 33 1.2 AC002984-1|AAB81546.1| 268|Homo sapiens CANS_Human protein. 33 1.2 AB209887-1|BAD93124.1| 725|Homo sapiens WD repeat domain 26 var... 33 1.2 AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain... 33 1.2 AB058753-1|BAB47479.1| 1236|Homo sapiens KIAA1850 protein protein. 33 1.2 AB028987-1|BAA83016.2| 1315|Homo sapiens KIAA1064 protein protein. 33 1.2 AB028974-1|BAA83003.2| 402|Homo sapiens KIAA1051 protein protein. 33 1.2 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 33 1.2 AB014516-1|BAA31591.1| 634|Homo sapiens KIAA0616 protein protein. 33 1.2 AB001835-1|BAA19459.1| 500|Homo sapiens Brain-1 protein. 33 1.2 BC008207-1|AAH08207.1| 494|Homo sapiens hypothetical protein BC... 31 1.3 Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. 33 1.6 Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. 33 1.6 M94077-1|AAA36181.1| 316|Homo sapiens loricrin protein. 33 1.6 M61120-1|AAA36180.1| 316|Homo sapiens loricrin protein. 33 1.6 L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1... 33 1.6 D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. 33 1.6 D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternativel... 33 1.6 CR536555-1|CAG38792.1| 316|Homo sapiens LOR protein. 33 1.6 BC108290-1|AAI08291.1| 316|Homo sapiens LOR protein protein. 33 1.6 BC034690-1|AAH34690.1| 316|Homo sapiens LOR protein protein. 33 1.6 BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. 33 1.6 BC021165-1|AAH21165.1| 609|Homo sapiens ZNF503 protein protein. 33 1.6 BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. 33 1.6 BC013011-1|AAH13011.1| 609|Homo sapiens ZNF503 protein protein. 33 1.6 BC011625-1|AAH11625.1| 646|Homo sapiens zinc finger protein 503... 33 1.6 BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. 33 1.6 BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. 33 1.6 BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger ... 33 1.6 AY950679-1|AAY34147.1| 659|Homo sapiens MEX3C protein. 33 1.6 AL161636-5|CAI19560.1| 312|Homo sapiens loricrin protein. 33 1.6 AK128195-1|BAC87319.1| 976|Homo sapiens BP4). protein. 33 1.6 AK127803-1|BAC87142.1| 1063|Homo sapiens protein ( Homo sapiens ... 33 1.6 AK027184-1|BAB15686.1| 412|Homo sapiens protein ( Homo sapiens ... 33 1.6 AB095934-1|BAC23110.2| 1032|Homo sapiens KIAA2014 protein protein. 33 1.6 AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. 33 1.6 AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. 33 1.6 AB028999-1|BAA83028.1| 804|Homo sapiens KIAA1076 protein protein. 33 1.6 AB013076-1|BAA25794.1| 338|Homo sapiens loricrin protein. 33 1.6 X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage f... 33 2.1 X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. 33 2.1 DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. 33 2.1 BC146791-1|AAI46792.1| 1858|Homo sapiens myosin XVI protein. 33 2.1 BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (D... 33 2.1 BC090853-1|AAH90853.1| 289|Homo sapiens HOXD8 protein protein. 33 2.1 BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. 33 2.1 BC038709-1|AAH38709.1| 289|Homo sapiens homeobox D8 protein. 33 2.1 BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. 33 2.1 BC035727-1|AAH35727.1| 337|Homo sapiens Lix1 homolog (mouse)-li... 33 2.1 BC032358-1|AAH32358.1| 418|Homo sapiens Enah/Vasp-like protein. 33 2.1 BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled ... 33 2.1 BC023997-1|AAH23997.1| 416|Homo sapiens EVL protein protein. 33 2.1 BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. 33 2.1 BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. 33 2.1 AY014304-1|AAG42152.1| 290|Homo sapiens HOXD8 protein. 33 2.1 AL390918-1|CAI15821.1| 1858|Homo sapiens protein ( Human DNA seq... 33 2.1 AL353143-1|CAH73221.1| 1858|Homo sapiens protein ( Human DNA seq... 33 2.1 AL161431-1|CAI15548.1| 1858|Homo sapiens protein ( Human DNA seq... 33 2.1 AL157771-1|CAI16366.1| 1858|Homo sapiens protein ( Human DNA seq... 33 2.1 AL136132-1|CAH70519.1| 1858|Homo sapiens protein ( Human DNA seq... 33 2.1 AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein pr... 33 2.1 AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. 33 2.1 AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenyl... 33 2.1 AK129677-1|BAC85214.1| 168|Homo sapiens protein ( Homo sapiens ... 33 2.1 AK096970-1|BAC04915.1| 485|Homo sapiens protein ( Homo sapiens ... 33 2.1 AF386649-1|AAL26987.1| 1362|Homo sapiens bromodomain-containing ... 33 2.1 AF131766-1|AAD20040.1| 362|Homo sapiens Similar to Ena-VASP lik... 33 2.1 AF112209-1|AAF17197.1| 416|Homo sapiens Ena-VASP-like protein p... 33 2.1 AF087843-1|AAP97156.1| 418|Homo sapiens B6 protein. 33 2.1 AF052504-1|AAF21709.1| 418|Homo sapiens RNB6 protein. 33 2.1 AB020672-1|BAA74888.2| 1900|Homo sapiens KIAA0865 protein protein. 33 2.1 AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. 33 2.1 AL357564-3|CAI20974.1| 5183|Homo sapiens ubiquitin protein ligas... 25 2.4 AL137127-5|CAI19272.1| 5183|Homo sapiens ubiquitin protein ligas... 25 2.4 AF348492-1|AAL83880.1| 5183|Homo sapiens p600 protein. 25 2.4 Z93020-1|CAI21594.1| 729|Homo sapiens RAN binding protein 9 pro... 32 2.8 U80743-1|AAB91441.1| 556|Homo sapiens CAGH32 protein. 32 2.8 M98776-1|AAB47721.1| 644|Homo sapiens keratin 1 protein. 32 2.8 M33521-1|AAA35588.1| 1132|Homo sapiens protein ( Human HLA-B-ass... 32 2.8 M33519-1|AAA35587.1| 1132|Homo sapiens protein ( Human HLA-B-ass... 32 2.8 L20969-1|AAC00042.1| 809|Homo sapiens cyclic AMP phosphodiester... 32 2.8 BX511262-10|CAM45801.1| 743|Homo sapiens HLA-B associated trans... 32 2.8 BX511262-9|CAM45800.1| 1132|Homo sapiens HLA-B associated transc... 32 2.8 BX511262-8|CAM45799.1| 1126|Homo sapiens HLA-B associated transc... 32 2.8 BC110996-1|AAI10997.1| 393|Homo sapiens FAM39B protein protein. 32 2.8 BC106020-1|AAI06021.1| 267|Homo sapiens FAM39B protein protein. 32 2.8 BC100279-1|AAI00280.1| 322|Homo sapiens FAM39B protein protein. 32 2.8 BC063697-1|AAH63697.1| 644|Homo sapiens keratin 1 (epidermolyti... 32 2.8 BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precu... 32 2.8 BC052781-1|AAH52781.1| 802|Homo sapiens RANBP9 protein protein. 32 2.8 BC048328-1|AAH48328.1| 468|Homo sapiens family with sequence si... 32 2.8 BC003133-1|AAH03133.1| 1126|Homo sapiens HLA-B associated transc... 32 2.8 BA000025-30|BAB63390.1| 1126|Homo sapiens BAT3 protein. 32 2.8 AY152730-1|AAN75525.1| 665|Homo sapiens Rap1-interacting adapto... 32 2.8 AY044869-1|AAK97789.1| 3124|Homo sapiens p400 SWI2/SNF2-related ... 32 2.8 AM404259-1|CAL49295.1| 1200|Homo sapiens breast cancer anti-estr... 32 2.8 AM404183-1|CAL49297.1| 1200|Homo sapiens breast cancer anti-estr... 32 2.8 AM404182-1|CAL49296.1| 1220|Homo sapiens breast cancer anti-estr... 32 2.8 AL805934-12|CAI18508.2| 743|Homo sapiens HLA-B associated trans... 32 2.8 AL805934-11|CAI18504.1| 1132|Homo sapiens HLA-B associated trans... 32 2.8 AL805934-10|CAI18501.1| 1126|Homo sapiens HLA-B associated trans... 32 2.8 AL670886-3|CAM25014.1| 743|Homo sapiens HLA-B associated transc... 32 2.8 AL670886-2|CAI17785.1| 1132|Homo sapiens HLA-B associated transc... 32 2.8 AL670886-1|CAI17784.1| 1126|Homo sapiens HLA-B associated transc... 32 2.8 AL662847-3|CAO72072.1| 743|Homo sapiens HLA-B associated transc... 32 2.8 AL662847-2|CAI17659.1| 1132|Homo sapiens HLA-B associated transc... 32 2.8 AL662847-1|CAI17658.1| 1126|Homo sapiens HLA-B associated transc... 32 2.8 AL662801-55|CAI18316.2| 743|Homo sapiens HLA-B associated trans... 32 2.8 AL662801-54|CAI18314.1| 1132|Homo sapiens HLA-B associated trans... 32 2.8 AL662801-53|CAI18315.1| 1126|Homo sapiens HLA-B associated trans... 32 2.8 AL441883-5|CAI19841.1| 729|Homo sapiens RAN binding protein 9 p... 32 2.8 AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precu... 32 2.8 AL096814-1|CAD92526.1| 1200|Homo sapiens transcriptional regulat... 32 2.8 AF304164-1|AAG41947.1| 644|Homo sapiens keratin 1 protein. 32 2.8 AF297872-1|AAL01653.1| 1200|Homo sapiens zinc finger transcripti... 32 2.8 AF237621-1|AAF60327.1| 644|Homo sapiens keratin 1 protein. 32 2.8 AF129756-16|AAD18085.1| 1229|Homo sapiens BAT3 protein. 32 2.8 AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73... 32 2.8 AB058721-1|BAB47447.1| 1157|Homo sapiens KIAA1818 protein protein. 32 2.8 AB055311-1|BAB62525.1| 729|Homo sapiens RanBPM protein. 32 2.8 AB002358-1|BAA21638.2| 1019|Homo sapiens KIAA0360 protein. 32 2.8 L19605-1|AAA19734.1| 505|Homo sapiens 56K autoantigen protein. 32 3.6 CR450323-1|CAG29319.1| 505|Homo sapiens ANXA11 protein. 32 3.6 BX640870-1|CAE45928.1| 510|Homo sapiens hypothetical protein pr... 32 3.6 BT019934-1|AAV38737.1| 505|Homo sapiens annexin A11 protein. 32 3.6 BC110288-1|AAI10289.1| 403|Homo sapiens WIPF1 protein protein. 32 3.6 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 32 3.6 BC067364-1|AAH67364.1| 871|Homo sapiens PRP40 pre-mRNA processi... 32 3.6 BC050398-1|AAH50398.1| 788|Homo sapiens PRPF40B protein protein. 32 3.6 BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LO... 32 3.6 BC007564-1|AAH07564.1| 505|Homo sapiens annexin A11 protein. 32 3.6 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 32 3.6 AL513174-3|CAI13917.1| 204|Homo sapiens annexin A11 protein. 32 3.6 AL513174-2|CAI13916.1| 505|Homo sapiens annexin A11 protein. 32 3.6 AL513174-1|CAI13915.1| 150|Homo sapiens annexin A11 protein. 32 3.6 AL356095-2|CAI40438.1| 204|Homo sapiens annexin A11 protein. 32 3.6 AL356095-1|CAI40437.1| 505|Homo sapiens annexin A11 protein. 32 3.6 AL158012-1|CAH70655.1| 775|Homo sapiens GLIS family zinc finger... 32 3.6 AL137071-1|CAI39818.1| 775|Homo sapiens GLIS family zinc finger... 32 3.6 AL133283-1|CAH72449.1| 775|Homo sapiens GLIS family zinc finger... 32 3.6 AK222918-1|BAD96638.1| 505|Homo sapiens annexin A11 variant pro... 32 3.6 AJ278465-1|CAB94997.1| 505|Homo sapiens annexin A11 protein. 32 3.6 AJ278464-1|CAB94996.1| 505|Homo sapiens annexin A11 protein. 32 3.6 AJ278463-1|CAB94995.1| 505|Homo sapiens annexin A11 protein. 32 3.6 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 32 3.6 AF106062-1|AAD45972.1| 312|Homo sapiens Wiskott-Aldrich syndrom... 32 3.6 AC010894-2|AAY14708.1| 503|Homo sapiens unknown protein. 32 3.6 AB209770-1|BAD93007.1| 510|Homo sapiens annexin A11 variant pro... 32 3.6 AB058717-1|BAB47443.1| 1285|Homo sapiens KIAA1814 protein protein. 32 3.6 AB005216-1|BAA22432.1| 485|Homo sapiens Nck, Ash and phospholip... 26 4.8 Y18198-1|CAB38253.1| 485|Homo sapiens ONECUT-2 transcription fa... 31 4.8 Y13709-1|CAA74038.1| 313|Homo sapiens caudal-type homeobox prot... 31 4.8 X63753-1|CAA45282.1| 1523|Homo sapiens son-a protein. 31 4.8 X63071-1|CAA44793.1| 1179|Homo sapiens DBP-5 protein protein. 31 4.8 U53209-1|AAC50658.1| 282|Homo sapiens transformer-2 alpha protein. 31 4.8 U51096-1|AAB40603.1| 311|Homo sapiens homeobox protein Cdx2 pro... 31 4.8 U23767-1|AAA92290.1| 1178|Homo sapiens calcium-activated potassi... 31 4.8 U13913-1|AAA85104.1| 1178|Homo sapiens large-conductance calcium... 31 4.8 U06233-1|AAA16509.1| 410|Homo sapiens Brn-3b protein. 31 4.8 M96684-1|AAA60229.1| 322|Homo sapiens Pur protein. 31 4.8 M73069-1|AAA51735.1| 730|Homo sapiens androgen receptor protein. 31 4.8 M34233-1|AAA51780.1| 906|Homo sapiens AR protein. 31 4.8 D86982-1|BAA13218.1| 1180|Homo sapiens KIAA0229 protein. 31 4.8 BX538087-1|CAD98010.1| 913|Homo sapiens hypothetical protein pr... 31 4.8 BX537578-1|CAD97788.1| 913|Homo sapiens hypothetical protein pr... 31 4.8 BT019388-1|AAV38195.1| 322|Homo sapiens purine-rich element bin... 31 4.8 BC132832-1|AAI32833.1| 1134|Homo sapiens ankyrin repeat and ster... 31 4.8 BC130531-1|AAI30532.1| 491|Homo sapiens Cas-Br-M (murine) ecotr... 31 4.8 BC130529-1|AAI30530.1| 491|Homo sapiens Cas-Br-M (murine) ecotr... 31 4.8 BC125224-1|AAI25225.1| 748|Homo sapiens LRCH2 protein protein. 31 4.8 BC109221-1|AAI09222.1| 1019|Homo sapiens SLC4A5 protein protein. 31 4.8 BC062659-1|AAH62659.1| 168|Homo sapiens KCNMA1 protein protein. 31 4.8 BC036087-1|AAH36087.1| 322|Homo sapiens purine-rich element bin... 31 4.8 BC034498-1|AAH34498.1| 209|Homo sapiens WDR26 protein protein. 31 4.8 BC028697-1|AAH28697.3| 913|Homo sapiens WD repeat domain 44 pro... 31 4.8 BC027460-1|AAH27460.2| 488|Homo sapiens CBLL1 protein protein. 31 4.8 BC022396-1|AAH22396.1| 472|Homo sapiens Unknown (protein for IM... 31 4.8 BC017094-1|AAH17094.1| 282|Homo sapiens transformer-2 alpha pro... 31 4.8 BC014461-1|AAH14461.1| 313|Homo sapiens caudal type homeobox tr... 31 4.8 BC002422-1|AAH02422.1| 1365|Homo sapiens SON protein protein. 31 4.8 AY026895-1|AAK07692.1| 2386|Homo sapiens NREBP protein. 31 4.8 AL834210-1|CAD38894.1| 805|Homo sapiens hypothetical protein pr... 31 4.8 AL731560-10|CAI40877.1| 1178|Homo sapiens potassium large conduc... 31 4.8 AL731560-8|CAI40874.1| 1205|Homo sapiens potassium large conduct... 31 4.8 AL731560-2|CAI40870.1| 1177|Homo sapiens potassium large conduct... 31 4.8 AL731556-10|CAI14082.1| 1178|Homo sapiens potassium large conduc... 31 4.8 AL731556-8|CAI14079.1| 1205|Homo sapiens potassium large conduct... 31 4.8 AL731556-2|CAI14074.1| 1177|Homo sapiens potassium large conduct... 31 4.8 AL627447-10|CAI16171.1| 1178|Homo sapiens potassium large conduc... 31 4.8 AL627447-8|CAI16166.1| 1205|Homo sapiens potassium large conduct... 31 4.8 AL627447-2|CAI16162.1| 1177|Homo sapiens potassium large conduct... 31 4.8 AL591024-2|CAH70633.1| 313|Homo sapiens caudal type homeobox tr... 31 4.8 AL591002-1|CAI15138.1| 1134|Homo sapiens ankyrin repeat and ster... 31 4.8 AL391830-2|CAI41512.1| 913|Homo sapiens WD repeat domain 44 pro... 31 4.8 AL391830-1|CAI41513.1| 905|Homo sapiens WD repeat domain 44 pro... 31 4.8 AL391803-3|CAI41482.1| 913|Homo sapiens WD repeat domain 44 pro... 31 4.8 AL391803-2|CAI41483.1| 905|Homo sapiens WD repeat domain 44 pro... 31 4.8 AL391803-1|CAI41481.1| 805|Homo sapiens WD repeat domain 44 pro... 31 4.8 AL391474-2|CAI41402.1| 913|Homo sapiens WD repeat domain 44 pro... 31 4.8 AL391474-1|CAI41403.1| 905|Homo sapiens WD repeat domain 44 pro... 31 4.8 AL157833-10|CAI39736.1| 1178|Homo sapiens potassium large conduc... 31 4.8 AL157833-8|CAI39734.1| 1205|Homo sapiens potassium large conduct... 31 4.8 AL157833-2|CAI39730.1| 1177|Homo sapiens potassium large conduct... 31 4.8 AL138721-1|CAI12437.1| 1134|Homo sapiens ankyrin repeat and ster... 31 4.8 AL033520-2|CAI20281.1| 1134|Homo sapiens ankyrin repeat and ster... 31 4.8 AK026762-1|BAB15544.1| 491|Homo sapiens protein ( Homo sapiens ... 31 4.8 AJ278431-1|CAB94779.1| 313|Homo sapiens caudal type homeobox tr... 31 4.8 AF499137-1|AAQ07403.1| 903|Homo sapiens synaptopodin protein. 31 4.8 AF499136-1|AAQ07402.1| 903|Homo sapiens synaptopodin protein. 31 4.8 AF453528-1|AAL50802.1| 760|Homo sapiens sodium bicarbonate cotr... 31 4.8 AF452248-1|AAL48291.1| 1051|Homo sapiens sodium bicarbonate cotr... 31 4.8 AF380184-1|AAL34502.1| 2426|Homo sapiens SON DNA binding protein... 31 4.8 AF380183-1|AAL34501.1| 2108|Homo sapiens SON DNA binding protein... 31 4.8 AF380181-1|AAL34499.1| 2325|Homo sapiens SON DNA binding protein... 31 4.8 AF380180-1|AAL34498.1| 2303|Homo sapiens SON DNA binding protein... 31 4.8 AF380179-1|AAL34497.1| 2140|Homo sapiens SON DNA binding protein... 31 4.8 AF293338-1|AAK97073.1| 1040|Homo sapiens sodium bicarbonate cotr... 31 4.8 AF293337-1|AAK97072.1| 1121|Homo sapiens sodium bicarbonate cotr... 31 4.8 AF243499-1|AAK26741.1| 1137|Homo sapiens sodium bicarbonate cotr... 31 4.8 AF207661-1|AAG18492.1| 1074|Homo sapiens sodium bicarbonate cotr... 31 4.8 AF162704-1|AAD45921.1| 906|Homo sapiens androgen receptor protein. 31 4.8 AF007886-1|AAD05200.1| 313|Homo sapiens caudal-type homeobox pr... 31 4.8 AC073263-6|AAX93062.1| 714|Homo sapiens unknown protein. 31 4.8 AC023105-1|AAQ96870.1| 282|Homo sapiens unknown protein. 31 4.8 AC002467-2|AAS07390.1| 491|Homo sapiens unknown protein. 31 4.8 AB209752-1|BAD92989.1| 906|Homo sapiens sodium bicarbonate tran... 31 4.8 AB097048-1|BAC77401.1| 282|Homo sapiens putative MAPK activatin... 31 4.8 AB028952-1|BAA82981.2| 1015|Homo sapiens KIAA1029 protein protein. 31 4.8 AB028942-1|BAA82971.2| 2309|Homo sapiens KIAA1019 protein protein. 31 4.8 BC128607-1|AAI28608.1| 440|Homo sapiens SOCS7 protein protein. 26 4.9 Y13436-1|CAA73847.1| 387|Homo sapiens Sry-related Box 1 protein... 31 6.4 X86019-1|CAA60014.1| 494|Homo sapiens SH3-domain interacting pr... 31 6.4 X16667-1|CAA34657.1| 431|Homo sapiens protein ( Human HOX2G mRN... 31 6.4 X14487-1|CAA32649.1| 593|Homo sapiens protein ( Human gene for ... 31 6.4 U59298-1|AAD10852.1| 431|Homo sapiens hox homeobox transcriptio... 31 6.4 U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. 31 6.4 U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome ... 31 6.4 U10063-1|AAA57161.1| 423|Homo sapiens POU domain factor protein. 31 6.4 M77663-1|AAA59199.1| 384|Homo sapiens keratin 10 protein. 31 6.4 M77498-1|AAA73127.1| 268|Homo sapiens T-cell receptor alpha cha... 31 6.4 L20433-1|AAA65605.1| 420|Homo sapiens octamer binding transcrip... 31 6.4 L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease prot... 31 6.4 J04029-1|AAA60544.1| 561|Homo sapiens keratin 10 protein. 31 6.4 BC150273-1|AAI50274.1| 1422|Homo sapiens YEATS domain containing... 31 6.4 BC142702-1|AAI42703.1| 355|Homo sapiens vacuolar protein sortin... 31 6.4 BC141827-1|AAI41828.1| 355|Homo sapiens vacuolar protein sortin... 31 6.4 BC063316-1|AAH63316.1| 369|Homo sapiens FBXL17 protein protein. 31 6.4 BC034697-1|AAH34697.1| 584|Homo sapiens keratin 10 (epidermolyt... 31 6.4 BC020238-1|AAH20238.1| 596|Homo sapiens SRP68 protein protein. 31 6.4 BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrom... 31 6.4 BC003413-1|AAH03413.1| 217|Homo sapiens nucleolar protein famil... 31 6.4 BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. 31 6.4 BC002914-1|AAH02914.1| 358|Homo sapiens WIPF1 protein protein. 31 6.4 AY453840-1|AAR24087.1| 538|Homo sapiens atherin protein. 31 6.4 AL834261-1|CAD38936.1| 377|Homo sapiens hypothetical protein pr... 31 6.4 AL138691-1|CAH72340.1| 391|Homo sapiens SRY (sex determining re... 31 6.4 AK074698-1|BAC11145.1| 627|Homo sapiens protein ( Homo sapiens ... 31 6.4 AJ276003-1|CAB76563.1| 217|Homo sapiens GAR1 protein protein. 31 6.4 AF287967-5|AAG31555.1| 431|Homo sapiens homeobox B3 protein. 31 6.4 AF154915-2|AAF79045.1| 338|Homo sapiens transcription factor HO... 31 6.4 AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrom... 31 6.4 AF091395-1|AAC43042.1| 3038|Homo sapiens Trio isoform protein. 31 6.4 AF086762-1|AAF28400.1| 1111|Homo sapiens C11orf9 protein. 31 6.4 AF031588-1|AAC03767.1| 503|Homo sapiens WASP interacting protei... 31 6.4 AB209754-1|BAD92991.1| 2202|Homo sapiens triple functional domai... 31 6.4 AB209373-1|BAD92610.1| 410|Homo sapiens CS0DA006YC23 variant pr... 31 6.4 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 40.7 bits (91), Expect = 0.008 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 TPPPP PPP PPP PP P Sbjct: 1996 TPPPPPPPPPPPPPPPPPP 2014 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 1998 PPPPPPPPPPPPPPPPPP 2015 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 1999 PPPPPPPPPPPPPPPPPP 2016 Score = 37.1 bits (82), Expect = 0.097 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P P PPP P Sbjct: 1993 PPPTPPPPPPPPPPPPPPPPPPPPSAPP 2020 Score = 36.7 bits (81), Expect = 0.13 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP PPP PP Sbjct: 1993 PPPTPPPPPPPPPPPPPPPPPPP 2015 Score = 36.7 bits (81), Expect = 0.13 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP PPP PP Sbjct: 1994 PPTPPPPPPPPPPPPPPPPPPPP 2016 Score = 36.3 bits (80), Expect = 0.17 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q P PP PPP PPP PP P Sbjct: 1991 QAPPPTPPPPPPPPPPPPPPPP 2012 Score = 35.9 bits (79), Expect = 0.22 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 TPPPP PPP PP PP P PPP PP Sbjct: 1957 TPPPPPPPPPL-PPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPP 2007 Score = 35.9 bits (79), Expect = 0.22 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP P P Sbjct: 1995 PTPPPPPPPPPPPPPPPPPPPPSAP 2019 Score = 35.1 bits (77), Expect = 0.39 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 TP PP PP PP P P PPP P Sbjct: 1988 TPLQAPPPTPPPPPPPPPPPPPPPPPPPP 2016 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P P + PP P Sbjct: 1998 PPPPPPPPPPPPPPPPPPPSAPPQVQLP 2025 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP PP PP Sbjct: 1998 PPPPPPPPPPPPPPPPPPPSAPP 2020 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P Sbjct: 2003 PPPPPPPPPPPPPPSAPP 2020 >BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein protein. Length = 270 Score = 39.5 bits (88), Expect = 0.018 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 +P PPPP PPP PPP PP P Sbjct: 41 QPPLPLEMPPPPPPPPESPPPPPPPP 66 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP PP P Sbjct: 50 PPPPPPPESPPPPPPPPP 67 Score = 35.5 bits (78), Expect = 0.30 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 G P PPPP PPP PPP PP P Sbjct: 232 GAVPTATIIEPPPPPPPP--PPPPPPAP 257 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 243 PPPPPPPPPPPPPAPKMP 260 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PP PPP PP Sbjct: 53 PPPPESPPPPPPPPPP 68 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 51 PPPPPPESPPPPPPPPPP 68 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P P P P Sbjct: 245 PPPPPPPPPPPAPKMPPP 262 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 721 PPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P PPP Sbjct: 243 PPPPPPPPPPPPPAPKMPPP 262 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP P PPP PP Sbjct: 45 PLEMPPPPPPPPESPPPPPPPPP 67 >BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein 4 protein. Length = 1015 Score = 39.5 bits (88), Expect = 0.018 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 +P PPPP PPP PPP PP P Sbjct: 702 QPPLPLEMPPPPPPPPESPPPPPPPP 727 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP PP P Sbjct: 711 PPPPPPPESPPPPPPPPP 728 Score = 35.5 bits (78), Expect = 0.30 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 G P PPPP PPP PPP PP P Sbjct: 893 GAVPTATIIEPPPPPPPP--PPPPPPAP 918 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 904 PPPPPPPPPPPPPAPKMP 921 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PP PPP PP Sbjct: 714 PPPPESPPPPPPPPPP 729 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 712 PPPPPPESPPPPPPPPPP 729 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P P P P Sbjct: 906 PPPPPPPPPPPAPKMPPP 923 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 721 PPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P PPP Sbjct: 904 PPPPPPPPPPPPPAPKMPPP 923 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP P PPP PP Sbjct: 706 PLEMPPPPPPPPESPPPPPPPPP 728 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 39.5 bits (88), Expect = 0.018 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 +P PPPP PPP PPP PP P Sbjct: 623 QPSPPLPPPPPPPPPPPPPPPPPPPP 648 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 626 PPLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP PP PP PP P P PPP P Sbjct: 625 SPPLPPPPPPPPPPPPPP---PPPPPPLP 650 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP P P PPP PP Sbjct: 929 PPPPSPVPAPPPPPPP 944 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXP 774 PP PP PP PP P P + P Sbjct: 634 PPPPPPPPPPPPPPPLPSQSAP 655 >AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens cDNA FLJ12925 fis, clone NT2RP2004710, highly similar to Mus musculus formin binding protein 30 mRNA. ). Length = 560 Score = 39.5 bits (88), Expect = 0.018 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 +P PPPP PPP PPP PP P Sbjct: 247 QPPLPLEMPPPPPPPPESPPPPPPPP 272 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP PP P Sbjct: 256 PPPPPPPESPPPPPPPPP 273 Score = 35.5 bits (78), Expect = 0.30 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 G P PPPP PPP PPP PP P Sbjct: 438 GAVPTATIIEPPPPPPPP--PPPPPPAP 463 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 449 PPPPPPPPPPPPPAPKMP 466 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PP PPP PP Sbjct: 259 PPPPESPPPPPPPPPP 274 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 257 PPPPPPESPPPPPPPPPP 274 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P P P P Sbjct: 451 PPPPPPPPPPPAPKMPPP 468 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 721 PPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P PPP Sbjct: 449 PPPPPPPPPPPPPAPKMPPP 468 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP P PPP PP Sbjct: 251 PLEMPPPPPPPPESPPPPPPPPP 273 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 39.5 bits (88), Expect = 0.018 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 +P PPPP PPP PPP PP P Sbjct: 623 QPSPPLPPPPPPPPPPPPPPPPPPPP 648 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 626 PPLPPPPPPPPPPPPPPPPPPPPLP 650 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP PP PP PP P P PPP P Sbjct: 625 SPPLPPPPPPPPPPPPPP---PPPPPPLP 650 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP P P PPP PP Sbjct: 929 PPPPSPVPAPPPPPPP 944 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXP 774 PP PP PP PP P P + P Sbjct: 634 PPPPPPPPPPPPPPPLPSQSAP 655 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 39.5 bits (88), Expect = 0.018 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 +P PPPP PPP PPP PP P Sbjct: 609 QPSPPLPPPPPPPPPPPPPPPPPPPP 634 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 612 PPLPPPPPPPPPPPPPPPPPPPPLP 636 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP PP PP PP P P PPP P Sbjct: 611 SPPLPPPPPPPPPPPPPP---PPPPPPLP 636 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP P P PPP PP Sbjct: 915 PPPPSPVPAPPPPPPP 930 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXP 774 PP PP PP PP P P + P Sbjct: 620 PPPPPPPPPPPPPPPLPSQSAP 641 >AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. Length = 1050 Score = 39.5 bits (88), Expect = 0.018 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 +P PPPP PPP PPP PP P Sbjct: 737 QPPLPLEMPPPPPPPPESPPPPPPPP 762 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP PP P Sbjct: 746 PPPPPPPESPPPPPPPPP 763 Score = 35.5 bits (78), Expect = 0.30 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 G P PPPP PPP PPP PP P Sbjct: 928 GAVPTATIIEPPPPPPPP--PPPPPPAP 953 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 939 PPPPPPPPPPPPPAPKMP 956 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PP PPP PP Sbjct: 749 PPPPESPPPPPPPPPP 764 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 747 PPPPPPESPPPPPPPPPP 764 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P P P P Sbjct: 941 PPPPPPPPPPPAPKMPPP 958 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 721 PPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P PPP Sbjct: 939 PPPPPPPPPPPPPAPKMPPP 958 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP P PPP PP Sbjct: 741 PLEMPPPPPPPPESPPPPPPPPP 763 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 39.1 bits (87), Expect = 0.024 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXP 793 PPPP PPP PPP PP P PPP P Sbjct: 73 PPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPP 122 Score = 37.1 bits (82), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 PPPP PPP PP PP P + + PP PP Sbjct: 72 PPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQPP 122 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PP PP P Sbjct: 69 PPPPPPPPPPPPQQPPPP 86 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PPP P P Sbjct: 597 PPPMGMMPPPPPPPSGQPPPPPSGP 621 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G P PPP PPP PP PP Sbjct: 593 GMMPPPPMGMMPPPPPPPSGQPPPPP 618 >AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein protein. Length = 1009 Score = 39.1 bits (87), Expect = 0.024 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXXPPXPPKPXPXHNXPPP 780 PPP TPP PP PP PP P P PPP Sbjct: 445 PPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 489 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 463 PVTPPMPPPPPPPPPPPPPPPPPPP 487 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 466 PPMPPPPPPPPPPPPPPPPPPPPPP 490 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 475 PPPPPPPPPPPPPPPPLP 492 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP P P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPLPGP 494 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P P PPP P Sbjct: 463 PVTPPMPPPPPPPPPPPPPPPPPPPPP 489 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P P PPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPP 942 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 920 PPPPPPPPPPPPPPPPPPPPPPPP 943 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 921 PPPPPPPPPPPPPPPPPPPPPPPP 944 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPP 945 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P P PPP P Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPP 945 >AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. Length = 1112 Score = 39.1 bits (87), Expect = 0.024 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXXPPXPPKPXPXHNXPPP 780 PPP TPP PP PP PP P P PPP Sbjct: 548 PPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPPPPPPP 592 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 566 PVTPPMPPPPPPPPPPPPPPPPPPP 590 Score = 39.1 bits (87), Expect = 0.024 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 569 PPMPPPPPPPPPPPPPPPPPPPPPP 593 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 578 PPPPPPPPPPPPPPPPLP 595 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP P P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPLPGP 597 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P P PPP P Sbjct: 566 PVTPPMPPPPPPPPPPPPPPPPPPPPP 592 >Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 38.7 bits (86), Expect = 0.032 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP + PPPP PP PPP PP P Sbjct: 38 RRPGQRRPPPPPPPPPLPPPPPPPPLP 64 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 50 PPPPLPPPPPPPPLPPLP 67 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPP 777 PP PP PP PP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 >X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. Length = 281 Score = 38.7 bits (86), Expect = 0.032 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP + PPPP PP PPP PP P Sbjct: 38 RRPGQRRPPPPPPPPPLPPPPPPPPLP 64 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 50 PPPPLPPPPPPPPLPPLP 67 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPP 777 PP PP PP PP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 >U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 38.7 bits (86), Expect = 0.032 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP + PPPP PP PPP PP P Sbjct: 38 RRPGQRRPPPPPPPPPLPPPPPPPPLP 64 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 50 PPPPLPPPPPPPPLPPLP 67 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPP 777 PP PP PP PP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 >U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 38.7 bits (86), Expect = 0.032 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP + PPPP PP PPP PP P Sbjct: 38 RRPGQRRPPPPPPPPPLPPPPPPPPLP 64 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 50 PPPPLPPPPPPPPLPPLP 67 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPP 777 PP PP PP PP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 >EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 38.7 bits (86), Expect = 0.032 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP + PPPP PP PPP PP P Sbjct: 38 RRPGQRRPPPPPPPPPLPPPPPPPPLP 64 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 50 PPPPLPPPPPPPPLPPLP 67 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPP 777 PP PP PP PP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 >D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 38.7 bits (86), Expect = 0.032 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP + PPPP PP PPP PP P Sbjct: 38 RRPGQRRPPPPPPPPPLPPPPPPPPLP 64 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 50 PPPPLPPPPPPPPLPPLP 67 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPP 777 PP PP PP PP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 >BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 179 PPPPPPPPPLPPPPPPQP 196 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPP 201 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 180 PPPPPPPPLPPPPPPQPP 197 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P P PP P Sbjct: 184 PPPPLPPPPPPQPPPPPP 201 Score = 35.1 bits (77), Expect = 0.39 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +2 Query: 632 QXXTPPPPXPP-PXXPPPXPPXP 697 Q PPPP PP P PPP PP P Sbjct: 177 QPPPPPPPPPPLPPPPPPQPPPP 199 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PPP PPP P P PP P Sbjct: 176 TQPPPPPPPPPPLPPPPPP 194 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P P PP P Sbjct: 185 PPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PP P PPP PPP PP Sbjct: 179 PPPPPPPPPLPPPPPPQPPPPPP 201 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 183 PPPPPLPPPPPPQPPPPP 200 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPP 780 T P PP PP P P P PPP Sbjct: 176 TQPPPPPPPPPPLPPPPPPQPPPPP 200 >BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 179 PPPPPPPPPLPPPPPPQP 196 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPP 201 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 180 PPPPPPPPLPPPPPPQPP 197 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P P PP P Sbjct: 184 PPPPLPPPPPPQPPPPPP 201 Score = 35.1 bits (77), Expect = 0.39 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +2 Query: 632 QXXTPPPPXPP-PXXPPPXPPXP 697 Q PPPP PP P PPP PP P Sbjct: 177 QPPPPPPPPPPLPPPPPPQPPPP 199 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PPP PPP P P PP P Sbjct: 176 TQPPPPPPPPPPLPPPPPP 194 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P P PP P Sbjct: 185 PPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PP P PPP PPP PP Sbjct: 179 PPPPPPPPPLPPPPPPQPPPPPP 201 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 183 PPPPPLPPPPPPQPPPPP 200 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPP 780 T P PP PP P P P PPP Sbjct: 176 TQPPPPPPPPPPLPPPPPPQPPPPP 200 >BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. Length = 795 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 120 PPPPPPPPPLPPPPPPQP 137 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 119 PPPPPPPPPPLPPPPPPQPPPPPP 142 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 121 PPPPPPPPLPPPPPPQPP 138 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P P PP P Sbjct: 125 PPPPLPPPPPPQPPPPPP 142 Score = 35.1 bits (77), Expect = 0.39 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +2 Query: 632 QXXTPPPPXPP-PXXPPPXPPXP 697 Q PPPP PP P PPP PP P Sbjct: 118 QPPPPPPPPPPLPPPPPPQPPPP 140 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PPP PPP P P PP P Sbjct: 117 TQPPPPPPPPPPLPPPPPP 135 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P P PP P Sbjct: 126 PPPLPPPPPPQPPPPPPQSLGPPGRPNP 153 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PP P PPP PPP PP Sbjct: 120 PPPPPPPPPLPPPPPPQPPPPPP 142 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 124 PPPPPLPPPPPPQPPPPP 141 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPP 780 T P PP PP P P P PPP Sbjct: 117 TQPPPPPPPPPPLPPPPPPQPPPPP 141 >BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 38.7 bits (86), Expect = 0.032 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP + PPPP PP PPP PP P Sbjct: 38 RRPGQRRPPPPPPPPPLPPPPPPPPLP 64 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 50 PPPPLPPPPPPPPLPPLP 67 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPP 777 PP PP PP PP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 >AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. Length = 281 Score = 38.7 bits (86), Expect = 0.032 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP + PPPP PP PPP PP P Sbjct: 38 RRPGQRRPPPPPPPPPLPPPPPPPPLP 64 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 50 PPPPLPPPPPPPPLPPLP 67 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPP 777 PP PP PP PP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 >AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. Length = 281 Score = 38.7 bits (86), Expect = 0.032 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP + PPPP PP PPP PP P Sbjct: 38 RRPGQRRPPPPPPPPPLPPPPPPPPLP 64 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 50 PPPPLPPPPPPPPLPPLP 67 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPP 777 PP PP PP PP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 >AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341 protein. Length = 847 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 179 PPPPPPPPPLPPPPPPQP 196 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 178 PPPPPPPPPPLPPPPPPQPPPPPP 201 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 180 PPPPPPPPLPPPPPPQPP 197 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P P PP P Sbjct: 184 PPPPLPPPPPPQPPPPPP 201 Score = 35.1 bits (77), Expect = 0.39 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +2 Query: 632 QXXTPPPPXPP-PXXPPPXPPXP 697 Q PPPP PP P PPP PP P Sbjct: 177 QPPPPPPPPPPLPPPPPPQPPPP 199 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PPP PPP P P PP P Sbjct: 176 TQPPPPPPPPPPLPPPPPP 194 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P P PP P Sbjct: 185 PPPLPPPPPPQPPPPPPQSLGPPGRPNP 212 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PP P PPP PPP PP Sbjct: 179 PPPPPPPPPLPPPPPPQPPPPPP 201 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 183 PPPPPLPPPPPPQPPPPP 200 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPP 780 T P PP PP P P P PPP Sbjct: 176 TQPPPPPPPPPPLPPPPPPQPPPPP 200 >AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens cDNA FLJ40628 fis, clone THYMU2014204, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN. ). Length = 209 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 65 PPPPPPPPPPPPPPPPPP 82 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 66 PPPPPPPPPPPPPPPPPP 83 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 67 PPPPPPPPPPPPPPPPPP 84 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPP 682 P PPPP PPP PPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPP 84 Score = 31.1 bits (67), Expect = 6.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 65 PPPPPPPPPPPPPPPPP----PPP 84 >AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. Length = 127 Score = 38.7 bits (86), Expect = 0.032 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP + PPPP PP PPP PP P Sbjct: 38 RRPGQRRPPPPPPPPPLPPPPPPPPLP 64 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 50 PPPPLPPPPPPPPLPPLP 67 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPP 777 PP PP PP PP P P PP Sbjct: 48 PPPPPPLPPPPPPPPLPPLPLPP 70 >AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. Length = 830 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 660 PPPPPPPPPPPPPPPPPP 677 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 661 PPPPPPPPPPPPPPPPPP 678 Score = 38.7 bits (86), Expect = 0.032 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 662 PPPPPPPPPPPPPPPPPP 679 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPP 682 P PPPP PPP PPP Sbjct: 660 PPPPPPPPPPPPPPPPPPPP 679 Score = 31.1 bits (67), Expect = 6.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 660 PPPPPPPPPPPPPPPPP----PPP 679 >AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ).). Length = 232 Score = 38.3 bits (85), Expect = 0.042 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 RP PPPP P P PPP PP P Sbjct: 156 RPPPSPPPPPPPPPSPLPPPPPPPPP 181 Score = 36.3 bits (80), Expect = 0.17 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 R +P PPPP PPP PP PP P Sbjct: 149 RPPAAQPRPPPSPPPPPPPPPSPLPPPPPPP 179 Score = 36.3 bits (80), Expect = 0.17 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 157 PPPSPPPPPPPPPSPLPPPPPPPP 180 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P P PPP PP P Sbjct: 159 PSPPPPPPPPPSPLPPPPPPPPPTP 183 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP PP PP P P PPP P Sbjct: 156 RPPPSPPPPPPPPPSPLPPPPPPPP 180 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 RP P PPP PPP PP P Sbjct: 144 RPLPPRPPAAQPRPPPSPPPPPPPPP 169 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P PPP P Sbjct: 155 PRPPPSPPPPPPPPPSPLPPPPPPPPP 181 >U88666-1|AAC05299.1| 686|Homo sapiens serine kinase SRPK2 protein. Length = 686 Score = 37.5 bits (83), Expect = 0.073 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 K P PPPP PPP P P PP P Sbjct: 19 KAPLVPPPPPPPPPPPPPLPDPTPPEP 45 Score = 36.7 bits (81), Expect = 0.13 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP Q P P PPP PPP PP P Sbjct: 12 ERPEPQQKAPLVPPPPPPPPPPPPPLP 38 >BC068547-1|AAH68547.1| 688|Homo sapiens SRPK2 protein protein. Length = 688 Score = 37.5 bits (83), Expect = 0.073 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 K P PPPP PPP P P PP P Sbjct: 19 KAPLVPPPPPPPPPPPPPLPDPTPPEP 45 Score = 36.7 bits (81), Expect = 0.13 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP Q P P PPP PPP PP P Sbjct: 12 ERPEPQQKAPLVPPPPPPPPPPPPPLP 38 >BC035214-1|AAH35214.1| 688|Homo sapiens SFRS protein kinase 2 protein. Length = 688 Score = 37.5 bits (83), Expect = 0.073 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 K P PPPP PPP P P PP P Sbjct: 19 KAPLVPPPPPPPPPPPPPLPDPTPPEP 45 Score = 36.7 bits (81), Expect = 0.13 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP Q P P PPP PPP PP P Sbjct: 12 ERPEPQQKAPLVPPPPPPPPPPPPPLP 38 >AY354201-1|AAQ63886.1| 546|Homo sapiens SFRS protein kinase 2 isoform c protein. Length = 546 Score = 37.5 bits (83), Expect = 0.073 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 K P PPPP PPP P P PP P Sbjct: 19 KAPLVPPPPPPPPPPPPPLPDPTPPEP 45 Score = 36.7 bits (81), Expect = 0.13 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 +RP Q P P PPP PPP PP P Sbjct: 12 ERPEPQQKAPLVPPPPPPPPPPPPPLP 38 >AC005070-2|AAC29140.1| 675|Homo sapiens serine kinase SRPK2 protein. Length = 675 Score = 37.5 bits (83), Expect = 0.073 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 K P PPPP PPP P P PP P Sbjct: 6 KAPLVPPPPPPPPPPPPPLPDPTPPEP 32 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q P P PPP PPP PP P Sbjct: 1 PEPQQKAPLVPPPPPPPPPPPPPLP 25 >AC005070-1|AAC29141.1| 675|Homo sapiens WUGSC:H_RG152G17.1a protein. Length = 675 Score = 37.5 bits (83), Expect = 0.073 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 K P PPPP PPP P P PP P Sbjct: 6 KAPLVPPPPPPPPPPPPPLPDPTPPEP 32 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q P P PPP PPP PP P Sbjct: 1 PEPQQKAPLVPPPPPPPPPPPPPLP 25 >D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. Length = 567 Score = 30.3 bits (65), Expect(2) = 0.092 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 641 TPPPPXPPPXXPP 679 TPPPP PPP PP Sbjct: 355 TPPPPVPPPPPPP 367 Score = 25.8 bits (54), Expect(2) = 0.092 Identities = 13/48 (27%), Positives = 13/48 (27%) Frame = +2 Query: 653 PXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 P PPP PP P P PPP PP Sbjct: 392 PAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPP 439 >BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 30.3 bits (65), Expect(2) = 0.092 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 641 TPPPPXPPPXXPP 679 TPPPP PPP PP Sbjct: 347 TPPPPVPPPPPPP 359 Score = 25.8 bits (54), Expect(2) = 0.092 Identities = 13/48 (27%), Positives = 13/48 (27%) Frame = +2 Query: 653 PXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 P PPP PP P P PPP PP Sbjct: 384 PAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPP 431 >AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 30.3 bits (65), Expect(2) = 0.092 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 641 TPPPPXPPPXXPP 679 TPPPP PPP PP Sbjct: 347 TPPPPVPPPPPPP 359 Score = 25.8 bits (54), Expect(2) = 0.092 Identities = 13/48 (27%), Positives = 13/48 (27%) Frame = +2 Query: 653 PXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 P PPP PP P P PPP PP Sbjct: 384 PAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPP 431 >AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. Length = 559 Score = 30.3 bits (65), Expect(2) = 0.092 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 641 TPPPPXPPPXXPP 679 TPPPP PPP PP Sbjct: 347 TPPPPVPPPPPPP 359 Score = 25.8 bits (54), Expect(2) = 0.092 Identities = 13/48 (27%), Positives = 13/48 (27%) Frame = +2 Query: 653 PXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 P PPP PP P P PPP PP Sbjct: 384 PAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEVQGLPPPPPPPP 431 >AK095189-1|BAC04495.1| 634|Homo sapiens protein ( Homo sapiens cDNA FLJ37870 fis, clone BRSSN2017682, highly similar to Mus musculus p300 transcriptional cofactor JMY mRNA. ). Length = 634 Score = 37.1 bits (82), Expect = 0.097 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P TPPPP PPP PPP PP P Sbjct: 450 PSPLPPTPPPPPPPP-PPPPPPPLP 473 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P P PP PPP PPP PP Sbjct: 448 PLPSPLPPTPPPPPPPPPPPPPP 470 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXP 759 TPP PP PP PP P P Sbjct: 456 TPPPPPPPPPPPPPPPLP 473 >AK027872-1|BAB55422.1| 509|Homo sapiens protein ( Homo sapiens cDNA FLJ14966 fis, clone THYRO1000034, weakly similar to TRICHOHYALIN. ). Length = 509 Score = 37.1 bits (82), Expect = 0.097 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPP 691 Q PPPP PPP PPP PP Sbjct: 265 QAAPPPPPPPPPPPPPPPPP 284 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 268 PPPPPPPPPPPPPPPPP 284 >BC065551-1|AAH65551.1| 440|Homo sapiens WAS/WASL interacting protein family, member 2 protein. Length = 440 Score = 36.7 bits (81), Expect = 0.13 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 R G P + PPPP P PPP PP P Sbjct: 347 RMHGSEPPSRGKPPPPPSRTPAGPPPPPPPP 377 Score = 31.1 bits (67), Expect = 6.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 4 PPPPPPPPGPPPP 16 Score = 30.7 bits (66), Expect = 8.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 647 PPPXPPPXXPPPXP 688 PPP PPP PPP P Sbjct: 4 PPPPPPPPGPPPPP 17 >BC035907-1|AAH35907.1| 308|Homo sapiens USP51 protein protein. Length = 308 Score = 36.7 bits (81), Expect = 0.13 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 +P PPP PPP PPP PP P Sbjct: 117 QPGLSAPPPPPARPPPPPPPPPPPAP 142 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 R Q PP PP PPP PP P Sbjct: 113 RSRSQPGLSAPPPPPARPPPPPPPPP 138 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP PPP P P P Sbjct: 123 PPPPPARPPPPPPPPPPPAPRP 144 Score = 30.7 bits (66), Expect = 8.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXP 759 PP +PP PP PP P P Sbjct: 126 PPARPPPPPPPPPPPAP 142 >AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific proteinase 51 protein. Length = 711 Score = 36.7 bits (81), Expect = 0.13 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 +P PPP PPP PPP PP P Sbjct: 117 QPGLSAPPPPPARPPPPPPPPPPPAP 142 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 R Q PP PP PPP PP P Sbjct: 113 RSRSQPGLSAPPPPPARPPPPPPPPP 138 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP PPP P P P Sbjct: 123 PPPPPARPPPPPPPPPPPAPRP 144 Score = 30.7 bits (66), Expect = 8.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXP 759 PP +PP PP PP P P Sbjct: 126 PPARPPPPPPPPPPPAP 142 >AJ431177-1|CAD24007.1| 440|Homo sapiens WIRE protein protein. Length = 440 Score = 36.7 bits (81), Expect = 0.13 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 R G P + PPPP P PPP PP P Sbjct: 347 RMHGSEPPSRGKPPPPPSRTPAGPPPPPPPP 377 Score = 31.1 bits (67), Expect = 6.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 4 PPPPPPPPGPPPP 16 Score = 30.7 bits (66), Expect = 8.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 647 PPPXPPPXXPPPXP 688 PPP PPP PPP P Sbjct: 4 PPPPPPPPGPPPPP 17 >AB043786-1|BAB85113.1| 440|Homo sapiens WICH protein. Length = 440 Score = 36.7 bits (81), Expect = 0.13 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 R G P + PPPP P PPP PP P Sbjct: 347 RMHGSEPPSRGKPPPPPSRTPAGPPPPPPPP 377 Score = 31.1 bits (67), Expect = 6.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 4 PPPPPPPPGPPPP 16 Score = 30.7 bits (66), Expect = 8.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 647 PPPXPPPXXPPPXP 688 PPP PPP PPP P Sbjct: 4 PPPPPPPPGPPPPP 17 >D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. Length = 974 Score = 36.3 bits (80), Expect = 0.17 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PPP PP Sbjct: 468 PPPPPPPPPPPPPLPP 483 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 464 PPPHPPPPPPPPPPPPP 480 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PP P PPP PPP PP P Sbjct: 465 PPHPPPPPPPPPPPPPLP 482 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 464 PPPHPPPPPPPPPPPP 479 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PP P P Sbjct: 464 PPPHPPPPPPPPPPPPPLPPGQPVP 488 >BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1 protein. Length = 1099 Score = 36.3 bits (80), Expect = 0.17 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PPP PP Sbjct: 593 PPPPPPPPPPPPPLPP 608 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 589 PPPHPPPPPPPPPPPPP 605 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PP P PPP PPP PP P Sbjct: 590 PPHPPPPPPPPPPPPPLP 607 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 589 PPPHPPPPPPPPPPPP 604 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PP P P Sbjct: 589 PPPHPPPPPPPPPPPPPLPPGQPVP 613 >AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. Length = 784 Score = 36.3 bits (80), Expect = 0.17 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PPP PP Sbjct: 593 PPPPPPPPPPPPPLPP 608 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 589 PPPHPPPPPPPPPPPPP 605 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PP P PPP PPP PP P Sbjct: 590 PPHPPPPPPPPPPPPPLP 607 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 589 PPPHPPPPPPPPPPPP 604 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PP P P Sbjct: 589 PPPHPPPPPPPPPPPPPLPPGQPVP 613 >AB183864-1|BAD86792.1| 1271|Homo sapiens diacylglycerol kinase kappa protein. Length = 1271 Score = 36.3 bits (80), Expect = 0.17 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 G++P + PPPP PPP PP PP P Sbjct: 17 GEQPA-ESPEPPPPWPPPPPPPAPPPAP 43 >BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 protein. Length = 1542 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 1469 PPPPPPPLPPPPPPPLP 1485 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPPP 1489 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 1472 PPPPLPPPP-PPPLPPPP 1488 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 P PP PPP PPP PP Sbjct: 1467 PLPPPPPPPLPPPPPP 1482 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PPP P P Sbjct: 1470 PPPPPPLPPPPPPPLPPPPPLPKTP 1494 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PP P PPP PP PP P Sbjct: 1466 PPLPPPPPPPLPPPPPPP 1483 >BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. Length = 1081 Score = 35.9 bits (79), Expect = 0.22 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXP 688 K+P + TPPPP PPP PPP P Sbjct: 322 KKP--EKVTPPPPPPPPPPPPPPP 343 >BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 35.9 bits (79), Expect = 0.22 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q PP P PPP PPP PP Sbjct: 398 PPSQIQAPPMPGPPPLGPPPAPP 420 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +1 Query: 709 PPXKPPXXPPXPP---KPXPXHNXPPPXXXP 792 PP +PP PP PP P P PPP P Sbjct: 463 PPGRPPGPPPGPPPGLPPGPPPRGPPPRLPP 493 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P PPP Sbjct: 471 PPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 482 PPPRGPPPRLPPPAPP 497 Score = 32.3 bits (70), Expect = 2.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 614 GKRPXXQXXTPP--PPXPPPXXPPPXPPXP 697 G+ P PP PP PPP PPP P P Sbjct: 465 GRPPGPPPGPPPGLPPGPPPRGPPPRLPPP 494 >BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. Length = 400 Score = 35.9 bits (79), Expect = 0.22 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q PP P PPP PPP PP Sbjct: 157 PPSQIQAPPMPGPPPLGPPPAPP 179 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +1 Query: 709 PPXKPPXXPPXPP---KPXPXHNXPPPXXXP 792 PP +PP PP PP P P PPP P Sbjct: 222 PPGRPPGPPPGPPPGLPPGPPPRGPPPRLPP 252 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P PPP Sbjct: 230 PPGPPPGLPPGPPPRGPPPRLPPP 253 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 241 PPPRGPPPRLPPPAPP 256 Score = 32.3 bits (70), Expect = 2.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 614 GKRPXXQXXTPP--PPXPPPXXPPPXPPXP 697 G+ P PP PP PPP PPP P P Sbjct: 224 GRPPGPPPGPPPGLPPGPPPRGPPPRLPPP 253 >BC005174-1|AAH05174.1| 282|Homo sapiens activating transcription factor 5 protein. Length = 282 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 123 PPPSPPPLPPPPLPPAP 139 >BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 35.9 bits (79), Expect = 0.22 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q PP P PPP PPP PP Sbjct: 398 PPSQIQAPPMPGPPPLGPPPAPP 420 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +1 Query: 709 PPXKPPXXPPXPP---KPXPXHNXPPPXXXP 792 PP +PP PP PP P P PPP P Sbjct: 463 PPGRPPGPPPGPPPGLPPGPPPRGPPPRLPP 493 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P PPP Sbjct: 471 PPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 482 PPPRGPPPRLPPPAPP 497 Score = 32.3 bits (70), Expect = 2.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 614 GKRPXXQXXTPP--PPXPPPXXPPPXPPXP 697 G+ P PP PP PPP PPP P P Sbjct: 465 GRPPGPPPGPPPGLPPGPPPRGPPPRLPPP 494 >AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens cDNA FLJ46838 fis, clone UTERU2035926. ). Length = 121 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 88 PPPPPPPPPPPPLPPPP 104 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPP 682 P PPPP PPP PPP Sbjct: 85 PGLPPPPPPPPPPPPLPPPP 104 >AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens cDNA FLJ33811 fis, clone CTONG2002095. ). Length = 1077 Score = 35.9 bits (79), Expect = 0.22 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXP 688 K+P + TPPPP PPP PPP P Sbjct: 322 KKP--EKVTPPPPPPPPPPPPPPP 343 >AF305687-1|AAG22558.1| 282|Homo sapiens transcription factor ATFx protein. Length = 282 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 123 PPPSPPPLPPPPLPPAP 139 >AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding protein SNP70 protein. Length = 641 Score = 35.9 bits (79), Expect = 0.22 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q PP P PPP PPP PP Sbjct: 398 PPSQIQAPPMPGPPPLGPPPAPP 420 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +1 Query: 709 PPXKPPXXPPXPP---KPXPXHNXPPPXXXP 792 PP +PP PP PP P P PPP P Sbjct: 463 PPGRPPGPPPGPPPGLPPGPPPRGPPPRLPP 493 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P PPP Sbjct: 471 PPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 482 PPPRGPPPRLPPPAPP 497 Score = 32.3 bits (70), Expect = 2.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 614 GKRPXXQXXTPP--PPXPPPXXPPPXPPXP 697 G+ P PP PP PPP PPP P P Sbjct: 465 GRPPGPPPGPPPGLPPGPPPRGPPPRLPPP 494 >AB073613-1|BAD38650.1| 282|Homo sapiens activating transcription factor 5 protein. Length = 282 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 123 PPPSPPPLPPPPLPPAP 139 >AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein NpwBP protein. Length = 641 Score = 35.9 bits (79), Expect = 0.22 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q PP P PPP PPP PP Sbjct: 398 PPSQIQAPPMPGPPPLGPPPAPP 420 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +1 Query: 709 PPXKPPXXPPXPP---KPXPXHNXPPPXXXP 792 PP +PP PP PP P P PPP P Sbjct: 463 PPGRPPGPPPGPPPGLPPGPPPRGPPPRLPP 493 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P PPP Sbjct: 471 PPGPPPGLPPGPPPRGPPPRLPPP 494 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 482 PPPRGPPPRLPPPAPP 497 Score = 32.3 bits (70), Expect = 2.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 614 GKRPXXQXXTPP--PPXPPPXXPPPXPPXP 697 G+ P PP PP PPP PPP P P Sbjct: 465 GRPPGPPPGPPPGLPPGPPPRGPPPRLPPP 494 >AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SEB) protein. Length = 1542 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 1469 PPPPPPPLPPPPPPPLP 1485 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 1466 PPLPPPPPPPLPPPPPPPLPPPPP 1489 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 1472 PPPPLPPPP-PPPLPPPP 1488 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 P PP PPP PPP PP Sbjct: 1467 PLPPPPPPPLPPPPPP 1482 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PPP P P Sbjct: 1470 PPPPPPLPPPPPPPLPPPPPLPKTP 1494 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PP P PPP PP PP P Sbjct: 1466 PPLPPPPPPPLPPPPPPP 1483 >AB021663-1|BAA78477.2| 282|Homo sapiens leucine-zipper protein protein. Length = 282 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 123 PPPSPPPLPPPPLPPAP 139 >AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. Length = 1605 Score = 35.9 bits (79), Expect = 0.22 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 1532 PPPPPPPLPPPPPPPLP 1548 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 1529 PPLPPPPPPPLPPPPPPPLPPPPP 1552 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 1535 PPPPLPPPP-PPPLPPPP 1551 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 P PP PPP PPP PP Sbjct: 1530 PLPPPPPPPLPPPPPP 1545 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PPP P P Sbjct: 1533 PPPPPPLPPPPPPPLPPPPPLPKTP 1557 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PP P PPP PP PP P Sbjct: 1529 PPLPPPPPPPLPPPPPPP 1546 >X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. Length = 421 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 345 PPPPSPPPPPPPPASPLP 362 Score = 35.1 bits (77), Expect = 0.39 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPP--PXXPPPXPPXP 697 R +P PPPP PP P PPP PP P Sbjct: 338 RPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPP 370 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P P PPP Sbjct: 346 PPPSPPPPPPPPASPLPPPPPPPP 369 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P PPP P Sbjct: 344 PPPPPSPPPPPPPPASPLPPPPPPPPP 370 >X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. Length = 421 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 345 PPPPSPPPPPPPPASPLP 362 Score = 35.1 bits (77), Expect = 0.39 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPP--PXXPPPXPPXP 697 R +P PPPP PP P PPP PP P Sbjct: 338 RPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPP 370 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P P PPP Sbjct: 346 PPPSPPPPPPPPASPLPPPPPPPP 369 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P PPP P Sbjct: 344 PPPPPSPPPPPPPPASPLPPPPPPPPP 370 >M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. Length = 184 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 108 PPPPSPPPPPPPPASPLP 125 Score = 35.1 bits (77), Expect = 0.39 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPP--PXXPPPXPPXP 697 R +P PPPP PP P PPP PP P Sbjct: 101 RPPAAQPPPPPSPPPPPPPPASPLPPPPPPPPP 133 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P P PPP Sbjct: 109 PPPSPPPPPPPPASPLPPPPPPPP 132 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P PPP P Sbjct: 107 PPPPPSPPPPPPPPASPLPPPPPPPPP 133 >D10250-1|BAA01095.1| 2783|Homo sapiens alpha-fetoprotein enhancer binding protein protein. Length = 2783 Score = 35.5 bits (78), Expect = 0.30 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXC 631 G GG GGG GGG GGGG C Sbjct: 2590 GSGGGGGGGGGGGGGGGGSYHC 2611 Score = 33.9 bits (74), Expect = 0.90 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 RP PPPP PPP P PP P Sbjct: 1119 RPQTPEPPPPPPPPPPPPLPAAPPQP 1144 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 2587 GGGGSGGGGGGGGGGGGG 2604 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 2585 GGGGGGSGGGGGGGGG 2600 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 2585 GGGGGGSGGGGGGGGGGG 2602 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 2586 GGGGGSGGGGGGGGGGGG 2603 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 2588 GGGSGGGGGGGGGGGGGG 2605 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 2589 GGSGGGGGGGGGGGGGGG 2606 >AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. Length = 1272 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXP 688 TPPPP PPP PPP P Sbjct: 607 TPPPPPPPPPPPPPLP 622 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P T PPP PPP PPP PP P Sbjct: 600 PAPGDSTTPPPPPPP--PPPPPPLP 622 >AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens cDNA FLJ13283 fis, clone OVARC1001113, highly similar to Homo sapiens diaphanous 1 (HDIA1) mRNA. ). Length = 533 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXP 688 TPPPP PPP PPP P Sbjct: 374 TPPPPPPPPPPPPPLP 389 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P T PPP PPP PPP PP P Sbjct: 367 PAPGDSTTPPPPPPP--PPPPPPLP 389 >AJ400879-3|CAC35389.1| 1214|Homo sapiens KIAA0298 protein protein. Length = 1214 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q PPPP P P PPP PP P Sbjct: 452 QQQLPPPPPPLPHPPPPLPPPP 473 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXP 688 TPPPP PPP PPP P Sbjct: 598 TPPPPPPPPPPPPPLP 613 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P T PPP PPP PPP PP P Sbjct: 591 PAPGDSTTPPPPPPP--PPPPPPLP 613 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPP 780 TPP PP PP PP P PPP Sbjct: 598 TPPPPPPPPPPPPPLPGGTAISPPP 622 Score = 30.7 bits (66), Expect = 8.4 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXP 793 PPPP P PP PP P T PPP P Sbjct: 588 PPPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPPLSGDATIPPPPPLP 637 >AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant protein. Length = 1299 Score = 35.5 bits (78), Expect = 0.30 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXP 688 TPPPP PPP PPP P Sbjct: 634 TPPPPPPPPPPPPPLP 649 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P T PPP PPP PPP PP P Sbjct: 627 PAPGDSTTPPPPPPP--PPPPPPLP 649 >AB002296-1|BAA20758.2| 901|Homo sapiens KIAA0298 protein protein. Length = 901 Score = 35.5 bits (78), Expect = 0.30 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q PPPP P P PPP PP P Sbjct: 487 QQQLPPPPPPLPHPPPPLPPPP 508 >Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for acrosin (EC 3.4.21.10). ). Length = 421 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 RP PPPP P PPP PP P Sbjct: 345 RPPPSPPPPPPPPASPLPPPPPPPPP 370 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P P PPP Sbjct: 346 PPPSPPPPPPPPASPLPPPPPPPP 369 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P PPP P Sbjct: 344 PRPPPSPPPPPPPPASPLPPPPPPPPP 370 >X70944-1|CAA50283.1| 707|Homo sapiens PTB-associated splicing factor protein. Length = 707 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PPP PPP PPP P P Sbjct: 65 PHQQQQQPPPQQPPPQQPPPHQPPP 89 >D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. Length = 505 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 375 PPPPPPPPPGPPPPPGLP 392 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 373 PPPPPPPP--PPPGPPPP 388 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 374 PPPPPPPPPPGPPPPP 389 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PP PP P Sbjct: 373 PPPPPPPPPPPGPPPPP 389 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 277 PPPPPPSRGGPPPPPPPP 294 >CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. Length = 421 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 RP PPPP P PPP PP P Sbjct: 345 RPPPSPPPPPPPPASPLPPPPPPPPP 370 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P P PPP Sbjct: 346 PPPSPPPPPPPPASPLPPPPPPPP 369 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P PPP P Sbjct: 344 PRPPPSPPPPPPPPASPLPPPPPPPPP 370 >BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrome-like protein. Length = 505 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 375 PPPPPPPPPGPPPPPGLP 392 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 373 PPPPPPPP--PPPGPPPP 388 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 374 PPPPPPPPPPGPPPPP 389 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PP PP P Sbjct: 373 PPPPPPPPPPPGPPPPP 389 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P HN PP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPP 300 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 277 PPPPPPSRGGPPPPPPPP 294 Score = 31.1 bits (67), Expect = 6.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP P P PP P P ++ PPP Sbjct: 278 PPPPPSRGGPPPPPPPPHNSGPPP 301 >BC051192-1|AAH51192.1| 707|Homo sapiens splicing factor proline/glutamine-rich (polypyrimidine tract binding protein as protein. Length = 707 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PPP PPP PPP P P Sbjct: 65 PHQQQQQPPPQQPPPQQPPPHQPPP 89 >BC027708-1|AAH27708.1| 525|Homo sapiens SFPQ protein protein. Length = 525 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PPP PPP PPP P P Sbjct: 65 PHQQQQQPPPQQPPPQQPPPHQPPP 89 >BC008829-1|AAH08829.1| 355|Homo sapiens SHOX2 protein protein. Length = 355 Score = 35.1 bits (77), Expect = 0.39 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GGG GGGGV Sbjct: 60 GGGGGGGGGGGGGGGGGGV 78 Score = 33.9 bits (74), Expect = 0.90 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV-XXCXXGRFP 613 G GG GGG GGG GGGG GR P Sbjct: 65 GGGGGGGGGGGGGVGGGGAGGGAGGGRSP 93 >BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IMAGE:3946309) protein. Length = 39 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP PP P Sbjct: 15 PPPPLRPPPPPPPLPPPP 32 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 13 PPPPPPLRPPPPPPPLPP--PPPP 34 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PP PPP PP P Sbjct: 13 PPPPPPLRPPPPPPPLP 29 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%), Gaps = 2/18 (11%) Frame = +2 Query: 644 PP--PPXPPPXXPPPXPP 691 PP PP PPP PPP PP Sbjct: 17 PPLRPPPPPPPLPPPPPP 34 >AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. Length = 505 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 375 PPPPPPPPPGPPPPPGLP 392 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 373 PPPPPPPP--PPPGPPPP 388 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 374 PPPPPPPPPPGPPPPP 389 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PP PP P Sbjct: 373 PPPPPPPPPPPGPPPPP 389 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P HN PP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPP 300 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 277 PPPPPPSRGGPPPPPPPP 294 Score = 31.1 bits (67), Expect = 6.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP P P PP P P ++ PPP Sbjct: 278 PPPPPSRGGPPPPPPPPHNSGPPP 301 >AL590434-2|CAI12467.1| 707|Homo sapiens splicing factor proline/glutamine-rich (polypyrimidine tract binding protein as protein. Length = 707 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PPP PPP PPP P P Sbjct: 65 PHQQQQQPPPQQPPPQQPPPHQPPP 89 >AL590383-2|CAH71374.2| 2279|Homo sapiens zinc finger protein 318 protein. Length = 2279 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 1442 PPPPPPPPPPPPPPPVIP 1459 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 1444 PPPPPPPPPPPPPVIPHP 1461 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPP 691 Q PPPP PPP PPP PP Sbjct: 1439 QILPPPPPPPPP--PPPPPP 1456 >AL583834-6|CAI14459.2| 2279|Homo sapiens zinc finger protein 318 protein. Length = 2279 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 1442 PPPPPPPPPPPPPPPVIP 1459 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 1444 PPPPPPPPPPPPPVIPHP 1461 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPP 691 Q PPPP PPP PPP PP Sbjct: 1439 QILPPPPPPPPP--PPPPPP 1456 >AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. Length = 1766 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PP P PPP PPP PP P Sbjct: 1168 PPVPIPPPPPPPPLPPPP 1185 Score = 30.7 bits (66), Expect = 8.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 647 PPPXPPPXXPPPXP 688 PPP PPP PPP P Sbjct: 1173 PPPPPPPPLPPPPP 1186 >AF121141-1|AAD17298.1| 2099|Homo sapiens endocrine regulator protein. Length = 2099 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 1262 PPPPPPPPPPPPPPPVIP 1279 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 1264 PPPPPPPPPPPPPVIPHP 1281 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPP 691 Q PPPP PPP PPP PP Sbjct: 1259 QILPPPPPPPPP--PPPPPP 1276 >AF090114-1|AAD47387.1| 2099|Homo sapiens unknown protein. Length = 2099 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 1262 PPPPPPPPPPPPPPPVIP 1279 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 1264 PPPPPPPPPPPPPVIPHP 1281 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPP 691 Q PPPP PPP PPP PP Sbjct: 1259 QILPPPPPPPPP--PPPPPP 1276 >AC007956-2|AAF61275.1| 1822|Homo sapiens unknown protein. Length = 1822 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PP P PPP PPP PP P Sbjct: 1347 PPVPIPPPPPPPPLPPPP 1364 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q TPPP PPP P PP Sbjct: 427 PHIQATTPPPGIPPPGVPQGIPP 449 Score = 30.7 bits (66), Expect = 8.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 647 PPPXPPPXXPPPXP 688 PPP PPP PPP P Sbjct: 1352 PPPPPPPPLPPPPP 1365 >AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. Length = 505 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 375 PPPPPPPPPGPPPPPGLP 392 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 373 PPPPPPPP--PPPGPPPP 388 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 374 PPPPPPPPPPGPPPPP 389 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PP PP P Sbjct: 373 PPPPPPPPPPPGPPPPP 389 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP P P HN PP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPP 300 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 277 PPPPPPSRGGPPPPPPPP 294 Score = 31.1 bits (67), Expect = 6.4 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP P P PP P P ++ PPP Sbjct: 278 PPPPPSRGGPPPPPPPPHNSGPPP 301 >AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. Length = 1134 Score = 35.1 bits (77), Expect = 0.39 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP P P PP P Sbjct: 949 PSEARAPPPPPPPPPHPPLPPPPLP 973 Score = 35.1 bits (77), Expect = 0.39 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP PP P Sbjct: 959 PPPPPHPPLPPPPLPPPP 976 Score = 33.9 bits (74), Expect = 0.90 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P + PPP P Sbjct: 974 PPPLPLRLPPLPPPPLPRPHPPPPPPLP 1001 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXP---PPXPPXP 697 P PPPP PPP P PP PP P Sbjct: 961 PPPHPPLPPPPLPPPPLPLRLPPLPPPP 988 Score = 31.1 bits (67), Expect = 6.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 957 PPPPPPPHPPLPPPPLP----PPP 976 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P P PPP PP P Sbjct: 985 PPPPLPRP-HPPPPPPLP 1001 >EF055487-1|ABK56022.1| 456|Homo sapiens shootin1 protein. Length = 456 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 353 PPPPPPPPPLPPP-PPNP 369 >DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated potassium channel 2 protein. Length = 112 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G P PPPP PP PPP PP Sbjct: 15 GATPAPGPPPPPPPAPPQQQPPPPPP 40 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 +P P PP PP P P PPP P Sbjct: 13 SPGATPAPGPPPPPPPAPPQQQPPPPPPP 41 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 24 PPPPPAPPQQQPPPPPPP 41 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q PPPP PP P P PP Sbjct: 30 PPQQQPPPPPPPAPPPGPGPAPP 52 Score = 31.9 bits (69), Expect = 3.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPP 691 R G RP P P PPP PPP PP Sbjct: 4 RGGGGRPGESPGATPAPGPPP-PPPPAPP 31 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP P P PPP P Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAPPPGPGP 49 >BC032303-1|AAH32303.1| 558|Homo sapiens KIAA1598 protein protein. Length = 558 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 353 PPPPPPPPPLPPP-PPNP 369 >BC008669-1|AAH08669.1| 360|Homo sapiens PRR11 protein protein. Length = 360 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 185 PPPPPPPPLPPPPPPLAP 202 >AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens cDNA FLJ34364 fis, clone FEBRA2015175, weakly similar to Mus musculus (clone E5.53) Huntington disease (hdh) gene. ). Length = 749 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PP PP P Sbjct: 659 PPPPPPPPLALPPPPPPP 676 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP PP P Sbjct: 660 PPPPPPPLALPPPPPPPP 677 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP PPP PPP P Sbjct: 663 PPPPLALPPPPPPPPPLPPPLP 684 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 3/21 (14%) Frame = +2 Query: 644 PPPPXPPPXXPP---PXPPXP 697 PPPP PPP PP P PP P Sbjct: 655 PPPPPPPPPPPPLALPPPPPP 675 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P PPP P Sbjct: 655 PPPPPPPPPPPPLALPPPPPPPPPLPP 681 >AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens cDNA FLJ31888 fis, clone NT2RP7003055. ). Length = 568 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PP PP P Sbjct: 341 PPPPPPPPLALPPPPPPP 358 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP PP P Sbjct: 342 PPPPPPPLALPPPPPPPP 359 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP PPP PPP P Sbjct: 345 PPPPLALPPPPPPPPPLPPPLP 366 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 3/21 (14%) Frame = +2 Query: 644 PPPPXPPPXXPP---PXPPXP 697 PPPP PPP PP P PP P Sbjct: 337 PPPPPPPPPPPPLALPPPPPP 357 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P PPP P Sbjct: 337 PPPPPPPPPPPPLALPPPPPPPPPLPP 363 >AK001891-1|BAA91964.1| 360|Homo sapiens protein ( Homo sapiens cDNA FLJ11029 fis, clone PLACE1004156. ). Length = 360 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 185 PPPPPPPPLPPPPPPLAP 202 >AK000296-1|BAA91064.1| 210|Homo sapiens protein ( Homo sapiens cDNA FLJ20289 fis, clone HEP04492. ). Length = 210 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 35 PPPPPPPPLPPPPPPLAP 52 >AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 protein. Length = 889 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G P PPPP PP PPP PP Sbjct: 15 GATPAPGPPPPPPPAPPQQQPPPPPP 40 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 +P P PP PP P P PPP P Sbjct: 13 SPGATPAPGPPPPPPPAPPQQQPPPPPPP 41 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 24 PPPPPAPPQQQPPPPPPP 41 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q PPPP PP P P PP Sbjct: 30 PPQQQPPPPPPPAPPPGPGPAPP 52 Score = 31.9 bits (69), Expect = 3.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPP 691 R G RP P P PPP PPP PP Sbjct: 4 RGGGGRPGESPGATPAPGPPP-PPPPAPP 31 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP P P PPP P Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAPPPGPGP 49 >AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activated cation channel HCN2 protein. Length = 889 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G P PPPP PP PPP PP Sbjct: 15 GATPAPGPPPPPPPAPPQQQPPPPPP 40 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 +P P PP PP P P PPP P Sbjct: 13 SPGATPAPGPPPPPPPAPPQQQPPPPPPP 41 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 24 PPPPPAPPQQQPPPPPPP 41 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q PPPP PP P P PP Sbjct: 30 PPQQQPPPPPPPAPPPGPGPAPP 52 Score = 31.9 bits (69), Expect = 3.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPP 691 R G RP P P PPP PPP PP Sbjct: 4 RGGGGRPGESPGATPAPGPPP-PPPPAPP 31 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP P P PPP P Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAPPPGPGP 49 >AJ007041-1|CAB45385.1| 2715|Homo sapiens trithorax homologue 2 protein. Length = 2715 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP P PP P P + PPP P Sbjct: 404 PPLTPPAPSPPPPLPPPSTSPPPPLCPP 431 Score = 32.3 bits (70), Expect = 2.8 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +2 Query: 641 TPPPPXPPPXXPPP--XPPXP 697 TPP P PPP PPP PP P Sbjct: 407 TPPAPSPPPPLPPPSTSPPPP 427 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P PP P Sbjct: 620 PPPPAPPPPPAPSPPPAP 637 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 +PPPP PPP PP P P Sbjct: 412 SPPPPLPPPSTSPPPPLCP 430 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +2 Query: 623 PXXQXXTPP--PPXPPPXXPPPXPPXP 697 P PP PP PPP PPP P P Sbjct: 419 PPSTSPPPPLCPPPPPPVSPPPLPSPP 445 >AF186605-1|AAD56420.1| 2605|Homo sapiens MLL2 protein protein. Length = 2605 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP P PP P P + PPP P Sbjct: 294 PPLTPPAPSPPPPLPPPSTSPPPPLCPP 321 Score = 32.3 bits (70), Expect = 2.8 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +2 Query: 641 TPPPPXPPPXXPPP--XPPXP 697 TPP P PPP PPP PP P Sbjct: 297 TPPAPSPPPPLPPPSTSPPPP 317 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P PP P Sbjct: 510 PPPPAPPPPPAPSPPPAP 527 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 +PPPP PPP PP P P Sbjct: 302 SPPPPLPPPSTSPPPPLCP 320 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +2 Query: 623 PXXQXXTPP--PPXPPPXXPPPXPPXP 697 P PP PP PPP PPP P P Sbjct: 309 PPSTSPPPPLCPPPPPPVSPPPLPSPP 335 >AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activated, cyclic nucleotide-gated channel 2 protein. Length = 889 Score = 34.7 bits (76), Expect = 0.52 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXP---PPXPPXP 697 G+ P T PPP PPP P PP PP P Sbjct: 11 GESPGASPTTGPPPPPPPRPPKQQPPPPPPP 41 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPP 691 RP Q PPPP PP P P PP Sbjct: 29 RPPKQQPPPPPPPAPPPGPGPAPP 52 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 +P P PP PP P P PPP P Sbjct: 13 SPGASPTTGPPPPPPPRPPKQQPPPPPPP 41 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP P P PPP P Sbjct: 22 PPPPPPPRPPKQQPPPPPPPAPPPGPGP 49 >AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 2 protein. Length = 528 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G P PPPP PP PPP PP Sbjct: 15 GATPAPGPPPPPPPAPPQQQPPPPPP 40 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 +P P PP PP P P PPP P Sbjct: 13 SPGATPAPGPPPPPPPAPPQQQPPPPPPP 41 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 24 PPPPPAPPQQQPPPPPPP 41 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q PPPP PP P P PP Sbjct: 30 PPQQQPPPPPPPAPPPGPGPAPP 52 Score = 31.9 bits (69), Expect = 3.6 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPP 691 R G RP P P PPP PPP PP Sbjct: 4 RGGGGRPGESPGATPAPGPPP-PPPPAPP 31 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP P P PPP P Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAPPPGPGP 49 >AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. Length = 1652 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PP PP P Sbjct: 1425 PPPPPPPPLALPPPPPPP 1442 Score = 34.7 bits (76), Expect = 0.52 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP PP P Sbjct: 1426 PPPPPPPLALPPPPPPPP 1443 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP PPP PPP P Sbjct: 1429 PPPPLALPPPPPPPPPLPPPLP 1450 Score = 32.7 bits (71), Expect = 2.1 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 3/21 (14%) Frame = +2 Query: 644 PPPPXPPPXXPP---PXPPXP 697 PPPP PPP PP P PP P Sbjct: 1421 PPPPPPPPPPPPLALPPPPPP 1441 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P PPP P Sbjct: 1421 PPPPPPPPPPPPLALPPPPPPPPPLPP 1447 >AB046818-1|BAB13424.1| 446|Homo sapiens KIAA1598 protein protein. Length = 446 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 343 PPPPPPPPPLPPP-PPNP 359 >AB005297-1|BAA23647.1| 1584|Homo sapiens BAI 1 protein. Length = 1584 Score = 34.7 bits (76), Expect = 0.52 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPP--PXPPXP 697 G P PPPP PPP PP P PP P Sbjct: 1401 GGPPEAPPAQPPPPPPPPPPPPQQPLPPPP 1430 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP +PP PP PP P PPP P Sbjct: 1407 PPAQPPPPPPPPPPPPQQPLPPPPNLEP 1434 Score = 31.9 bits (69), Expect = 3.6 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q + PP PP PPP PP P Sbjct: 1394 PSRQPPSGGPPEAPPAQPPPPPPPP 1418 Score = 31.1 bits (67), Expect = 6.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P P PPP Sbjct: 1403 PPEAPPAQPPPPPPPPP----PPP 1422 >AB002344-1|BAA21572.2| 1682|Homo sapiens KIAA0346 protein. Length = 1682 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 250 PPPPLPPP-PPPPPPPLP 266 Score = 31.5 bits (68), Expect = 4.8 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +2 Query: 632 QXXTPPP-PXPPPXXPPPXPPXP 697 Q PP P PPP PPP PP P Sbjct: 240 QTGLPPGLPLPPPPLPPPPPPPP 262 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXP 688 G P PP P PPP PPP P Sbjct: 242 GLPPGLPLPPPPLPPPPPPPPPPLP 266 >AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. Length = 1709 Score = 34.7 bits (76), Expect = 0.52 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 PP PPP PPP PP P PPP PP Sbjct: 602 PPQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPP 651 Score = 34.3 bits (75), Expect = 0.68 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 P PP PP PPP PP P PPP PP Sbjct: 600 PTPPQQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPP 650 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 +PPP PP PPP PP P Sbjct: 595 SPPPAPTPPQQPPPPPPPP 613 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PP P PP PPP PP P Sbjct: 597 PPAPTPPQQPPPPPPPPP 614 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G P P P PPP PPP PP Sbjct: 593 GGSPPPAPTPPQQPPPPPPPPPPPPP 618 >AB002302-1|BAA20763.3| 2415|Homo sapiens KIAA0304 protein protein. Length = 2415 Score = 34.7 bits (76), Expect = 0.52 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP P PP P P + PPP P Sbjct: 104 PPLTPPAPSPPPPLPPPSTSPPPPLCPP 131 Score = 32.3 bits (70), Expect = 2.8 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +2 Query: 641 TPPPPXPPPXXPPP--XPPXP 697 TPP P PPP PPP PP P Sbjct: 107 TPPAPSPPPPLPPPSTSPPPP 127 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP P PP P Sbjct: 320 PPPPAPPPPPAPSPPPAP 337 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 +PPPP PPP PP P P Sbjct: 112 SPPPPLPPPSTSPPPPLCP 130 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +2 Query: 623 PXXQXXTPP--PPXPPPXXPPPXPPXP 697 P PP PP PPP PPP P P Sbjct: 119 PPSTSPPPPLCPPPPPPVSPPPLPSPP 145 >Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein (VASP) protein. Length = 380 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P PPP P Sbjct: 162 PPAPPAGGPPPPPGPPPPPGPPPPPGLP 189 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 171 PPPPGPPPPPGPPPPP 186 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 G P PPPP PP PPP PP P Sbjct: 160 GGPPAPPAGGPPPPPGPP--PPPGPPPP 185 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 172 PPPGPPPPPGPPPPPGLP 189 >X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 378 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P PPP P Sbjct: 160 PPAPPAGGPPPPPGPPPPPGPPPPPGLP 187 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 169 PPPPGPPPPPGPPPPP 184 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 G P PPPP PP PPP PP P Sbjct: 158 GGPPAPPAGGPPPPPGPP--PPPGPPPP 183 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 170 PPPGPPPPPGPPPPPGLP 187 >U47742-1|AAC50662.1| 2004|Homo sapiens monocytic leukaemia zinc finger protein protein. Length = 2004 Score = 34.3 bits (75), Expect = 0.68 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 P Q PPPP P PPP P P PPP PP Sbjct: 1644 PSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPPQQQPQQQPQPQPQQPPPPPPPQQQPP 1701 Score = 34.3 bits (75), Expect = 0.68 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +1 Query: 709 PPXKPPXXP-PXPPKPXPXHNXPPPXXXP 792 PP PP P P PP+P P PPP P Sbjct: 1651 PPPPPPQQPQPPPPQPQPAPQPPPPQQQP 1679 >BC050283-1|AAH50283.1| 499|Homo sapiens WASF3 protein protein. Length = 499 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 392 PPPPGPPP--PPPGPPGP 407 >BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P PPP P Sbjct: 162 PPAPPAGGPPPPPGPPPPPGPPPPPGLP 189 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 171 PPPPGPPPPPGPPPPP 186 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 G P PPPP PP PPP PP P Sbjct: 160 GGPPAPPAGGPPPPPGPP--PPPGPPPP 185 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 172 PPPGPPPPPGPPPPPGLP 189 >BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P PPP P Sbjct: 163 PPAPPAGGPPPPPGPPPPPGPPPPPGLP 190 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 172 PPPPGPPPPPGPPPPP 187 Score = 31.5 bits (68), Expect = 4.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 G P PPPP PP PPP PP P Sbjct: 161 GGPPAPPAGGPPPPPGPP--PPPGPPPP 186 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 173 PPPGPPPPPGPPPPPGLP 190 >BC022464-1|AAH22464.1| 459|Homo sapiens FEZ family zinc finger 2 protein. Length = 459 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGVXXC 631 GG GGG GGG GGGG C Sbjct: 102 GGGGGGGGGGGGGGGGAPVC 121 >AL163538-1|CAH72487.1| 502|Homo sapiens WAS protein family, member 3 protein. Length = 502 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 395 PPPPGPPP--PPPGPPGP 410 >AL159978-1|CAI14691.1| 502|Homo sapiens WAS protein family, member 3 protein. Length = 502 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 395 PPPPGPPP--PPPGPPGP 410 >AK001004-1|BAA91464.1| 304|Homo sapiens protein ( Homo sapiens cDNA FLJ10142 fis, clone HEMBA1003257. ). Length = 304 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGVXXC 631 GG GGG GGG GGGG C Sbjct: 102 GGGGGGGGGGGGGGGGAPVC 121 >AF454702-1|AAL51032.1| 502|Homo sapiens WAVE3 protein. Length = 502 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 395 PPPPGPPP--PPPGPPGP 410 >AF134305-1|AAD33054.1| 455|Homo sapiens Scar3 protein. Length = 455 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 348 PPPPGPPP--PPPGPPGP 363 >AB026543-1|BAA81796.1| 502|Homo sapiens WASP-family protein protein. Length = 502 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 395 PPPPGPPP--PPPGPPGP 410 >AB020707-1|BAA74923.2| 503|Homo sapiens KIAA0900 protein protein. Length = 503 Score = 34.3 bits (75), Expect = 0.68 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 396 PPPPGPPP--PPPGPPGP 411 >L32832-1|AAC14462.1| 3703|Homo sapiens zinc finger homeodomain protein protein. Length = 3703 Score = 33.9 bits (74), Expect = 0.90 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 RP PPPP PPP P PP P Sbjct: 2033 RPQTPEPPPPPPPPPPPPLPAAPPQP 2058 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 3509 GGGGSGGGGGGGGGGGGG 3526 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXC 631 G G GGG GGG GGGG C Sbjct: 3510 GGGSGGGGGGGGGGGGGGSYHC 3531 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 3507 GGGGGGSGGGGGGGGG 3522 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 3507 GGGGGGSGGGGGGGGGGG 3524 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 3508 GGGGGSGGGGGGGGGGGG 3525 >BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T P P PPP PPP PP P Sbjct: 3 TNPQPQPPPPAPPPPPPQP 21 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 P PP PP PP+P P PPP Sbjct: 7 PQPPPPAPPPPPPQPQPQPPPPPP 30 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +PP P PP P P PPP P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGP 32 Score = 32.3 bits (70), Expect = 2.8 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 620 RPXXQXXTPPPPXP-PPXXPPPXPPXP 697 +P PPPP P P PPP PP P Sbjct: 6 QPQPPPPAPPPPPPQPQPQPPPPPPGP 32 >BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T P P PPP PPP PP P Sbjct: 3 TNPQPQPPPPAPPPPPPQP 21 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 P PP PP PP+P P PPP Sbjct: 7 PQPPPPAPPPPPPQPQPQPPPPPP 30 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +PP P PP P P PPP P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGP 32 Score = 32.3 bits (70), Expect = 2.8 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 620 RPXXQXXTPPPPXP-PPXXPPPXPPXP 697 +P PPPP P P PPP PP P Sbjct: 6 QPQPPPPAPPPPPPQPQPQPPPPPPGP 32 >BC053992-1|AAH53992.1| 1312|Homo sapiens SR-related CTD-associated factor 1 protein. Length = 1312 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P +P PP PPP PP PP P Sbjct: 199 PSPSSSSPSPPPPPPPPAPPAPPAP 223 >BC032638-1|AAH32638.1| 411|Homo sapiens methyl-CpG binding domain protein 2 protein. Length = 411 Score = 33.9 bits (74), Expect = 0.90 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFP 613 G GG GGG GGG GGGG FP Sbjct: 103 GLGGDGGGCGGGGSGGGGAPRREPVPFP 130 >AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. Length = 854 Score = 33.9 bits (74), Expect = 0.90 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPP 780 TPP PP PP PP P PPP Sbjct: 429 TPPPPPPSFPPPPPPPGTQLPPPPP 453 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P P PP PPP PPP PP Sbjct: 421 PRGTIGKPTPPPPPPSFPPPPPP 443 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPP 691 TPPPP PP PPP PP Sbjct: 429 TPPPP-PPSFPPPPPPP 444 >AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. Length = 854 Score = 33.9 bits (74), Expect = 0.90 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPP 780 TPP PP PP PP P PPP Sbjct: 429 TPPPPPPSFPPPPPPPGTQLPPPPP 453 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P P PP PPP PPP PP Sbjct: 421 PRGTIGKPTPPPPPPSFPPPPPP 443 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPP 691 TPPPP PP PPP PP Sbjct: 429 TPPPP-PPSFPPPPPPP 444 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 33.9 bits (74), Expect = 0.90 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P P PPP P Sbjct: 326 PPLPPPPPPPPPLPPPSSAGPPPPPPP 352 Score = 33.9 bits (74), Expect = 0.90 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +2 Query: 623 PXXQXXTPPPPXPPP--XXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 327 PLPPPPPPPPPLPPPSSAGPPPPPPPP 353 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP P PP P Sbjct: 340 PPSSAGPPPPPPPPPLPNSPAPPNP 364 >AK024444-1|BAB15734.1| 1343|Homo sapiens FLJ00034 protein protein. Length = 1343 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P +P PP PPP PP PP P Sbjct: 230 PSPSSSSPSPPPPPPPPAPPAPPAP 254 >AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein protein. Length = 502 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T P P PPP PPP PP P Sbjct: 3 TNPQPQPPPPAPPPPPPQP 21 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 P PP PP PP+P P PPP Sbjct: 7 PQPPPPAPPPPPPQPQPQPPPPPP 30 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +PP P PP P P PPP P Sbjct: 5 PQPQPPPPAPPPPPPQPQPQPPPPPPGP 32 Score = 32.3 bits (70), Expect = 2.8 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 620 RPXXQXXTPPPPXP-PPXXPPPXPPXP 697 +P PPPP P P PPP PP P Sbjct: 6 QPQPPPPAPPPPPPQPQPQPPPPPPGP 32 >AF254411-1|AAF87552.1| 1312|Homo sapiens ser/arg-rich pre-mRNA splicing factor SR-A1 protein. Length = 1312 Score = 33.9 bits (74), Expect = 0.90 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P +P PP PPP PP PP P Sbjct: 199 PSPSSSSPSPPPPPPPPAPPAPPAP 223 >AF120993-1|AAD56597.1| 411|Homo sapiens methyl-CpG binding protein 2 protein. Length = 411 Score = 33.9 bits (74), Expect = 0.90 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFP 613 G GG GGG GGG GGGG FP Sbjct: 103 GLGGDGGGCGGGGSGGGGAPRREPVPFP 130 >AF120989-1|AAD56596.1| 302|Homo sapiens testis-specific methyl-CpG binding protein 2 protein. Length = 302 Score = 33.9 bits (74), Expect = 0.90 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFP 613 G GG GGG GGG GGGG FP Sbjct: 103 GLGGDGGGCGGGGSGGGGAPRREPVPFP 130 >AF072242-1|AAC68871.1| 411|Homo sapiens methyl-CpG binding protein MBD2 protein. Length = 411 Score = 33.9 bits (74), Expect = 0.90 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFP 613 G GG GGG GGG GGGG FP Sbjct: 103 GLGGDGGGCGGGGSGGGGAPRREPVPFP 130 >AC004943-1|AAC79153.1| 2553|Homo sapiens unknown protein. Length = 2553 Score = 33.9 bits (74), Expect = 0.90 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 RP PPPP PPP P PP P Sbjct: 883 RPQTPEPPPPPPPPPPPPLPAAPPQP 908 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 2359 GGGGSGGGGGGGGGGGGG 2376 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXC 631 G G GGG GGG GGGG C Sbjct: 2360 GGGSGGGGGGGGGGGGGGSYHC 2381 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 2357 GGGGGGSGGGGGGGGG 2372 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 2357 GGGGGGSGGGGGGGGGGG 2374 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 2358 GGGGGSGGGGGGGGGGGG 2375 >Z11933-1|CAA77990.1| 443|Homo sapiens N-Oct 3 octamer DNA (ATGCAAAT) binding protein with brn-2 POU domain protein. Length = 443 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 68 GGGGGGGGGGGGGGGGGG 85 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 69 GGGGGGGGGGGGGGGGGG 86 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 70 GGGGGGGGGGGGGGGGGG 87 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 71 GGGGGGGGGGGGGGGGGG 88 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 73 GGGGGGGGGGGGGGGGDG 90 >X58964-1|CAA41730.1| 979|Homo sapiens MHC class II regulatory factor RFX protein. Length = 979 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 381 GGGGSGGGGGGGGGGGGG 398 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 382 GGGSGGGGGGGGGGGGGG 399 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 384 GSGGGGGGGGGGGGGGSG 401 >X56597-1|CAA39935.1| 321|Homo sapiens fibrillarin protein. Length = 321 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 46 GGGGGGGGGGGGGRGGGG 63 >X04106-1|CAA27726.1| 268|Homo sapiens protein ( Human mRNA for calcium dependent protease (small subunit). ). Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >U36561-1|AAA79948.1| 528|Homo sapiens fus-like protein protein. Length = 528 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 179 GSGGGGGGGGGGGSGGGG 196 >U16371-1|AAB60346.1| 31|Homo sapiens androgen receptor protein. Length = 31 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 4 GGGGGGGGGGGGGGGGGG 21 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 5 GGGGGGGGGGGGGGGGGG 22 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 6 GGGGGGGGGGGGGGGGGG 23 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 7 GGGGGGGGGGGGGGGGGG 24 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 8 GGGGGGGGGGGGGGGGGG 25 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 9 GGGGGGGGGGGGGGGGGG 26 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 10 GGGGGGGGGGGGGGGGGG 27 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 11 GGGGGGGGGGGGGGGGGG 28 >M59849-1|AAA52453.1| 321|Homo sapiens fibrillarin protein. Length = 321 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 46 GGGGGGGGGGGGGRGGGG 63 >M35851-1|AAA51772.1| 917|Homo sapiens androgen receptor protein. Length = 917 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 448 GGGGGGGGGGGGGGGGGG 465 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 449 GGGGGGGGGGGGGGGGGG 466 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 450 GGGGGGGGGGGGGGGGGG 467 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 451 GGGGGGGGGGGGGGGGGG 468 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 452 GGGGGGGGGGGGGGGGGG 469 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 453 GGGGGGGGGGGGGGGGGG 470 >M31511-1|AAA35646.1| 268|Homo sapiens protein ( Human calcium-activated neutral protease small subunit gene, exon 11. ). Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >M27430-1|AAA51886.1| 919|Homo sapiens AR protein. Length = 919 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 449 GGGGGGGGGGGGGGGGGG 466 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 450 GGGGGGGGGGGGGGGGGG 467 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 451 GGGGGGGGGGGGGGGGGG 468 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 452 GGGGGGGGGGGGGGGGGG 469 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 453 GGGGGGGGGGGGGGGGGG 470 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 454 GGGGGGGGGGGGGGGGGG 471 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 455 GGGGGGGGGGGGGGGGGG 472 >M23263-1|AAA51775.1| 918|Homo sapiens androgen receptor protein. Length = 918 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 445 GGGGGGGGGGGGGGGGGG 462 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 446 GGGGGGGGGGGGGGGGGG 463 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 447 GGGGGGGGGGGGGGGGGG 464 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 448 GGGGGGGGGGGGGGGGGG 465 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 449 GGGGGGGGGGGGGGGGGG 466 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 450 GGGGGGGGGGGGGGGGGG 467 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 451 GGGGGGGGGGGGGGGGGG 468 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 452 GGGGGGGGGGGGGGGGGG 469 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 453 GGGGGGGGGGGGGGGGGG 470 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 454 GGGGGGGGGGGGGGGGGG 471 >M21748-1|AAA51771.1| 917|Homo sapiens androgen receptor protein. Length = 917 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 448 GGGGGGGGGGGGGGGGGG 465 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 449 GGGGGGGGGGGGGGGGGG 466 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 450 GGGGGGGGGGGGGGGGGG 467 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 451 GGGGGGGGGGGGGGGGGG 468 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 452 GGGGGGGGGGGGGGGGGG 469 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 453 GGGGGGGGGGGGGGGGGG 470 >M20132-1|AAA51729.1| 919|Homo sapiens AR protein. Length = 919 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 449 GGGGGGGGGGGGGGGGGG 466 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 450 GGGGGGGGGGGGGGGGGG 467 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 451 GGGGGGGGGGGGGGGGGG 468 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 452 GGGGGGGGGGGGGGGGGG 469 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 453 GGGGGGGGGGGGGGGGGG 470 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 454 GGGGGGGGGGGGGGGGGG 471 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 455 GGGGGGGGGGGGGGGGGG 472 >L38696-1|AAC28898.1| 291|Homo sapiens autoantigen p542 protein. Length = 291 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 216 GGGGGGGGSGGGGSGGGG 233 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 211 GGGASGGGGGGGGSGGGG 228 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 220 GGGGSGGGGSGGGGGGG 236 >L37868-1|AAB59611.1| 443|Homo sapiens POU-domain transcription factor protein. Length = 443 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 68 GGGGGGGGGGGGGGGGGG 85 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 69 GGGGGGGGGGGGGGGGGG 86 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 70 GGGGGGGGGGGGGGGGGG 87 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 71 GGGGGGGGGGGGGGGGGG 88 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 73 GGGGGGGGGGGGGGGGDG 90 >L29496-1|AAA51770.1| 734|Homo sapiens AR protein. Length = 734 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 261 GGGGGGGGGGGGGGGGGG 278 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 262 GGGGGGGGGGGGGGGGGG 279 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 263 GGGGGGGGGGGGGGGGGG 280 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 264 GGGGGGGGGGGGGGGGGG 281 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 265 GGGGGGGGGGGGGGGGGG 282 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 266 GGGGGGGGGGGGGGGGGG 283 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 267 GGGGGGGGGGGGGGGGGG 284 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 268 GGGGGGGGGGGGGGGGGG 285 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 269 GGGGGGGGGGGGGGGGGG 286 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 270 GGGGGGGGGGGGGGGGGG 287 >CR457069-1|CAG33350.1| 321|Homo sapiens FBL protein. Length = 321 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 46 GGGGGGGGGGGGGRGGGG 63 >BT020144-1|AAV38946.1| 321|Homo sapiens fibrillarin protein. Length = 321 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 46 GGGGGGGGGGGGGRGGGG 63 >BT009775-1|AAP88777.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >BT006830-1|AAP35476.1| 321|Homo sapiens fibrillarin protein. Length = 321 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 46 GGGGGGGGGGGGGRGGGG 63 >BC132975-1|AAI32976.1| 914|Homo sapiens AR protein protein. Length = 914 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 449 GGGGGGGGGGGGGGGGGG 466 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 450 GGGGGGGGGGGGGGGGGG 467 >BC105018-1|AAI05019.1| 306|Homo sapiens RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog protein. Length = 306 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 231 GGGGGGGGSGGGGSGGGG 248 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 228 GGAGGGGGGGGSGGGG 243 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 235 GGGGSGGGGSGGGGGGG 251 >BC103753-1|AAI03754.1| 307|Homo sapiens RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog protein. Length = 307 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 232 GGGGGGGGSGGGGSGGGG 249 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 227 GGGASGGGGGGGGSGGGG 244 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 236 GGGGSGGGGSGGGGGGG 252 >BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosophila) protein. Length = 591 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXX---PPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 341 PLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P N PP P Sbjct: 339 PPPLPSTGPPPPPPPPPLPNQVPPPPPP 366 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPP 355 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXP----PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 352 PPPPLPNQVPPPPPPPPAPPLP 373 >BC094799-1|AAH94799.1| 1222|Homo sapiens valosin containing protein (p97)/p47 complex interacting protein 1 protein. Length = 1222 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 4 PPPPPPPLPPPPPPP 18 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q PPPP PPP PP P P Sbjct: 3 QPPPPPPPLPPPPPPPEAPQTP 24 >BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. Length = 527 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXX---PPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 298 PLPSTGPPPPPPPPPLPNQVPPPPPPPP 325 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P N PP P Sbjct: 296 PPPLPSTGPPPPPPPPPLPNQVPPPPPP 323 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 288 PPPPGPPPPPPLPSTGPPPPPPPPP 312 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXP----PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 309 PPPPLPNQVPPPPPPPPAPPLP 330 >BC064998-1|AAH64998.1| 268|Homo sapiens CAPNS1 protein protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 34 GGAGGGGGGGGGGGGG 49 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 34 GGAGGGGGGGGGGGGGGG 51 >BC051699-1|AAH51699.2| 443|Homo sapiens POU class 3 homeobox 2 protein. Length = 443 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 68 GGGGGGGGGGGGGGGGGG 85 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 69 GGGGGGGGGGGGGGGGGG 86 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 70 GGGGGGGGGGGGGGGGGG 87 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 71 GGGGGGGGGGGGGGGGGG 88 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 73 GGGGGGGGGGGGGGGGDG 90 >BC049826-1|AAH49826.1| 979|Homo sapiens regulatory factor X, 1 (influences HLA class II expression) protein. Length = 979 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 381 GGGGSGGGGGGGGGGGGG 398 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 382 GGGSGGGGGGGGGGGGGG 399 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 384 GSGGGGGGGGGGGGGGSG 401 >BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 73 PPPPPPPPPPPPPPP 87 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 73 PPPPPPPPPPPPPPP 87 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 P PP PPP PPP PP Sbjct: 71 PGPPPPPPPPPPPPPP 86 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 P P PPP PPP PP P Sbjct: 71 PGPPPPPPPPPPPPPPP 87 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P PPP Sbjct: 75 PPPPPPPPPPPPPGLSPRAPAPPP 98 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 33.5 bits (73), Expect = 1.2 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPP----PXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPP 781 G P + PPP PPP PP P PP P PPP Sbjct: 307 GSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPP 366 Query: 782 XXXPP 796 PP Sbjct: 367 PPPPP 371 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 392 PPPPPPPPPGPPPPP 406 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 391 PPPPPPPPPPGPPPPP 406 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPP 682 +P PPPP PPP PPP Sbjct: 385 QPTGGAPPPPPPPPPPGPPPP 405 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 391 PPPPPPP--PPPGPPPP 405 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PP PPP PP PP P Sbjct: 382 PLSQPTGGAPPPPPPPPPPGPPPPP 406 >BC028050-1|AAH28050.1| 634|Homo sapiens CREB regulated transcription coactivator 1 protein. Length = 634 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPP 691 ++P Q PPPP P PPP PP Sbjct: 361 QQPPPQPQPPPPPPPASQQPPPPPP 385 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 369 PPPPPPPASQQPPPPPPP 386 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP P PP P P PPP P Sbjct: 362 QPPPQPQPPPPPPPASQQPPPPPPP 386 >BC027713-1|AAH27713.1| 804|Homo sapiens heterogeneous nuclear ribonucleoprotein U-like 1 protein. Length = 804 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 701 PPPPQPPPQQPPPPP 715 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +PP P PP+P P PPP P Sbjct: 692 PQQQPPPQQPPPPQPPPQQPPPPPSYSP 719 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 696 PPPQQPPPPQPPPQQPPP 713 >BC023643-1|AAH23643.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >BC023614-1|AAH23614.2| 604|Homo sapiens CRTC1 protein protein. Length = 604 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPP 691 ++P Q PPPP P PPP PP Sbjct: 331 QQPPPQPQPPPPPPPASQQPPPPPP 355 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 339 PPPPPPPASQQPPPPPPP 356 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP P PP P P PPP P Sbjct: 332 QPPPQPQPPPPPPPASQQPPPPPPP 356 >BC021933-1|AAH21933.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >BC019260-1|AAH19260.1| 321|Homo sapiens fibrillarin protein. Length = 321 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 46 GGGGGGGGGGGGGRGGGG 63 >BC018931-1|AAH18931.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >BC017308-1|AAH17308.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >BC017075-1|AAH17075.2| 475|Homo sapiens CRTC1 protein protein. Length = 475 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPP 691 ++P Q PPPP P PPP PP Sbjct: 202 QQPPPQPQPPPPPPPASQQPPPPPP 226 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 210 PPPPPPPASQQPPPPPPP 227 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP P PP P P PPP P Sbjct: 203 QPPPQPQPPPPPPPASQQPPPPPPP 227 >BC014232-1|AAH14232.1| 756|Homo sapiens HNRPUL1 protein protein. Length = 756 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 601 PPPPQPPPQQPPPPP 615 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +PP P PP+P P PPP P Sbjct: 592 PQQQPPPQQPPPPQPPPQQPPPPPSYSP 619 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 596 PPPQQPPPPQPPPQQPPP 613 >BC011903-1|AAH11903.1| 322|Homo sapiens CAPNS1 protein protein. Length = 322 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >BC009988-1|AAH09988.2| 756|Homo sapiens HNRPUL1 protein protein. Length = 756 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 601 PPPPQPPPQQPPPPP 615 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +PP P PP+P P PPP P Sbjct: 592 PQQQPPPQQPPPPQPPPQQPPPPPSYSP 619 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 596 PPPQQPPPPQPPPQQPPP 613 >BC007779-1|AAH07779.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >BC002564-1|AAH02564.1| 856|Homo sapiens heterogeneous nuclear ribonucleoprotein U-like 1 protein. Length = 856 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 701 PPPPQPPPQQPPPPP 715 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +PP P PP+P P PPP P Sbjct: 692 PQQQPPPQQPPPPQPPPQQPPPPPSYSP 719 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 696 PPPQQPPPPQPPPQQPPP 713 >BC000592-1|AAH00592.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >AY789642-1|AAV40829.1| 268|Homo sapiens calpain, small subunit 1 protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >AY360171-1|AAQ98856.1| 650|Homo sapiens transducer of regulated CREB protein 1 protein. Length = 650 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPP 691 ++P Q PPPP P PPP PP Sbjct: 377 QQPPPQPQPPPPPPPASQQPPPPPP 401 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 385 PPPPPPPASQQPPPPPPP 402 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP P PP P P PPP P Sbjct: 378 QPPPQPQPPPPPPPASQQPPPPPPP 402 >AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. Length = 570 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXX---PPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 341 PLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P N PP P Sbjct: 339 PPPLPSTGPPPPPPPPPLPNQVPPPPPP 366 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPP 355 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXP----PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 352 PPPPLPNQVPPPPPPPPAPPLP 373 >AY225517-1|AAO74854.1| 124|Homo sapiens acetylcholinesterase membrane anchor precursor PRiMA variant II protein. Length = 124 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 56 PPPPLPPPPPPPPPP 70 >AY225516-1|AAO74853.1| 153|Homo sapiens acetylcholinesterase membrane anchor precursor PRiMA variant I protein. Length = 153 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 56 PPPPLPPPPPPPPPP 70 >AY040323-1|AAK93832.1| 593|Homo sapiens mucoepidermoid susceptibility protein protein. Length = 593 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPP 691 ++P Q PPPP P PPP PP Sbjct: 361 QQPPPQPQPPPPPPPASQQPPPPPP 385 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 369 PPPPPPPASQQPPPPPPP 386 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP P PP P P PPP P Sbjct: 362 QPPPQPQPPPPPPPASQQPPPPPPP 386 >AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXX---PPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 341 PLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P N PP P Sbjct: 339 PPPLPSTGPPPPPPPPPLPNQVPPPPPP 366 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPP 355 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXP----PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 352 PPPPLPNQVPPPPPPPPAPPLP 373 >AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXX---PPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 588 PLPSTGPPPPPPPPPLPNQVPPPPPPPP 615 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P N PP P Sbjct: 586 PPPLPSTGPPPPPPPPPLPNQVPPPPPP 613 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 578 PPPPGPPPPPPLPSTGPPPPPPPPP 602 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXP----PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 599 PPPPLPNQVPPPPPPPPAPPLP 620 >AL356358-1|CAI40496.1| 920|Homo sapiens androgen receptor (dihydrotestosterone receptor; testicular feminization; spina protein. Length = 920 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 451 GGGGGGGGGGGGGGGGGG 468 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 452 GGGGGGGGGGGGGGGGGG 469 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 453 GGGGGGGGGGGGGGGGGG 470 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 454 GGGGGGGGGGGGGGGGGG 471 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 455 GGGGGGGGGGGGGGGGGG 472 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 456 GGGGGGGGGGGGGGGGGG 473 >AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXX---PPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 341 PLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P N PP P Sbjct: 339 PPPLPSTGPPPPPPPPPLPNQVPPPPPP 366 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPP 355 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXP----PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 352 PPPPLPNQVPPPPPPPPAPPLP 373 >AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXX---PPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 588 PLPSTGPPPPPPPPPLPNQVPPPPPPPP 615 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P N PP P Sbjct: 586 PPPLPSTGPPPPPPPPPLPNQVPPPPPP 613 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 578 PPPPGPPPPPPLPSTGPPPPPPPPP 602 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXP----PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 599 PPPPLPNQVPPPPPPPPAPPLP 620 >AL355338-1|CAH70366.2| 663|Homo sapiens Zic family member 5 (odd-paired homolog, Drosophila) protein. Length = 663 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PP P PPP PPP PP Sbjct: 151 PPPAPPLPPTPSPPPPPPPPPPP 173 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 410 PPPPPPPPPPPPPPP 424 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 410 PPPPPPPPPPPPPPP 424 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +2 Query: 632 QXXTPPPPXPP----PXXPPPXPPXP 697 Q PPPP PP P PPP PP P Sbjct: 146 QPSAPPPPAPPLPPTPSPPPPPPPPP 171 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 P PP PP PP P P PPP Sbjct: 147 PSAPPPPAPPLPPTPSPPPPPPPP 170 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 P PP P P PPP PP P Sbjct: 156 PLPPTPSPPPPPPPPPPP 173 >AL158016-1|CAI40853.1| 920|Homo sapiens androgen receptor (dihydrotestosterone receptor; testicular feminization; spina protein. Length = 920 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 451 GGGGGGGGGGGGGGGGGG 468 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 452 GGGGGGGGGGGGGGGGGG 469 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 453 GGGGGGGGGGGGGGGGGG 470 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 454 GGGGGGGGGGGGGGGGGG 471 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 455 GGGGGGGGGGGGGGGGGG 472 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 456 GGGGGGGGGGGGGGGGGG 473 >AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein protein. Length = 246 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 68 PPPPPPPPPPPPPPP 82 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 68 PPPPPPPPPPPPPPP 82 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 P PP PPP PPP PP Sbjct: 66 PGPPPPPPPPPPPPPP 81 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 P P PPP PPP PP P Sbjct: 66 PGPPPPPPPPPPPPPPP 82 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P PPP Sbjct: 70 PPPPPPPPPPPPPGLSPRAPAPPP 93 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 33.5 bits (73), Expect = 1.2 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPP----PXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPP 781 G P + PPP PPP PP P PP P PPP Sbjct: 307 GSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPP 366 Query: 782 XXXPP 796 PP Sbjct: 367 PPPPP 371 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 392 PPPPPPPPPGPPPPP 406 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 391 PPPPPPPPPPGPPPPP 406 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPP 682 +P PPPP PPP PPP Sbjct: 385 QPTGGAPPPPPPPPPPGPPPP 405 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 391 PPPPPPP--PPPGPPPP 405 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PP PPP PP PP P Sbjct: 382 PLSQPTGGAPPPPPPPPPPGPPPPP 406 >AL049564-2|CAI43080.1| 920|Homo sapiens androgen receptor (dihydrotestosterone receptor; testicular feminization; spina protein. Length = 920 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 451 GGGGGGGGGGGGGGGGGG 468 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 452 GGGGGGGGGGGGGGGGGG 469 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 453 GGGGGGGGGGGGGGGGGG 470 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 454 GGGGGGGGGGGGGGGGGG 471 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 455 GGGGGGGGGGGGGGGGGG 472 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 456 GGGGGGGGGGGGGGGGGG 473 >AL031668-6|CAB43742.1| 290|Homo sapiens RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog protein. Length = 290 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 215 GGGGGGGGSGGGGSGGGG 232 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 212 GGAGGGGGGGGSGGGG 227 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 219 GGGGSGGGGSGGGGGGG 235 >AL031668-5|CAI22150.1| 306|Homo sapiens RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog protein. Length = 306 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 231 GGGGGGGGSGGGGSGGGG 248 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 228 GGAGGGGGGGGSGGGG 243 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 235 GGGGSGGGGSGGGGGGG 251 >AL031668-4|CAI22149.1| 237|Homo sapiens RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog protein. Length = 237 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 215 GGGGGGGGSGGGGSGGGG 232 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 212 GGAGGGGGGGGSGGGG 227 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 219 GGGGSGGGGSGGGGGGG 235 >AL022395-2|CAB37982.1| 443|Homo sapiens POU domain, class 3, transcription factor 2 protein. Length = 443 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 68 GGGGGGGGGGGGGGGGGG 85 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 69 GGGGGGGGGGGGGGGGGG 86 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 70 GGGGGGGGGGGGGGGGGG 87 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 71 GGGGGGGGGGGGGGGGGG 88 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 73 GGGGGGGGGGGGGGGGDG 90 >AK222915-1|BAD96635.1| 307|Homo sapiens RNA binding protein (autoantigenic, hnRNP-associated with lethal yellow) long i protein. Length = 307 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 232 GGGGGGGGSGGGGSGGGG 249 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 227 GGGASGGGGGGGGSGGGG 244 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 236 GGGGSGGGGSGGGGGGG 252 >AK127057-1|BAC86806.1| 752|Homo sapiens protein ( Homo sapiens cDNA FLJ45114 fis, clone BRAWH3034775, highly similar to Homo sapiens E1B-55kDa-associated protein 5 (E1B-AP5). ). Length = 752 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 +P +PP P PP+P P PPP P Sbjct: 577 SPQQQPPPQQPPPPQPPPQQPPPPPSYSP 605 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 587 PPPPQPPPQQPPPPP 601 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 582 PPPQQPPPPQPPPQQPPP 599 >AK123671-1|BAC85674.1| 520|Homo sapiens protein ( Homo sapiens cDNA FLJ41677 fis, clone HCASM2002918. ). Length = 520 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 457 PPPPPPPPPPPPPPP 471 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 457 PPPPPPPPPPPPPPP 471 >AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens cDNA FLJ38927 fis, clone NT2NE2012505, highly similar to Gallus gallus mRNA for avena. ). Length = 467 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXX---PPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 238 PLPSTGPPPPPPPPPLPNQVPPPPPPPP 265 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P N PP P Sbjct: 236 PPPLPSTGPPPPPPPPPLPNQVPPPPPP 263 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 228 PPPPGPPPPPPLPSTGPPPPPPPPP 252 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXP----PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 249 PPPPLPNQVPPPPPPPPAPPLP 270 >AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens cDNA FLJ90750 fis, clone PLACE2000118, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN HOMOLOG. ). Length = 169 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 63 PPPPPPPPPGPPPPP 77 Score = 31.5 bits (68), Expect = 4.8 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 6/58 (10%) Frame = +2 Query: 641 TPPPPXPPPXXP------PPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 TPPPP PP P PP PP P PPP PP Sbjct: 18 TPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPGPPP 75 >AK021455-1|BAB13831.1| 390|Homo sapiens protein ( Homo sapiens cDNA FLJ11393 fis, clone HEMBA1000591, weakly similar to PTB-ASSOCIATED SPLICING FACTOR. ). Length = 390 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 225 PPPPQPPPQQPPPPP 239 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +PP P PP+P P PPP P Sbjct: 216 PQQQPPPQQPPPPQPPPQQPPPPPSYSP 243 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 220 PPPQQPPPPQPPPQQPPP 237 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 33.5 bits (73), Expect = 1.2 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPP----PXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPP 781 G P + PPP PPP PP P PP P PPP Sbjct: 435 GSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPP 494 Query: 782 XXXPP 796 PP Sbjct: 495 LPPPP 499 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 519 PPPPPPPPPGPPPPP 533 >AJ007509-1|CAA07548.1| 856|Homo sapiens E1B-55kDa-associated protein protein. Length = 856 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 701 PPPPQPPPQQPPPPP 715 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +PP P PP+P P PPP P Sbjct: 692 PQQQPPPQQPPPPQPPPQQPPPPPSYSP 719 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPP PPP PPP P P Sbjct: 696 PPPQQPPPPQPPPQQPPP 713 >AF521671-1|AAN03447.1| 2165|Homo sapiens SWI/SNF chromatin remodeling complex subunit OSA2 protein. Length = 2165 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 236 GGGGGGGGGGGGGSGGGG 253 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 240 GGGGGGGGGSGGGGGGGG 257 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 234 GAGGGGGGGGGGGGGSGG 251 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 237 GGGGGGGGGGGGSGGGGG 254 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 238 GGGGGGGGGGGSGGGGGG 255 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 239 GGGGGGGGGGSGGGGGGG 256 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 245 GGGGSGGGGGGGGAGAGG 262 >AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. Length = 591 Score = 33.5 bits (73), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXX---PPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 341 PLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 Score = 33.1 bits (72), Expect = 1.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P N PP P Sbjct: 339 PPPLPSTGPPPPPPPPPLPNQVPPPPPP 366 Score = 32.7 bits (71), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPP 355 Score = 31.9 bits (69), Expect = 3.6 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXP----PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 352 PPPPLPNQVPPPPPPPPAPPLP 373 >AF378304-1|AAK55418.1| 639|Homo sapiens zinc family member 5 protein protein. Length = 639 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PP P PPP PPP PP Sbjct: 127 PPPAPPLPPTPSPPPPPPPPPPP 149 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 386 PPPPPPPPPPPPPPP 400 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 386 PPPPPPPPPPPPPPP 400 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +2 Query: 632 QXXTPPPPXPP----PXXPPPXPPXP 697 Q PPPP PP P PPP PP P Sbjct: 122 QPSAPPPPAPPLPPTPSPPPPPPPPP 147 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 P PP PP PP P P PPP Sbjct: 123 PSAPPPPAPPLPPTPSPPPPPPPP 146 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 P PP P P PPP PP P Sbjct: 132 PLPPTPSPPPPPPPPPPP 149 >AF321917-1|AAK09426.1| 531|Homo sapiens androgen receptor protein. Length = 531 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 443 GGGGGGGGGGGGGGGGGG 460 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 444 GGGGGGGGGGGGGGGGGG 461 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 445 GGGGGGGGGGGGGGGGGG 462 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 446 GGGGGGGGGGGGGGGGGG 463 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 447 GGGGGGGGGGGGGGGGGG 464 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 448 GGGGGGGGGGGGGGGGGG 465 >AF321916-1|AAK09425.1| 542|Homo sapiens androgen receptor protein. Length = 542 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 454 GGGGGGGGGGGGGGGGGG 471 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 455 GGGGGGGGGGGGGGGGGG 472 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 456 GGGGGGGGGGGGGGGGGG 473 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 457 GGGGGGGGGGGGGGGGGG 474 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 458 GGGGGGGGGGGGGGGGGG 475 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 459 GGGGGGGGGGGGGGGGGG 476 >AF321915-1|AAK09424.1| 539|Homo sapiens androgen receptor protein. Length = 539 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 451 GGGGGGGGGGGGGGGGGG 468 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 452 GGGGGGGGGGGGGGGGGG 469 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 453 GGGGGGGGGGGGGGGGGG 470 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 454 GGGGGGGGGGGGGGGGGG 471 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 455 GGGGGGGGGGGGGGGGGG 472 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 456 GGGGGGGGGGGGGGGGGG 473 >AF321914-1|AAK09423.1| 544|Homo sapiens androgen receptor protein. Length = 544 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 455 GGGGGGGGGGGGGGGGGG 472 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 456 GGGGGGGGGGGGGGGGGG 473 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 457 GGGGGGGGGGGGGGGGGG 474 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 458 GGGGGGGGGGGGGGGGGG 475 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 459 GGGGGGGGGGGGGGGGGG 476 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 460 GGGGGGGGGGGGGGGGGG 477 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 461 GGGGGGGGGGGGGGGGGG 478 >AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. Length = 251 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 73 PPPPPPPPPPPPPPP 87 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 73 PPPPPPPPPPPPPPP 87 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 P PP PPP PPP PP Sbjct: 71 PGPPPPPPPPPPPPPP 86 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 P P PPP PPP PP P Sbjct: 71 PGPPPPPPPPPPPPPPP 87 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P PPP Sbjct: 75 PPPPPPPPPPPPPGLSPRAPAPPP 98 >AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. Length = 251 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 73 PPPPPPPPPPPPPPP 87 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 73 PPPPPPPPPPPPPPP 87 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 P PP PPP PPP PP Sbjct: 71 PGPPPPPPPPPPPPPP 86 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 P P PPP PPP PP P Sbjct: 71 PGPPPPPPPPPPPPPPP 87 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP PP PP PP P PPP Sbjct: 75 PPPPPPPPPPPPPGLSPRAPAPPP 98 >AF253515-1|AAN70985.1| 1957|Homo sapiens BAF250b subunit protein. Length = 1957 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 28 GGGGGGGGGGGGGSGGGG 45 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 32 GGGGGGGGGSGGGGGGGG 49 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 26 GAGGGGGGGGGGGGGSGG 43 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 29 GGGGGGGGGGGGSGGGGG 46 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 30 GGGGGGGGGGGSGGGGGG 47 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 31 GGGGGGGGGGSGGGGGGG 48 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 37 GGGGSGGGGGGGGAGAGG 54 >AF148457-1|AAF04487.1| 306|Homo sapiens heterogeneous nuclear ribonucleoprotein, alternate transcript protein. Length = 306 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 231 GGGGGGGGSGGGGSGGGG 248 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 228 GGAGGGGGGGGSGGGG 243 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 235 GGGGSGGGGSGGGGGGG 251 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 33.5 bits (73), Expect = 1.2 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPP----PXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPP 781 G P + PPP PPP PP P PP P PPP Sbjct: 306 GSPPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPP 365 Query: 782 XXXPP 796 PP Sbjct: 366 LPPPP 370 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 390 PPPPPPPPPGPPPPP 404 >AD001527-4|AAB51183.1| 268|Homo sapiens calcium-dependent protease, small (regulatory) subunit (calpain) (calcium-activ protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >AC018730-1|AAX88973.1| 500|Homo sapiens unknown protein. Length = 500 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 31 GGGGGGGGGGGGGAGGGG 48 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG G G GGGG+ Sbjct: 33 GGGGGGGGGGGAGGGGGGM 51 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 28 GAGGGGGGGGGGGGGGAG 45 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 30 GGGGGGGGGGGGGGAGGG 47 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 32 GGGGGGGGGGGGAGGGGG 49 >AC006950-1|AAD15623.1| 227|Homo sapiens FBRL_HUMAN [AA 1- 227] protein. Length = 227 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 46 GGGGGGGGGGGGGRGGGG 63 >AC006123-1|AAC97072.1| 414|Homo sapiens KIAA0616 protein protein. Length = 414 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPP 691 ++P Q PPPP P PPP PP Sbjct: 335 QQPPPQPQPPPPPPPASQQPPPPPP 359 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 343 PPPPPPPASQQPPPPPPP 360 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP P PP P P PPP P Sbjct: 336 QPPPQPQPPPPPPPASQQPPPPPPP 360 >AC005393-3|AAC28913.1| 318|Homo sapiens FBRL_HUMAN protein. Length = 318 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 43 GGGGGGGGGGGGGRGGGG 60 >AC002984-1|AAB81546.1| 268|Homo sapiens CANS_Human protein. Length = 268 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 35 GAGGGGGGGGGGGGGGGG 52 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 37 GGGGGGGGGGGGGGGGGG 54 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 38 GGGGGGGGGGGGGGGGGG 55 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 39 GGGGGGGGGGGGGGGGGG 56 >AB209887-1|BAD93124.1| 725|Homo sapiens WD repeat domain 26 variant protein. Length = 725 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 69 GAGGGGGGGGGGGGGGGG 86 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 71 GGGGGGGGGGGGGGGGGG 88 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 72 GGGGGGGGGGGGGGGGGG 89 >AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain protein 4 protein. Length = 3599 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 TPPPP PPP PP PP P Sbjct: 2002 TPPPPPPPPPL-PPAPPQP 2019 >AB058753-1|BAB47479.1| 1236|Homo sapiens KIAA1850 protein protein. Length = 1236 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 18 PPPPPPPLPPPPPPP 32 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q PPPP PPP PP P P Sbjct: 17 QPPPPPPPLPPPPPPPEAPQTP 38 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXP-PPXXPPPXPP 691 R + P PPPP P PP PPP P Sbjct: 6 RSETREPGAMSQPPPPPPPLPPPPPPPEAP 35 >AB028987-1|BAA83016.2| 1315|Homo sapiens KIAA1064 protein protein. Length = 1315 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 RP PPPP PPP PP P P Sbjct: 547 RPMQGGPPPPPPPPPPPPGPPQMPMP 572 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G P +PPPP PPP P PP Sbjct: 18 GTPPPPPSESPPPPSPPPPSTPSPPP 43 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPP 780 TPP P PP P P P PPP Sbjct: 19 TPPPPPSESPPPPSPPPPSTPSPPP 43 Score = 30.7 bits (66), Expect = 8.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 4/23 (17%) Frame = +2 Query: 641 TPPPPX----PPPXXPPPXPPXP 697 TPPPP PPP PPP P P Sbjct: 19 TPPPPPSESPPPPSPPPPSTPSP 41 >AB028974-1|BAA83003.2| 402|Homo sapiens KIAA1051 protein protein. Length = 402 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 382 PPPQPPPPPPPPPPP 396 Score = 33.1 bits (72), Expect = 1.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 382 PPPQPPPPPPPPPPPP 397 Score = 32.3 bits (70), Expect = 2.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P P P PPP PPP PP P Sbjct: 370 PHWYRQPPVPQYPPPQPPPPPPPPP 394 Score = 31.9 bits (69), Expect = 3.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXP 688 ++P PP P PPP PPP P Sbjct: 374 RQPPVPQYPPPQPPPPPPPPPPPP 397 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 33.5 bits (73), Expect = 1.2 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPP----PXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPP 781 G P + PPP PPP PP P PP P PPP Sbjct: 307 GSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPP 366 Query: 782 XXXPP 796 PP Sbjct: 367 PPPPP 371 Score = 33.5 bits (73), Expect = 1.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 392 PPPPPPPPPGPPPPP 406 Score = 32.7 bits (71), Expect = 2.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 391 PPPPPPPPPPGPPPPP 406 Score = 31.5 bits (68), Expect = 4.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPP 682 +P PPPP PPP PPP Sbjct: 385 QPTGGAPPPPPPPPPPGPPPP 405 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 391 PPPPPPP--PPPGPPPP 405 Score = 30.7 bits (66), Expect = 8.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PP PPP PP PP P Sbjct: 382 PLSQPTGGAPPPPPPPPPPGPPPPP 406 >AB014516-1|BAA31591.1| 634|Homo sapiens KIAA0616 protein protein. Length = 634 Score = 33.5 bits (73), Expect = 1.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPP 691 ++P Q PPPP P PPP PP Sbjct: 361 QQPPPQPQPPPPPPPASQQPPPPPP 385 Score = 32.3 bits (70), Expect = 2.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 369 PPPPPPPASQQPPPPPPP 386 Score = 30.7 bits (66), Expect = 8.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP P PP P P PPP P Sbjct: 362 QPPPQPQPPPPPPPASQQPPPPPPP 386 >AB001835-1|BAA19459.1| 500|Homo sapiens Brain-1 protein. Length = 500 Score = 33.5 bits (73), Expect = 1.2 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 31 GGGGGGGGGGGGGAGGGG 48 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG G G GGGG+ Sbjct: 33 GGGGGGGGGGGAGGGGGGM 51 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 28 GAGGGGGGGGGGGGGGAG 45 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 30 GGGGGGGGGGGGGGAGGG 47 Score = 31.1 bits (67), Expect = 6.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 32 GGGGGGGGGGGGAGGGGG 49 >BC008207-1|AAH08207.1| 494|Homo sapiens hypothetical protein BC008207 protein. Length = 494 Score = 31.1 bits (67), Expect = 6.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 469 PPPPPPPPLPPPP 481 Score = 28.7 bits (61), Expect(2) = 1.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 P PPP PPP PP P Sbjct: 465 PYSLPPPPPPPPLPPPP 481 Score = 23.4 bits (48), Expect(2) = 1.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 644 PPPPXPPP 667 PPPP PPP Sbjct: 439 PPPPPPPP 446 >Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. Length = 638 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PPP P P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGP 496 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G P PPP PPP PP PP Sbjct: 468 GMMPPPPMGMMPPPPPPPSGQPPPPP 493 >Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. Length = 639 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PPP P P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGP 496 Score = 32.3 bits (70), Expect = 2.8 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 7/35 (20%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPP-------XXPPPXPPXP 697 G +P PPPP PPP PPP PP P Sbjct: 572 GVQPPLPPGAPPPPPPPPPGSAGMMYAPPPPPPPP 606 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G P PPP PPP PP PP Sbjct: 468 GMMPPPPMGMMPPPPPPPSGQPPPPP 493 >M94077-1|AAA36181.1| 316|Homo sapiens loricrin protein. Length = 316 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGVXXCXXG 622 GG GGG GGG GGGG+ C G Sbjct: 62 GGCGGGSSGGG-GGGGIGGCGGG 83 >M61120-1|AAA36180.1| 316|Homo sapiens loricrin protein. Length = 316 Score = 33.1 bits (72), Expect = 1.6 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGVXXCXXG 622 GG GGG GGG GGGG+ C G Sbjct: 62 GGCGGGSSGGG-GGGGIGGCGGG 83 >L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1 protein. Length = 639 Score = 33.1 bits (72), Expect = 1.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PPP P P Sbjct: 472 PPPMGMMPPPPPPPSGQPPPPPSGP 496 Score = 32.3 bits (70), Expect = 2.8 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 7/35 (20%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPP-------XXPPPXPPXP 697 G +P PPPP PPP PPP PP P Sbjct: 572 GVQPPLPPGAPPPPPPPPPVSAGMMYAPPPPPPPP 606 Score = 31.5 bits (68), Expect = 4.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G P PPP PPP PP PP Sbjct: 468 GMMPPPPMGMMPPPPPPPSGQPPPPP 493 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.311 0.146 0.499 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,129,215 Number of Sequences: 237096 Number of extensions: 1361663 Number of successful extensions: 52181 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 7382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33738 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 12991778748 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -