BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F10 (976 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 40 0.004 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 39 0.009 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 39 0.012 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 39 0.012 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 38 0.016 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 38 0.016 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 36 0.084 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 36 0.084 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 36 0.084 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 36 0.11 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 36 0.11 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 36 0.11 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 35 0.15 AY118955-1|AAM50815.1| 911|Drosophila melanogaster LD35748p pro... 35 0.15 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 35 0.15 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 35 0.15 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 35 0.15 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 35 0.15 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 35 0.15 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 35 0.15 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 35 0.15 AE013599-3650|AAF47037.3| 906|Drosophila melanogaster CG5403-PA... 35 0.15 AE013599-3649|AAO41347.1| 911|Drosophila melanogaster CG5403-PB... 35 0.15 X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.me... 35 0.20 AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p pro... 35 0.20 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 35 0.20 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 35 0.20 AE014297-416|AAF51905.3| 393|Drosophila melanogaster CG10303-PA... 35 0.20 AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB... 35 0.20 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 35 0.20 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 35 0.20 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 35 0.20 AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p pro... 34 0.26 AL031583-7|CAB41346.1| 359|Drosophila melanogaster EG:34F3.10 p... 34 0.26 AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA... 34 0.26 AE014298-111|AAF45553.2| 359|Drosophila melanogaster CG13358-PA... 34 0.26 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 34 0.26 AE014298-2781|AAF48895.2| 1868|Drosophila melanogaster CG7282-PA... 34 0.34 AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-P... 34 0.34 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 34 0.34 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 33 0.45 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 33 0.45 U62542-1|AAB05771.1| 901|Drosophila melanogaster dead ringer pr... 33 0.45 DQ285021-1|ABB90104.1| 110|Drosophila melanogaster G-rich selen... 33 0.45 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 33 0.45 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 33 0.45 AY060611-1|AAL28159.1| 108|Drosophila melanogaster GH03581p pro... 33 0.45 AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p pro... 33 0.45 AF396454-1|AAK72981.1| 110|Drosophila melanogaster G-rich selen... 33 0.45 AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-P... 33 0.45 AE014298-1711|AAF48111.2| 110|Drosophila melanogaster CG1844-PA... 33 0.45 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 33 0.45 AE014298-1050|AAF46265.4| 1268|Drosophila melanogaster CG12690-P... 33 0.45 AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA... 33 0.45 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 33 0.45 AE014134-1928|AAF52988.1| 96|Drosophila melanogaster CG17107-P... 33 0.45 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 33 0.45 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 33 0.45 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 33 0.45 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 33 0.45 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 33 0.45 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 33 0.45 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 33 0.45 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 33 0.45 AE013599-1122|AAF58779.3| 757|Drosophila melanogaster CG12052-P... 33 0.45 AB107346-1|BAC67651.1| 757|Drosophila melanogaster Lola protein... 33 0.45 AB107326-1|BAC67631.1| 757|Drosophila melanogaster Lola protein... 33 0.45 AB107306-1|BAC67611.1| 757|Drosophila melanogaster Lola protein... 33 0.45 AB107286-1|BAC67591.1| 757|Drosophila melanogaster Lola protein... 33 0.45 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 33 0.60 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 33 0.60 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 33 0.60 AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p pro... 33 0.60 AY069647-1|AAL39792.1| 337|Drosophila melanogaster LD41395p pro... 33 0.60 AE014296-2974|AAF49295.1| 337|Drosophila melanogaster CG5546-PA... 33 0.60 X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein ... 33 0.79 M57889-1|AAA28920.1| 1322|Drosophila melanogaster su(s) protein ... 33 0.79 AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p pro... 33 0.79 AY094731-1|AAM11084.1| 708|Drosophila melanogaster GH25793p pro... 33 0.79 AY089487-1|AAL90225.1| 293|Drosophila melanogaster AT31162p pro... 33 0.79 AY071563-1|AAL49185.1| 1220|Drosophila melanogaster RE63043p pro... 33 0.79 AL031581-8|CAA20886.1| 1325|Drosophila melanogaster EG:115C2.3,F... 33 0.79 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 33 0.79 AE014298-82|AAF45534.1| 1325|Drosophila melanogaster CG6222-PA p... 33 0.79 AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA p... 33 0.79 AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA... 33 0.79 AE014297-1179|AAF54542.1| 293|Drosophila melanogaster CG4073-PA... 33 0.79 AE013599-3336|AAM68207.1| 751|Drosophila melanogaster CG13503-P... 33 0.79 AE013599-3335|AAM68206.1| 751|Drosophila melanogaster CG13503-P... 33 0.79 AE013599-3334|AAM68205.1| 751|Drosophila melanogaster CG13503-P... 33 0.79 AE013599-3333|AAF46800.2| 751|Drosophila melanogaster CG13503-P... 33 0.79 AE013599-3332|AAM68204.1| 708|Drosophila melanogaster CG13503-P... 33 0.79 AE013599-3331|AAM68208.2| 761|Drosophila melanogaster CG13503-P... 33 0.79 X54251-1|CAA38152.1| 1596|Drosophila melanogaster nuclear protei... 32 1.0 BT023751-1|AAZ41759.1| 1594|Drosophila melanogaster RH56202p pro... 32 1.0 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 32 1.0 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 32 1.0 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 32 1.0 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 32 1.0 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 32 1.0 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 32 1.0 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 32 1.0 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 32 1.0 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 32 1.0 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 32 1.0 AE014296-2144|AAF49916.1| 733|Drosophila melanogaster CG10663-P... 32 1.0 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 32 1.0 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 32 1.0 AE013599-1817|AAF58300.2| 1594|Drosophila melanogaster CG8118-PB... 32 1.0 AE013599-1816|AAF58299.1| 1594|Drosophila melanogaster CG8118-PA... 32 1.0 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 32 1.0 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 32 1.4 BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p pro... 32 1.4 BT030124-1|ABN49263.1| 655|Drosophila melanogaster IP13804p pro... 32 1.4 BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p pro... 32 1.4 BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p pro... 32 1.4 BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p pro... 32 1.4 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 32 1.4 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 32 1.4 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 32 1.4 AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p pro... 32 1.4 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 32 1.4 AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH0791... 32 1.4 AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-P... 32 1.4 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 32 1.4 AE014298-1814|AAF48205.2| 963|Drosophila melanogaster CG32648-P... 32 1.4 AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD... 32 1.4 AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC... 32 1.4 AE014297-2408|AAF55467.1| 1493|Drosophila melanogaster CG14318-P... 32 1.4 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 32 1.4 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 32 1.4 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 32 1.4 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 31 1.8 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 31 1.8 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 31 1.8 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 31 1.8 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 31 1.8 BT024428-1|ABC86490.1| 627|Drosophila melanogaster IP02644p pro... 31 1.8 BT022134-1|AAY51529.1| 543|Drosophila melanogaster IP08802p pro... 31 1.8 BT015257-1|AAT94486.1| 988|Drosophila melanogaster LP04173p pro... 31 1.8 BT011461-1|AAR99119.1| 638|Drosophila melanogaster RE27685p pro... 31 1.8 BT011351-1|AAR96143.1| 638|Drosophila melanogaster RE74788p pro... 31 1.8 BT011350-1|AAR96142.1| 489|Drosophila melanogaster RH05790p pro... 31 1.8 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 31 1.8 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 31 1.8 BT003578-1|AAO39582.1| 739|Drosophila melanogaster LD24631p pro... 31 1.8 BT003171-1|AAO24926.1| 443|Drosophila melanogaster SD07604p pro... 31 1.8 BT001477-1|AAN71232.1| 443|Drosophila melanogaster LD21345p pro... 31 1.8 AY119224-1|AAM51084.1| 469|Drosophila melanogaster SD16903p pro... 31 1.8 AY119154-1|AAM51014.1| 380|Drosophila melanogaster RE65163p pro... 31 1.8 AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p pro... 31 1.8 AY075437-1|AAL68252.1| 155|Drosophila melanogaster LP09837p pro... 31 1.8 AY058479-1|AAL13708.1| 700|Drosophila melanogaster GH28722p pro... 31 1.8 AL023893-1|CAA19655.1| 485|Drosophila melanogaster EG:132E8.1 p... 31 1.8 AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-P... 31 1.8 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 31 1.8 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 31 1.8 AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA... 31 1.8 AE014298-190|AAS65244.1| 443|Drosophila melanogaster CG3056-PB,... 31 1.8 AE014298-189|AAF45613.1| 485|Drosophila melanogaster CG3056-PA,... 31 1.8 AE014297-461|AAN13377.1| 646|Drosophila melanogaster CG1021-PB,... 31 1.8 AE014297-460|AAF54123.2| 646|Drosophila melanogaster CG1021-PA,... 31 1.8 AE014296-3616|AAF51781.3| 627|Drosophila melanogaster CG7152-PB... 31 1.8 AE014296-723|AAF47815.1| 155|Drosophila melanogaster CG10853-PA... 31 1.8 AE014296-443|AAF47637.2| 988|Drosophila melanogaster CG1317-PB ... 31 1.8 AE014134-2970|AAF53700.1| 530|Drosophila melanogaster CG10348-P... 31 1.8 AE014134-2891|AAN11175.1| 475|Drosophila melanogaster CG5674-PC... 31 1.8 AE014134-2886|AAN11174.1| 489|Drosophila melanogaster CG5674-PA... 31 1.8 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 31 1.8 AE013599-2734|AAF57660.2| 1271|Drosophila melanogaster CG30122-P... 31 1.8 AE013599-1064|AAM68780.2| 1734|Drosophila melanogaster CG18408-P... 31 1.8 AB053479-1|BAB62018.1| 1743|Drosophila melanogaster DCAPL2 protein. 31 1.8 X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. 31 2.4 U41808-1|AAC47016.1| 452|Drosophila melanogaster Cyclin D protein. 31 2.4 U21717-1|AAA92045.1| 743|Drosophila melanogaster nervy protein. 31 2.4 M25292-1|AAA17840.1| 397|Drosophila melanogaster dsx protein. 31 2.4 BT029258-1|ABK30895.1| 427|Drosophila melanogaster FI01107p pro... 31 2.4 BT029145-1|ABJ17079.1| 428|Drosophila melanogaster RT01021p pro... 31 2.4 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 31 2.4 BT024335-1|ABC86397.1| 257|Drosophila melanogaster IP09958p pro... 31 2.4 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 31 2.4 BT015199-1|AAT94428.1| 335|Drosophila melanogaster RE69682p pro... 31 2.4 BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p pro... 31 2.4 BT010035-1|AAQ22504.1| 1596|Drosophila melanogaster LD47819p pro... 31 2.4 BT009951-1|AAQ22420.1| 295|Drosophila melanogaster RH51767p pro... 31 2.4 BT004898-1|AAO47876.1| 743|Drosophila melanogaster LD17501p pro... 31 2.4 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 31 2.4 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 31 2.4 BT003529-1|AAO39533.1| 987|Drosophila melanogaster RE18590p pro... 31 2.4 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 31 2.4 AY121649-1|AAM51976.1| 950|Drosophila melanogaster LD23647p pro... 31 2.4 AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p pro... 31 2.4 AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p pro... 31 2.4 AY069509-1|AAL39654.1| 481|Drosophila melanogaster LD22957p pro... 31 2.4 AY060257-1|AAL25296.1| 427|Drosophila melanogaster GH08308p pro... 31 2.4 AY051919-1|AAK93343.1| 255|Drosophila melanogaster LD40489p pro... 31 2.4 AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p pro... 31 2.4 AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 prot... 31 2.4 AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 prot... 31 2.4 AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 prot... 31 2.4 AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 prot... 31 2.4 AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 prot... 31 2.4 AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 prot... 31 2.4 AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 prot... 31 2.4 AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 prot... 31 2.4 AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 prot... 31 2.4 AM294871-1|CAL26857.1| 148|Drosophila melanogaster CG10853 prot... 31 2.4 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 31 2.4 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 31 2.4 AF260583-1|AAG13285.1| 481|Drosophila melanogaster cyclin D pro... 31 2.4 AF234157-1|AAF60294.1| 255|Drosophila melanogaster SR family sp... 31 2.4 AF232773-1|AAF43413.1| 255|Drosophila melanogaster SR family sp... 31 2.4 AF086820-1|AAC36333.1| 428|Drosophila melanogaster paired-like ... 31 2.4 AE014298-2938|AAN09519.1| 1596|Drosophila melanogaster CG12701-P... 31 2.4 AE014298-2937|AAF49020.1| 1596|Drosophila melanogaster CG12701-P... 31 2.4 AE014298-2608|AAF48762.1| 428|Drosophila melanogaster CG6269-PA... 31 2.4 AE014298-2505|AAF48684.1| 335|Drosophila melanogaster CG13001-P... 31 2.4 AE014298-2283|AAF48537.1| 481|Drosophila melanogaster CG9096-PC... 31 2.4 AE014298-2282|AAN09375.1| 481|Drosophila melanogaster CG9096-PB... 31 2.4 AE014298-2281|AAN09374.1| 481|Drosophila melanogaster CG9096-PA... 31 2.4 AE014298-1582|AAF48018.1| 267|Drosophila melanogaster CG12625-P... 31 2.4 AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-P... 31 2.4 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 31 2.4 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 31 2.4 AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-P... 31 2.4 AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-P... 31 2.4 AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-P... 31 2.4 AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA... 31 2.4 AE014297-2769|AAF55745.3| 1314|Drosophila melanogaster CG34139-P... 31 2.4 AE014297-2188|AAF55300.1| 255|Drosophila melanogaster CG6987-PA... 31 2.4 AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA... 31 2.4 AE014297-676|AAF54168.2| 427|Drosophila melanogaster CG11094-PC... 31 2.4 AE014297-675|AAN13385.1| 427|Drosophila melanogaster CG11094-PB... 31 2.4 AE014297-674|AAF54169.1| 549|Drosophila melanogaster CG11094-PA... 31 2.4 AE014297-426|AAF51896.2| 171|Drosophila melanogaster CG15597-PA... 31 2.4 AE014297-425|AAF51897.2| 295|Drosophila melanogaster CG1154-PA ... 31 2.4 AE014296-2979|ABC66133.1| 329|Drosophila melanogaster CG34002-P... 31 2.4 AE014296-1757|AAF50200.2| 734|Drosophila melanogaster CG32050-P... 31 2.4 AE014296-390|AAF47594.1| 553|Drosophila melanogaster CG12361-PA... 31 2.4 AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-P... 31 2.4 AE014134-2238|AAF53220.2| 950|Drosophila melanogaster CG5787-PA... 31 2.4 AE013599-3848|AAF47191.2| 743|Drosophila melanogaster CG3385-PA... 31 2.4 AE013599-3307|AAF46785.2| 204|Drosophila melanogaster CG13499-P... 31 2.4 AE013599-1467|AAF58524.2| 259|Drosophila melanogaster CG30042-P... 31 2.4 X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal p... 31 3.2 L35153-1|AAA64457.1| 857|Drosophila melanogaster polycomblike n... 31 3.2 BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p pro... 31 3.2 BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p pro... 31 3.2 BT021376-1|AAX33524.1| 758|Drosophila melanogaster LD46788p pro... 31 3.2 AY795927-1|AAY27494.1| 912|Drosophila melanogaster notch protein. 31 3.2 AY075585-1|AAL68389.1| 1043|Drosophila melanogaster SD09488p pro... 31 3.2 AY069803-1|AAL39948.1| 856|Drosophila melanogaster SD04280p pro... 31 3.2 AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease... 31 3.2 AE014298-3176|AAN09565.1| 856|Drosophila melanogaster CG14619-P... 31 3.2 AE014298-3175|AAN09564.1| 856|Drosophila melanogaster CG14619-P... 31 3.2 AE014298-3174|AAF50952.2| 856|Drosophila melanogaster CG14619-P... 31 3.2 AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA... 31 3.2 AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB... 31 3.2 AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA... 31 3.2 AE014298-972|AAF46216.3| 758|Drosophila melanogaster CG33691-PA... 31 3.2 AE014298-971|AAZ52507.1| 702|Drosophila melanogaster CG33691-PC... 31 3.2 AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA ... 31 3.2 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 31 3.2 AE013599-2620|AAF57748.2| 1043|Drosophila melanogaster CG5109-PA... 31 3.2 AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA ... 31 3.2 X76210-1|CAA53803.1| 389|Drosophila melanogaster homeotic ultra... 30 4.2 X05723-1|CAA29194.1| 389|Drosophila melanogaster Ultrabithorax ... 30 4.2 U31961-13|AAA84410.1| 346|Drosophila melanogaster UBXIVA protein. 30 4.2 U31961-12|AAA84409.1| 363|Drosophila melanogaster UBXIIA protein. 30 4.2 U31961-11|AAA84408.1| 380|Drosophila melanogaster UBXIA protein. 30 4.2 U31961-10|AAA84411.1| 372|Drosophila melanogaster UBXIIB protein. 30 4.2 U31961-9|AAA84412.1| 389|Drosophila melanogaster UBXIB protein. 30 4.2 BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p pro... 30 4.2 BT016162-1|AAV37047.1| 702|Drosophila melanogaster AT08270p pro... 30 4.2 BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p pro... 30 4.2 BT010241-1|AAQ23559.1| 380|Drosophila melanogaster RE43738p pro... 30 4.2 BT009983-1|AAQ22452.1| 622|Drosophila melanogaster RE53941p pro... 30 4.2 AY118596-1|AAM49965.1| 165|Drosophila melanogaster LD48005p pro... 30 4.2 AY113614-1|AAM29619.1| 121|Drosophila melanogaster RH62530p pro... 30 4.2 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 30 4.2 AY075371-1|AAL68216.1| 165|Drosophila melanogaster GM14667p pro... 30 4.2 AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p pro... 30 4.2 AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protei... 30 4.2 AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA... 30 4.2 AE014297-2261|AAF55355.2| 389|Drosophila melanogaster CG10388-P... 30 4.2 AE014297-2260|AAN13719.1| 372|Drosophila melanogaster CG10388-P... 30 4.2 AE014297-2259|AAS65158.1| 355|Drosophila melanogaster CG10388-P... 30 4.2 AE014297-2258|AAN13718.1| 380|Drosophila melanogaster CG10388-P... 30 4.2 AE014297-2257|AAN13717.1| 363|Drosophila melanogaster CG10388-P... 30 4.2 AE014297-2256|AAF55356.1| 346|Drosophila melanogaster CG10388-P... 30 4.2 AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-P... 30 4.2 AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-P... 30 4.2 AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA... 30 4.2 AE014134-2686|AAF53511.1| 622|Drosophila melanogaster CG4132-PA... 30 4.2 AE013599-3513|AAN16117.1| 165|Drosophila melanogaster CG3800-PA... 30 4.2 AE013599-2521|AAF57825.3| 702|Drosophila melanogaster CG11423-P... 30 4.2 AE013599-1232|AAF58699.1| 121|Drosophila melanogaster CG9080-PA... 30 4.2 U31961-18|AAA84417.1| 642|Drosophila melanogaster protein ( Dro... 30 5.5 L14768-1|AAB39774.1| 1429|Drosophila melanogaster expanded protein. 30 5.5 BT023949-1|ABB36453.1| 1312|Drosophila melanogaster IP03879p pro... 30 5.5 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 30 5.5 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 30 5.5 AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p pro... 30 5.5 AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p pro... 30 5.5 AY095057-1|AAM11385.1| 258|Drosophila melanogaster LD46359p pro... 30 5.5 AY069068-1|AAL39213.1| 1427|Drosophila melanogaster GH08582p pro... 30 5.5 AJ249466-1|CAB60724.1| 258|Drosophila melanogaster DXl6 protein... 30 5.5 AF232774-1|AAF43414.1| 258|Drosophila melanogaster SR family sp... 30 5.5 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 30 5.5 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 30 5.5 AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA... 30 5.5 AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB... 30 5.5 AE014298-2334|AAF48566.2| 1311|Drosophila melanogaster CG32577-P... 30 5.5 AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA... 30 5.5 AE014297-2248|AAF55347.1| 630|Drosophila melanogaster CG10328-P... 30 5.5 AE014297-2039|AAF55194.3| 1559|Drosophila melanogaster CG31302-P... 30 5.5 AE014297-2038|AAF55193.3| 1569|Drosophila melanogaster CG31302-P... 30 5.5 AE014297-2037|AAN13660.2| 1622|Drosophila melanogaster CG31302-P... 30 5.5 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 30 5.5 AE014134-1188|AAF52454.1| 258|Drosophila melanogaster CG10203-P... 30 5.5 AE014134-106|AAF51495.1| 1427|Drosophila melanogaster CG4114-PA ... 30 5.5 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 30 5.5 M25545-4|AAA28621.1| 361|Drosophila melanogaster protein ( D.me... 29 7.3 M25545-3|AAA28624.1| 365|Drosophila melanogaster protein ( D.me... 29 7.3 M25545-2|AAA28623.1| 360|Drosophila melanogaster protein ( D.me... 29 7.3 M25545-1|AAA28622.1| 364|Drosophila melanogaster protein ( D.me... 29 7.3 M15766-1|AAA70426.1| 365|Drosophila melanogaster unknown protei... 29 7.3 AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p pro... 29 7.3 AY069429-1|AAL39574.1| 479|Drosophila melanogaster LD13887p pro... 29 7.3 AY061448-1|AAL28996.1| 361|Drosophila melanogaster LD38464p pro... 29 7.3 AY060400-1|AAL25439.1| 482|Drosophila melanogaster LD32009p pro... 29 7.3 AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-P... 29 7.3 AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-P... 29 7.3 AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-P... 29 7.3 AE014298-2104|AAF48424.1| 2075|Drosophila melanogaster CG5627-PA... 29 7.3 AE014297-4248|AAN14144.1| 361|Drosophila melanogaster CG9983-PF... 29 7.3 AE014297-4247|AAN14143.1| 361|Drosophila melanogaster CG9983-PD... 29 7.3 AE014297-4246|AAN14142.1| 365|Drosophila melanogaster CG9983-PC... 29 7.3 AE014297-4245|AAF56801.1| 365|Drosophila melanogaster CG9983-PB... 29 7.3 AE014297-4244|AAN14141.1| 360|Drosophila melanogaster CG9983-PE... 29 7.3 AE014297-4243|AAF56800.2| 364|Drosophila melanogaster CG9983-PA... 29 7.3 AE014297-2379|AAF55444.1| 137|Drosophila melanogaster CG14326-P... 29 7.3 AE014296-1669|AAF50260.2| 783|Drosophila melanogaster CG32043-P... 29 7.3 AE014296-1668|AAF50261.2| 783|Drosophila melanogaster CG32043-P... 29 7.3 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 29 7.3 AE013599-846|AAF58954.1| 482|Drosophila melanogaster CG1975-PA ... 29 7.3 U02042-1|AAA19249.1| 606|Drosophila melanogaster GABA receptor ... 29 9.7 M69057-3|AAA28558.1| 595|Drosophila melanogaster GABA-alpha rec... 29 9.7 M69057-2|AAA28557.1| 601|Drosophila melanogaster GABA-alpha rec... 29 9.7 M69057-1|AAA28556.1| 606|Drosophila melanogaster GABA-alpha rec... 29 9.7 M16152-1|AAB59220.1| 2703|Drosophila melanogaster Notch growth f... 29 9.7 K03508-1|AAA28725.1| 2703|Drosophila melanogaster developmental ... 29 9.7 D17315-1|BAA04135.1| 1454|Drosophila melanogaster diacylglycerol... 29 9.7 BT024238-1|ABC86300.1| 385|Drosophila melanogaster LD04512p pro... 29 9.7 BT023944-1|ABB36448.1| 834|Drosophila melanogaster LD32364p pro... 29 9.7 BT023922-1|ABB36426.1| 1246|Drosophila melanogaster RH04127p pro... 29 9.7 BT023499-1|AAY84899.1| 1400|Drosophila melanogaster LD34134p pro... 29 9.7 BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro... 29 9.7 BT009959-1|AAQ22428.1| 1027|Drosophila melanogaster RH08828p pro... 29 9.7 BT001885-1|AAN71659.1| 359|Drosophila melanogaster SD14463p pro... 29 9.7 BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p pro... 29 9.7 AY795937-1|AAY27534.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY795936-1|AAY27530.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY795935-1|AAY27526.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY795934-1|AAY27522.1| 913|Drosophila melanogaster notch protein. 29 9.7 AY795933-1|AAY27518.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795932-1|AAY27514.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY795931-1|AAY27510.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795930-1|AAY27506.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY795929-1|AAY27502.1| 912|Drosophila melanogaster notch protein. 29 9.7 AY795928-1|AAY27498.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795926-1|AAY27490.1| 916|Drosophila melanogaster notch protein. 29 9.7 AY795925-1|AAY27486.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795924-1|AAY27482.1| 913|Drosophila melanogaster notch protein. 29 9.7 AY795923-1|AAY27478.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795922-1|AAY27474.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795921-1|AAY27470.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY795920-1|AAY27466.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795919-1|AAY27462.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY795918-1|AAY27458.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795917-1|AAY27454.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY795916-1|AAY27450.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795915-1|AAY27446.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY795914-1|AAY27442.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY795913-1|AAY27438.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795912-1|AAY27434.1| 910|Drosophila melanogaster notch protein. 29 9.7 AY795911-1|AAY27429.1| 911|Drosophila melanogaster notch protein. 29 9.7 AY122212-1|AAM52724.1| 658|Drosophila melanogaster LP07906p pro... 29 9.7 AY089465-1|AAL90203.1| 586|Drosophila melanogaster AT27789p pro... 29 9.7 AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p pro... 29 9.7 AY075349-1|AAL68208.1| 1457|Drosophila melanogaster GH23785p pro... 29 9.7 AY069099-1|AAL39244.1| 562|Drosophila melanogaster GH11670p pro... 29 9.7 AY051892-1|AAK93316.1| 349|Drosophila melanogaster LD38046p pro... 29 9.7 AY051749-1|AAK93173.1| 827|Drosophila melanogaster LD27988p pro... 29 9.7 AY051622-1|AAK93046.1| 456|Drosophila melanogaster GH27042p pro... 29 9.7 AM412888-1|CAL85511.1| 116|Drosophila melanogaster CG9080 prote... 29 9.7 AM412887-1|CAL85510.1| 116|Drosophila melanogaster CG9080 prote... 29 9.7 AM412886-1|CAL85509.1| 116|Drosophila melanogaster CG9080 prote... 29 9.7 AM412885-1|CAL85508.1| 116|Drosophila melanogaster CG9080 prote... 29 9.7 AM294873-1|CAL26859.1| 155|Drosophila melanogaster CG10853 prot... 29 9.7 AM294870-1|CAL26856.1| 155|Drosophila melanogaster CG10853 prot... 29 9.7 AL035436-2|CAB37610.1| 2704|Drosophila melanogaster EG:140G11.1,... 29 9.7 AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom... 29 9.7 AE014298-2513|AAF48690.2| 834|Drosophila melanogaster CG8949-PA... 29 9.7 AE014298-2302|AAS65377.1| 1246|Drosophila melanogaster CG9170-PB... 29 9.7 AE014298-2301|AAF48550.1| 1246|Drosophila melanogaster CG9170-PA... 29 9.7 AE014298-2027|AAN09585.1| 2148|Drosophila melanogaster CG1517-PC... 29 9.7 AE014298-2026|AAF48365.2| 2196|Drosophila melanogaster CG1517-PB... 29 9.7 AE014298-1424|AAF46566.2| 349|Drosophila melanogaster CG2961-PA... 29 9.7 AE014298-1356|AAF46513.2| 802|Drosophila melanogaster CG32697-P... 29 9.7 AE014298-1355|AAF46514.2| 827|Drosophila melanogaster CG32697-P... 29 9.7 AE014298-1354|AAN09610.1| 797|Drosophila melanogaster CG32697-P... 29 9.7 AE014298-1254|AAF46430.2| 1457|Drosophila melanogaster CG10966-P... 29 9.7 AE014298-1253|ABI30971.1| 1475|Drosophila melanogaster CG10966-P... 29 9.7 AE014298-962|AAF46206.1| 230|Drosophila melanogaster CG4547-PA ... 29 9.7 AE014298-950|AAF46198.2| 456|Drosophila melanogaster CG3135-PA ... 29 9.7 AE014298-493|AAF45848.2| 2703|Drosophila melanogaster CG3936-PA ... 29 9.7 AE014297-2780|AAF55756.1| 556|Drosophila melanogaster CG4360-PA... 29 9.7 AE014297-1387|AAF54705.1| 586|Drosophila melanogaster CG6946-PB... 29 9.7 AE014297-1386|AAF54704.1| 586|Drosophila melanogaster CG6946-PA... 29 9.7 AE014296-3604|AAF51767.2| 706|Drosophila melanogaster CG32447-P... 29 9.7 AE014296-3603|AAS65094.1| 658|Drosophila melanogaster CG32447-P... 29 9.7 AE014296-1598|AAN11989.1| 585|Drosophila melanogaster CG10537-P... 29 9.7 AE014296-1597|AAF50311.1| 606|Drosophila melanogaster CG10537-P... 29 9.7 AE014296-1596|AAN11988.1| 606|Drosophila melanogaster CG10537-P... 29 9.7 AE014296-1574|AAF50325.2| 562|Drosophila melanogaster CG32031-P... 29 9.7 AE014296-1422|AAF50443.2| 407|Drosophila melanogaster CG7072-PA... 29 9.7 AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA... 29 9.7 AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P... 29 9.7 AE014134-2468|AAF53378.1| 635|Drosophila melanogaster CG17341-P... 29 9.7 AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA... 29 9.7 AE013599-3070|AAF46624.1| 418|Drosophila melanogaster CG15226-P... 29 9.7 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 40.3 bits (90), Expect = 0.004 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 R GK PPPP PPP PPP PP P Sbjct: 63 RHVGKPKAKLPPPPPPPPPPPPPPPPPPPSP 93 Score = 36.3 bits (80), Expect = 0.064 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PPP PP Sbjct: 79 PPPPPPPPPPPPPSPP 94 Score = 35.5 bits (78), Expect = 0.11 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP P P Sbjct: 77 PPPPPPPPPPPPPPPSPP 94 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PP P P Sbjct: 76 PPPPPPPPPPPPPPPPSPPGVPANP 100 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXP 774 PP PP PP PP P P + P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPP 94 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 P K P PP PP P P PPP Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPP 91 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPP 777 P PP PP PP P P PP Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPP 94 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP PP P Sbjct: 75 PPPPPPPPPPPPPPPPPSPPGVP 97 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P P P P Sbjct: 77 PPPPPPPPPPPPPPPSPPGVPANPVSLP 104 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 721 PPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP P P P P P Sbjct: 74 PPPPPPPPPPPPPPPPPPSPPGVP 97 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 39.1 bits (87), Expect = 0.009 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPPPPP 489 Score = 37.9 bits (84), Expect = 0.021 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P P PPP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 36.3 bits (80), Expect = 0.064 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PPP PP Sbjct: 463 PPPPPPPPPPPPPPPP 478 Score = 36.3 bits (80), Expect = 0.064 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PPP PP Sbjct: 464 PPPPPPPPPPPPPPPP 479 Score = 35.9 bits (79), Expect = 0.084 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PPP PP P Sbjct: 463 PPPPPPPPPPPPPPPPP 479 Score = 35.9 bits (79), Expect = 0.084 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PP PP P Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPP 488 Score = 35.9 bits (79), Expect = 0.084 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PPP PP P Sbjct: 466 PPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P PPP P Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 38.7 bits (86), Expect = 0.012 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 152 PPPPPPPPPPPPPPPPPP 169 Score = 35.5 bits (78), Expect = 0.11 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 P PP PPP PPP PP P Sbjct: 150 PAPPPPPPPPPPPPPPPP 167 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXP 774 PP PP PP PP P P H+ P Sbjct: 152 PPPPPPPPPPPPPPPPPPHSHP 173 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP P P Sbjct: 230 PGTTYPQPPPPPPPPPPPPPSYPYP 254 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP P P P + PPP P Sbjct: 238 PPPPPPPPPPPPSYPYPPYPYPPPGPYP 265 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q PPPP PPP P PP P Sbjct: 236 QPPPPPPPPPPPPPSYPYPPYP 257 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P T P P PPP PPP PP Sbjct: 227 PGPPGTTYPQPPPPPPPPPPPPP 249 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPP 682 P PPPP PPP PPP Sbjct: 150 PAPPPPPPPPPPPPPPPPPP 169 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXP-XHNXPPPXXXP 792 PP PP PP PP P H+ PP P Sbjct: 157 PPPPPPPPPPPPPHSHPHSHHPHPPIVTP 185 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP P P P P Sbjct: 235 PQPPPPPPPPPPPPPSYPYPPYPYP 259 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXP----PPXPPXP 697 K P PPPP PPP PP PP P Sbjct: 46 KLPPQHYYPPPPPPPPPPPQHCNCPPGPPGP 76 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P P PPP P Sbjct: 150 PAPPPPPPPPPPPPPP---PPPPHSHP 173 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP PP PP P P + PP P Sbjct: 236 QPPPPPPPPPPPPPSYPYPPYPYPP 260 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP P Sbjct: 158 PPPPPPPPPPPPHSHP 173 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 38.7 bits (86), Expect = 0.012 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 154 PPPPPPPPPPPPPPPPPP 171 Score = 35.5 bits (78), Expect = 0.11 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 P PP PPP PPP PP P Sbjct: 152 PAPPPPPPPPPPPPPPPP 169 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXP 774 PP PP PP PP P P H+ P Sbjct: 154 PPPPPPPPPPPPPPPPPPHSHP 175 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP P P Sbjct: 232 PGTTYPQPPPPPPPPPPPPPSYPYP 256 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP P P P + PPP P Sbjct: 240 PPPPPPPPPPPPSYPYPPYPYPPPGPYP 267 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q PPPP PPP P PP P Sbjct: 238 QPPPPPPPPPPPPPSYPYPPYP 259 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P T P P PPP PPP PP Sbjct: 229 PGPPGTTYPQPPPPPPPPPPPPP 251 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPP 682 P PPPP PPP PPP Sbjct: 152 PAPPPPPPPPPPPPPPPPPP 171 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXP-XHNXPPPXXXP 792 PP PP PP PP P H+ PP P Sbjct: 159 PPPPPPPPPPPPPHSHPHSHHPHPPIVTP 187 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP P P P P Sbjct: 237 PQPPPPPPPPPPPPPSYPYPPYPYP 261 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 4/31 (12%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXP----PPXPPXP 697 K P PPPP PPP PP PP P Sbjct: 48 KLPPQHYYPPPPPPPPPPPQHCNCPPGPPGP 78 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P P PPP P Sbjct: 152 PAPPPPPPPPPPPPPP---PPPPHSHP 175 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP PP PP P P + PP P Sbjct: 238 QPPPPPPPPPPPPPSYPYPPYPYPP 262 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP P Sbjct: 160 PPPPPPPPPPPPHSHP 175 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 38.3 bits (85), Expect = 0.016 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G+ P PPPP PPP PPP PP Sbjct: 325 GQCPSPVTAAPPPPPPPPPPPPPPPP 350 Score = 34.3 bits (75), Expect = 0.26 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PP PPP PPP PP P Sbjct: 332 TAAPPPPPPPPPPPPPPPP 350 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P P P P Sbjct: 336 PPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 ++ Q +P PPP PPP PP P Sbjct: 321 RKSVGQCPSPVTAAPPPPPPPPPPPPP 347 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 38.3 bits (85), Expect = 0.016 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXPPPXPP 691 G+ P PPPP PPP PPP PP Sbjct: 325 GQCPSPVTAAPPPPPPPPPPPPPPPP 350 Score = 34.3 bits (75), Expect = 0.26 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PP PPP PPP PP P Sbjct: 332 TAAPPPPPPPPPPPPPPPP 350 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P P P P Sbjct: 336 PPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 ++ Q +P PPP PPP PP P Sbjct: 321 RKSVGQCPSPVTAAPPPPPPPPPPPPP 347 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 35.9 bits (79), Expect = 0.084 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 RP PPPP PP PP P P T PPP PP Sbjct: 99 RPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPP 157 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P + PPPP PP PPP PP Sbjct: 168 PTVEPPPPPPPAPPTVEPPPPPP 190 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P PPP P Sbjct: 177 PPAPPTVEPPPPPPPAPTKVEPPPPPAP 204 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P PPP P Sbjct: 164 PPAPPTVEPPPPPPPAPPTVEPPPPPPP 191 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PP PP P Sbjct: 143 PAPPTLVPPPPPAPPTIKPPPPPAP 167 Score = 33.1 bits (72), Expect = 0.60 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PP PPP PP Sbjct: 162 PPPPAPPTVEPPPPPP 177 Score = 32.7 bits (71), Expect = 0.79 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PPP PP P PP PP P PPP P Sbjct: 132 PPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 180 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PP PP P Sbjct: 154 PAPPTIKPPPPPAPPTVEPPPPPPP 178 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP P P Sbjct: 151 PPPPAPPTIKPPPPPAPP 168 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 174 PPPPPAPPTVEPPPPPPP 191 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Frame = +2 Query: 644 PPPPXP-PPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 PPPP P P PP P P T PPP PP Sbjct: 95 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 146 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PP PP P Sbjct: 191 PAPTKVEPPPPPAPAEVEPPPPPAP 215 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PP PP P Sbjct: 202 PAPAEVEPPPPPAPTELEPPPPPAP 226 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P P PP PP+P PPP P Sbjct: 87 PAPPKVNPPPPPRPASPKVEPPPPAPP 113 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PP PP P Sbjct: 187 PPPPPAPTKVEPPPPPAP 204 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP P P Sbjct: 210 PPPPAPTELEPPPPPAPP 227 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 35.9 bits (79), Expect = 0.084 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 RP PPPP PP PP P P T PPP PP Sbjct: 362 RPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPP 420 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P + PPPP PP PPP PP Sbjct: 431 PTVEPPPPPPPAPPTVEPPPPPP 453 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P PPP P Sbjct: 440 PPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P PPP P Sbjct: 427 PPAPPTVEPPPPPPPAPPTVEPPPPPPP 454 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PP PP P Sbjct: 406 PAPPTLVPPPPPAPPTIKPPPPPAP 430 Score = 33.1 bits (72), Expect = 0.60 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PP PPP PP Sbjct: 425 PPPPAPPTVEPPPPPP 440 Score = 32.7 bits (71), Expect = 0.79 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PPP PP P PP PP P PPP P Sbjct: 395 PPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 443 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PP PP P Sbjct: 417 PAPPTIKPPPPPAPPTVEPPPPPPP 441 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP P P Sbjct: 414 PPPPAPPTIKPPPPPAPP 431 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 437 PPPPPAPPTVEPPPPPPP 454 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Frame = +2 Query: 644 PPPPXP-PPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 PPPP P P PP P P T PPP PP Sbjct: 358 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PP PP P Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPPAP 478 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PP PP P Sbjct: 465 PAPAEVEPPPPPAPTELEPPPPPAP 489 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P P PP PP+P PPP P Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPP 376 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PP PP P Sbjct: 450 PPPPPAPTKVEPPPPPAP 467 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP P P Sbjct: 473 PPPPAPTELEPPPPPAPP 490 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 35.9 bits (79), Expect = 0.084 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 RP PPPP PP PP P P T PPP PP Sbjct: 362 RPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPP 420 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P + PPPP PP PPP PP Sbjct: 431 PTVEPPPPPPPAPPTVEPPPPPP 453 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P PPP P Sbjct: 440 PPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P PP PP P P PPP P Sbjct: 427 PPAPPTVEPPPPPPPAPPTVEPPPPPPP 454 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PP PP P Sbjct: 406 PAPPTLVPPPPPAPPTIKPPPPPAP 430 Score = 33.1 bits (72), Expect = 0.60 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PP PPP PP Sbjct: 425 PPPPAPPTVEPPPPPP 440 Score = 32.7 bits (71), Expect = 0.79 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PPP PP P PP PP P PPP P Sbjct: 395 PPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 443 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PP PP P Sbjct: 417 PAPPTIKPPPPPAPPTVEPPPPPPP 441 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP P P Sbjct: 414 PPPPAPPTIKPPPPPAPP 431 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 437 PPPPPAPPTVEPPPPPPP 454 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 1/52 (1%) Frame = +2 Query: 644 PPPPXP-PPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 PPPP P P PP P P T PPP PP Sbjct: 358 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PP PP P Sbjct: 454 PAPTKVEPPPPPAPAEVEPPPPPAP 478 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PP PP P Sbjct: 465 PAPAEVEPPPPPAPTELEPPPPPAP 489 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P P PP PP+P PPP P Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPP 376 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PP PP P Sbjct: 450 PPPPPAPTKVEPPPPPAP 467 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP P P Sbjct: 473 PPPPAPTELEPPPPPAPP 490 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 TP P PPP PP PP P T PPP PP Sbjct: 46 TPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 97 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PPP PP PPP P P Sbjct: 86 TTPPPPPPSAPPPPDPATP 104 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 TP P PPP PP PP P T PPP PP Sbjct: 46 TPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 97 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PPP PP PPP P P Sbjct: 86 TTPPPPPPSAPPPPDPATP 104 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 TP P PPP PP PP P T PPP PP Sbjct: 28 TPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPP 79 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PPP PP PPP P P Sbjct: 68 TTPPPPPPSAPPPPDPATP 86 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 90 PQRPWGPPPPPGPPPPGPPP-PPGP 113 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP + P PP PP P P PPP Sbjct: 88 PPPQRPWGPPPPPGPPPPGPPPPP 111 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PPP P P PPP PP P Sbjct: 88 PPPQRPWGPPPPPGP--PPPGPPPP 110 >AY118955-1|AAM50815.1| 911|Drosophila melanogaster LD35748p protein. Length = 911 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GGG GGGGV Sbjct: 211 GTGGSGGGGGGGGGGGGGV 229 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 208 GPGGTGGSGGGGGGGGGG 225 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 214 GSGGGGGGGGGGGGGVGG 231 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 120 PQRPWGPPPPPGPPPPGPPP-PPGP 143 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP + P PP PP P P PPP Sbjct: 118 PPPQRPWGPPPPPGPPPPGPPPPP 141 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PPP P P PPP PP P Sbjct: 118 PPPQRPWGPPPPPGP--PPPGPPPP 140 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PP PP P Sbjct: 383 PPPPPPPPAAVPPPPPPP 400 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 378 PVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P P PP P P PPP P Sbjct: 373 PPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PP PP P Sbjct: 364 PPISTAPPPPPVSAPVVAPPPPPPP 388 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PP PP P Sbjct: 350 PPPPPPPPAAVPPPPPPP 367 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 345 PVVAPPPPPPPPPAAVPPPPPPPMP 369 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P P PP P P PPP P Sbjct: 340 PPVSAPVVAPPPPPPPPPAAVPPPPPPP 367 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PP PP P Sbjct: 331 PPISTAPPPPPVSAPVVAPPPPPPP 355 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PP PP P Sbjct: 383 PPPPPPPPAAVPPPPPPP 400 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 378 PVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P P PP P P PPP P Sbjct: 373 PPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PP PP P Sbjct: 364 PPISTAPPPPPVSAPVVAPPPPPPP 388 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 35.1 bits (77), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PP PP P Sbjct: 383 PPPPPPPPAAVPPPPPPP 400 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PPP PP P Sbjct: 378 PVVAPPPPPPPPPAAVPPPPPPPMP 402 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P P PP P P PPP P Sbjct: 373 PPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP P PP PP P Sbjct: 364 PPISTAPPPPPVSAPVVAPPPPPPP 388 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 120 PQRPWGPPPPPGPPPPGPPP-PPGP 143 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP + P PP PP P P PPP Sbjct: 118 PPPQRPWGPPPPPGPPPPGPPPPP 141 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PPP P P PPP PP P Sbjct: 118 PPPQRPWGPPPPPGP--PPPGPPPP 140 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 90 PQRPWGPPPPPGPPPPGPPP-PPGP 113 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPP 780 PP + P PP PP P P PPP Sbjct: 88 PPPQRPWGPPPPPGPPPPGPPPPP 111 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P Q PPP P P PPP PP P Sbjct: 88 PPPQRPWGPPPPPGP--PPPGPPPP 110 >AE013599-3650|AAF47037.3| 906|Drosophila melanogaster CG5403-PA, isoform A protein. Length = 906 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GGG GGGGV Sbjct: 211 GTGGSGGGGGGGGGGGGGV 229 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 208 GPGGTGGSGGGGGGGGGG 225 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 214 GSGGGGGGGGGGGGGVGG 231 >AE013599-3649|AAO41347.1| 911|Drosophila melanogaster CG5403-PB, isoform B protein. Length = 911 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GGG GGGGV Sbjct: 211 GTGGSGGGGGGGGGGGGGV 229 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 208 GPGGTGGSGGGGGGGGGG 225 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 214 GSGGGGGGGGGGGGGVGG 231 >X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.melanogaster 75B mRNAencoding hypothetical 75B protein. ). Length = 1443 Score = 34.7 bits (76), Expect = 0.20 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q TPP PPP PPP PP P Sbjct: 263 QRQTPPLAPPPPPPPPPPPPPP 284 Score = 33.5 bits (73), Expect = 0.45 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 271 PPPPPPPPPPPPPPP 285 Score = 33.5 bits (73), Expect = 0.45 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 271 PPPPPPPPPPPPPPP 285 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q PP PPP PPP PP P Sbjct: 262 QQRQTPPLAPPPPPPPPPPPPP 283 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXP 759 TPP PP PP PP P P Sbjct: 266 TPPLAPPPPPPPPPPPPP 283 >AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p protein. Length = 393 Score = 34.7 bits (76), Expect = 0.20 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 779 GGGXLWXGXGLGGXGGXXGGXXGG 708 GGG L G GLGG GG GG GG Sbjct: 164 GGGLLGGGGGLGGNGGGGGGLLGG 187 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P + PPP PPP PPP PP Sbjct: 468 PVKKPAAAPPPPPPPPPPPPPPP 490 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPP 679 K+P PPPP PPP PP Sbjct: 470 KKPAAAPPPPPPPPPPPPPPP 490 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P P PPP PPP PP P Sbjct: 465 PLSPVKKPAAAPPPPPPPPPPPPPP 489 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P + PPP PPP PPP PP Sbjct: 650 PVKKPAAAPPPPPPPPPPPPPPP 672 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPP 679 K+P PPPP PPP PP Sbjct: 652 KKPAAAPPPPPPPPPPPPPPP 672 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P P PPP PPP PP P Sbjct: 647 PLSPVKKPAAAPPPPPPPPPPPPPP 671 >AE014297-416|AAF51905.3| 393|Drosophila melanogaster CG10303-PA protein. Length = 393 Score = 34.7 bits (76), Expect = 0.20 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 779 GGGXLWXGXGLGGXGGXXGGXXGG 708 GGG L G GLGG GG GG GG Sbjct: 164 GGGLLGGGGGLGGNGGGGGGLLGG 187 >AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB, isoform B protein. Length = 1412 Score = 34.7 bits (76), Expect = 0.20 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q TPP PPP PPP PP P Sbjct: 261 QRQTPPLAPPPPPPPPPPPPPP 282 Score = 33.5 bits (73), Expect = 0.45 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP 688 PPPP PPP PPP P Sbjct: 269 PPPPPPPPPPPPPPP 283 Score = 33.5 bits (73), Expect = 0.45 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 269 PPPPPPPPPPPPPPP 283 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q PP PPP PPP PP P Sbjct: 260 QQRQTPPLAPPPPPPPPPPPPP 281 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXP 759 TPP PP PP PP P P Sbjct: 264 TPPLAPPPPPPPPPPPPP 281 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P + PPP PPP PPP PP Sbjct: 650 PVKKPAAAPPPPPPPPPPPPPPP 672 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPP 679 K+P PPPP PPP PP Sbjct: 652 KKPAAAPPPPPPPPPPPPPPP 672 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P P PPP PPP PP P Sbjct: 647 PLSPVKKPAAAPPPPPPPPPPPPPP 671 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P + PPP PPP PPP PP Sbjct: 650 PVKKPAAAPPPPPPPPPPPPPPP 672 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPP 679 K+P PPPP PPP PP Sbjct: 652 KKPAAAPPPPPPPPPPPPPPP 672 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P P PPP PPP PP P Sbjct: 647 PLSPVKKPAAAPPPPPPPPPPPPPP 671 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXP 688 +P PPPP PPP PPP P Sbjct: 220 KPSRPNRRPPPPPPPPPPPPPPP 242 Score = 33.5 bits (73), Expect = 0.45 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 228 PPPPPPPPPPPPPPP 242 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPP 691 RP + PPPP PPP PP P Sbjct: 223 RPNRRPPPPPPPPPPPPPPPTLSP 246 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXP 688 +RP PPPP PPP P P Sbjct: 226 RRPPPPPPPPPPPPPPPTLSPSLP 249 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P + P PPP PPP PP P Sbjct: 216 PPFYKPSRPNRRPPPPPPPPPPPPP 240 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P + P PPP PPP PP P Sbjct: 217 PFYKPSRPNRRPPPPPPPPPPPPPP 241 >AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p protein. Length = 118 Score = 34.3 bits (75), Expect = 0.26 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFPXXR 604 G GG GGG GGG GGGG G P R Sbjct: 70 GGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR 100 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 65 GGGGGGGGGGGGGGGGGG 82 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 66 GGGGGGGGGGGGGGGGGG 83 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 67 GGGGGGGGGGGGGGGGGG 84 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 68 GGGGGGGGGGGGGGGGGG 85 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 69 GGGGGGGGGGGGGGGGGG 86 >AL031583-7|CAB41346.1| 359|Drosophila melanogaster EG:34F3.10 protein. Length = 359 Score = 34.3 bits (75), Expect = 0.26 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP-PXP 697 PPPP PPP PPP P P P Sbjct: 170 PPPPLPPPPPPPPRPTPIP 188 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP P P Sbjct: 169 PPPPPLPPPPPPPPRPTP 186 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PP PP PPP PP P Sbjct: 166 TRRPPPPPLPPPPPPPPRP 184 >AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA protein. Length = 118 Score = 34.3 bits (75), Expect = 0.26 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFPXXR 604 G GG GGG GGG GGGG G P R Sbjct: 70 GGGGGGGGGGGGGGGGGGSGYRGGGLRPNRR 100 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 65 GGGGGGGGGGGGGGGGGG 82 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 66 GGGGGGGGGGGGGGGGGG 83 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 67 GGGGGGGGGGGGGGGGGG 84 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 68 GGGGGGGGGGGGGGGGGG 85 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 69 GGGGGGGGGGGGGGGGGG 86 >AE014298-111|AAF45553.2| 359|Drosophila melanogaster CG13358-PA protein. Length = 359 Score = 34.3 bits (75), Expect = 0.26 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = +2 Query: 644 PPPPXPPPXXPPPXP-PXP 697 PPPP PPP PPP P P P Sbjct: 170 PPPPLPPPPPPPPRPTPIP 188 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PPP P P Sbjct: 169 PPPPPLPPPPPPPPRPTP 186 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXP 697 T PP PP PPP PP P Sbjct: 166 TRRPPPPPLPPPPPPPPRP 184 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 34.3 bits (75), Expect = 0.26 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPPXP 697 RP +PP PPP PPP PP P Sbjct: 50 RPPPPPPSPPCGRPPPGSPPPGPPPP 75 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPP PPP PPP PP Sbjct: 56 PSPPCGRPPPGSPPPGPPPPGPP 78 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PPP P P Sbjct: 46 PDPTRPPPPPPSPPCGRPPPGSPPP 70 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +PP PP PP P PPP P Sbjct: 48 PTRPPPPPPSPPCGRPPPGSPPPGPPP 74 Score = 29.5 bits (63), Expect = 7.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP P Sbjct: 68 PPPGPPPPGPPPGCP 82 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 P P P P PPP PP P Sbjct: 42 PNPVPDPTRPPPPPPSP 58 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PP PPP P P Sbjct: 63 PPPGSPPPGPPPPGPPP 79 >AE014298-2781|AAF48895.2| 1868|Drosophila melanogaster CG7282-PA protein. Length = 1868 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFP 613 G GG GGG GGG GGGG G P Sbjct: 158 GGGGGGGGGGGGGGGGGGGSLLVQGSQP 185 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 156 GSGGGGGGGGGGGGGGGG 173 >AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-PA protein. Length = 239 Score = 33.9 bits (74), Expect = 0.34 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPP 780 P KPP PP PP P P ++ PP Sbjct: 35 PVKPPAPPPRPPPPAPANSYGPP 57 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXP 688 RP PP PPP PPP P Sbjct: 28 RPPATYLPVKPPAPPPRPPPPAP 50 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPP-----PXXPPPXPPXP 697 K+P PPPP PP P PPP PP P Sbjct: 178 KKPNHGQYPPPPPPPPYYPPYPYYPPPPPPPP 209 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Frame = +1 Query: 709 PPXKPPXXPPXP--PKPXPXHNXPPP 780 PP PP PP P P P P PPP Sbjct: 188 PPPPPPYYPPYPYYPPPPPPPPLPPP 213 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 181 GRGGRGGGRGGGGRGGGG 198 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 25 GFGGGGGGRGGGGGRGGG 42 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 20 GGGGRGFGGGGGGRGGGG 37 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 696 GXGGXGG-GXXGGGXGGGG 643 G GG GG G GGG GGGG Sbjct: 175 GGGGFGGRGGRGGGRGGGG 193 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 57 GRGGFGGGRGGGGRGGGG 74 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGR 619 G GG GGG GGG GGG G+ Sbjct: 91 GGGGRGGGGRGGGGRGGGAGGFKGGK 116 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 21 GGGGGGGGFRGRGGGGGG 38 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 34 GGGGGGGGGFGGGRGRGG 51 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 82 GGRGGGGGRGGGGRGGGG 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 86 GGGGRGGGGRGGGGRGGG 103 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 87 GGGRGGGGRGGGGRGGGG 104 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 696 GXGGXGGGXXGG-GXGGGG 643 G GG GGG GG G GGGG Sbjct: 35 GGGGGGGGFGGGRGRGGGG 53 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 690 GGXGGGXXGGGXGGG 646 GG GGG GGG GGG Sbjct: 63 GGRGGGGRGGGGGGG 77 >U62542-1|AAB05771.1| 901|Drosophila melanogaster dead ringer protein. Length = 901 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 203 GTGGSGGGGAGGGGGGGG 220 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 G GGG GGG GGGGV Sbjct: 206 GSGGGGAGGGGGGGGGV 222 >DQ285021-1|ABB90104.1| 110|Drosophila melanogaster G-rich selenoprotein protein. Length = 110 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 60 GGGGWGGGGGGGGGGGGG 77 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 55 GNGWGGGGGWGGGGGGGG 72 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 57 GWGGGGGWGGGGGGGGGG 74 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 59 GGGGGWGGGGGGGGGGGG 76 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG W G G GG GG G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/20 (65%), Positives = 13/20 (65%), Gaps = 2/20 (10%) Frame = +2 Query: 644 PPPPXP--PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 1282 PPPPLPLTPPAAPPPPPPPP 1301 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P P + P P Sbjct: 1287 PLTPPAAPPPPPPPPPEADDPSSVALP 1313 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 33.5 bits (73), Expect = 0.45 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P + PPP P Sbjct: 490 PPPPPPPPPPPPPPLANYGAPPPPPPP 516 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +2 Query: 623 PXXQXXTPPPPXPPP----XXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 503 PLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP PPP PP Sbjct: 483 PLHAFVAPPPPPPPP--PPPPPP 503 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPP--------PXXPPPXPPXP 697 G++P PPPP PP P PPP PP P Sbjct: 467 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPP 502 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXPPPXX----PPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 496 PPPPPPPPLANYGAPPPPPPPP 517 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPP PPP PPP P Sbjct: 482 PPLHAFVAPPPPPPPPPPPPPP 503 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 4/53 (7%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXX----PPXPPKPXPXHNXPPPXXXP 792 PPP PP PP PP PP P P PP P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 >AY060611-1|AAL28159.1| 108|Drosophila melanogaster GH03581p protein. Length = 108 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 60 GGGGWGGGGGGGGGGGGG 77 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 55 GNGWGGGGGWGGGGGGGG 72 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 57 GWGGGGGWGGGGGGGGGG 74 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 59 GGGGGWGGGGGGGGGGGG 76 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG W G G GG GG G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 >AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p protein. Length = 455 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 348 GRGGGGGGGFGGGRGGGG 365 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 353 GGGGFGGGRGGGGGGGGG 370 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 352 GGGGGFGGGRGGGGGGGG 369 >AF396454-1|AAK72981.1| 110|Drosophila melanogaster G-rich selenoprotein protein. Length = 110 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 60 GGGGWGGGGGGGGGGGGG 77 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 55 GNGWGGGGGWGGGGGGGG 72 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 57 GWGGGGGWGGGGGGGGGG 74 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 59 GGGGGWGGGGGGGGGGGG 76 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG W G G GG GG G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 >AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-PA protein. Length = 2030 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 1282 GGGGNGGGGNGGGGGGGG 1299 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 1283 GGGNGGGGNGGGGGGGGG 1300 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 1285 GNGGGGNGGGGGGGGGGG 1302 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 1287 GGGGNGGGGGGGGGGGG 1303 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 G GGG GGG GGGG Sbjct: 1280 GSGGGGNGGGGNGGGG 1295 >AE014298-1711|AAF48111.2| 110|Drosophila melanogaster CG1844-PA protein. Length = 110 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 60 GGGGWGGGGGGGGGGGGG 77 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 55 GNGWGGGGGWGGGGGGGG 72 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 57 GWGGGGGWGGGGGGGGGG 74 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 59 GGGGGWGGGGGGGGGGGG 76 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG W G G GG GG G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/20 (65%), Positives = 13/20 (65%), Gaps = 2/20 (10%) Frame = +2 Query: 644 PPPPXP--PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 1342 PPPPLPLTPPAAPPPPPPPP 1361 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P P + P P Sbjct: 1347 PLTPPAAPPPPPPPPPEADDPSSVALP 1373 >AE014298-1050|AAF46265.4| 1268|Drosophila melanogaster CG12690-PA protein. Length = 1268 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 600 GGGGGGGGGSGGGGGGGG 617 >AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA protein. Length = 454 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 348 GRGGGGGGGFGGGRGGGG 365 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 353 GGGGFGGGRGGGGGGGGG 370 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 352 GGGGGFGGGRGGGGGGGG 369 >AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-PA protein. Length = 98 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 51 GGGGGGGGKHGGGGGGGG 68 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 61 GGGGGGGGKHGGGNGGGG 78 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 71 GGGNGGGGKHGGGGGGGG 88 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 41 GGGGQGGWQKGGGGGGGG 58 >AE014134-1928|AAF52988.1| 96|Drosophila melanogaster CG17107-PA protein. Length = 96 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 23 GFGGFGGGGGGGGRGGGG 40 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 GG GGG GGG GGGGV Sbjct: 29 GGGGGGGRGGGGGGGGV 45 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 28 GGGGGGGGRGGGGGGGG 44 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 32 GGGGRGGGGGGGGVGGVG 49 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 33.5 bits (73), Expect = 0.45 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P + PPP P Sbjct: 500 PPPPPPPPPPPPPPLANYGAPPPPPPP 526 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +2 Query: 623 PXXQXXTPPPPXPPP----XXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 513 PLANYGAPPPPPPPPPGSGSAPPPPPPAP 541 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP PPP PP Sbjct: 493 PLHAFVAPPPPPPPP--PPPPPP 513 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPP--------PXXPPPXPPXP 697 G++P PPPP PP P PPP PP P Sbjct: 477 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPP 512 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXPPPXX----PPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 506 PPPPPPPPLANYGAPPPPPPPP 527 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPP PPP PPP P Sbjct: 492 PPLHAFVAPPPPPPPPPPPPPP 513 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 4/53 (7%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXX----PPXPPKPXPXHNXPPPXXXP 792 PPP PP PP PP PP P P PP P Sbjct: 487 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 33.5 bits (73), Expect = 0.45 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P + PPP P Sbjct: 490 PPPPPPPPPPPPPPLANYGAPPPPPPP 516 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +2 Query: 623 PXXQXXTPPPPXPPP----XXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 503 PLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP PPP PP Sbjct: 483 PLHAFVAPPPPPPPP--PPPPPP 503 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPP--------PXXPPPXPPXP 697 G++P PPPP PP P PPP PP P Sbjct: 467 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPP 502 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXPPPXX----PPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 496 PPPPPPPPLANYGAPPPPPPPP 517 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPP PPP PPP P Sbjct: 482 PPLHAFVAPPPPPPPPPPPPPP 503 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 4/53 (7%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXX----PPXPPKPXPXHNXPPPXXXP 792 PPP PP PP PP PP P P PP P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 33.5 bits (73), Expect = 0.45 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P + PPP P Sbjct: 648 PPPPPPPPPPPPPPLANYGAPPPPPPP 674 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +2 Query: 623 PXXQXXTPPPPXPPP----XXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 661 PLANYGAPPPPPPPPPGSGSAPPPPPPAP 689 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP PPP PP Sbjct: 641 PLHAFVAPPPPPPPP--PPPPPP 661 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPP--------PXXPPPXPPXP 697 G++P PPPP PP P PPP PP P Sbjct: 625 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPP 660 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXPPPXX----PPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 654 PPPPPPPPLANYGAPPPPPPPP 675 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPP PPP PPP P Sbjct: 640 PPLHAFVAPPPPPPPPPPPPPP 661 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 4/53 (7%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXX----PPXPPKPXPXHNXPPPXXXP 792 PPP PP PP PP PP P P PP P Sbjct: 635 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 33.5 bits (73), Expect = 0.45 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P PP PP PP P + PPP P Sbjct: 595 PPPPPPPPPPPPPPLANYGAPPPPPPP 621 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +2 Query: 623 PXXQXXTPPPPXPPP----XXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 608 PLANYGAPPPPPPPPPGSGSAPPPPPPAP 636 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PPP PPP PP Sbjct: 588 PLHAFVAPPPPPPPP--PPPPPP 608 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPP--------PXXPPPXPPXP 697 G++P PPPP PP P PPP PP P Sbjct: 572 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPP 607 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXPPPXX----PPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 601 PPPPPPPPLANYGAPPPPPPPP 622 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPP PPP PPP P Sbjct: 587 PPLHAFVAPPPPPPPPPPPPPP 608 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 4/53 (7%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXX----PPXPPKPXPXHNXPPPXXXP 792 PPP PP PP PP PP P P PP P Sbjct: 582 PPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 50 GRGGFGGGRGGGGRGGGG 67 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGR 619 G GG GGG GGG GGG G+ Sbjct: 84 GGGGRGGGGRGGGGRGGGAGGFKGGK 109 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 14 GGGGGGGGFRGRGGGGGG 31 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 27 GGGGGGGGGFGGGRGRGG 44 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 75 GGRGGGGGRGGGGRGGGG 92 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 79 GGGGRGGGGRGGGGRGGG 96 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 80 GGGRGGGGRGGGGRGGGG 97 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 696 GXGGXGGGXXGG-GXGGGG 643 G GG GGG GG G GGGG Sbjct: 28 GGGGGGGGFGGGRGRGGGG 46 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 690 GGXGGGXXGGGXGGG 646 GG GGG GGG GGG Sbjct: 56 GGRGGGGRGGGGGGG 70 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 180 GFGGRGGGRGGGGRGGGG 197 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 8 GGGGGGGRGFGGGGGGGG 25 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 27 GFGGGGGGRGGGGGRGGG 44 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 22 GGGGRGFGGGGGGRGGGG 39 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 175 GGGGGGFGGRGGGRGGGG 192 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 49 GGGGFGGGGAGGGYGGGG 66 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G G G G G GG GG GG GG Sbjct: 33 GGSPGAGLQGPGGGFGGGGGFGGGGAGG 60 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 49 GGGGFGGGGAGGGYGGGG 66 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 257 GGSGFGGGGAGGGSGGGG 274 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 262 GGGGAGGGSGGGGGGAGG 279 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 341 GQGGAGGGYGGGGGGGRG 358 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 370 GGGGFGGQGGGGGFGGGG 387 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 406 GQGGAGGGYGGGGGRGGG 423 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 436 GGGGFGGQGGGGGFGGGG 453 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 344 GAGGGYGGGGGGGRGGGG 361 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G G G G G GG GG GG GG Sbjct: 33 GGSPGAGLQGPGGGFGGGGGFGGGGAGG 60 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 696 GXGGXGG-GXXGGGXGGGG 643 G GG GG G GGG GGGG Sbjct: 335 GGGGFGGQGGAGGGYGGGG 353 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 696 GXGGXGG-GXXGGGXGGGG 643 G GG GG G GGG GGGG Sbjct: 400 GGGGYGGQGGAGGGYGGGG 418 >AE013599-1122|AAF58779.3| 757|Drosophila melanogaster CG12052-PJ, isoform J protein. Length = 757 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 678 GSGGAGGGIGGGGSGGGG 695 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 684 GGIGGGGSGGGGGGGG 699 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXC 631 G GG G G GGG GGGG C Sbjct: 685 GIGGGGSGGGGGG-GGGGAYAC 705 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 683 GGGIGGGGSGGGGGGGGG 700 >AB107346-1|BAC67651.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 678 GSGGAGGGIGGGGSGGGG 695 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 684 GGIGGGGSGGGGGGGG 699 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXC 631 G GG G G GGG GGGG C Sbjct: 685 GIGGGGSGGGGGG-GGGGAYAC 705 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 683 GGGIGGGGSGGGGGGGGG 700 >AB107326-1|BAC67631.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 678 GSGGAGGGIGGGGSGGGG 695 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 684 GGIGGGGSGGGGGGGG 699 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXC 631 G GG G G GGG GGGG C Sbjct: 685 GIGGGGSGGGGGG-GGGGAYAC 705 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 683 GGGIGGGGSGGGGGGGGG 700 >AB107306-1|BAC67611.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 678 GSGGAGGGIGGGGSGGGG 695 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 684 GGIGGGGSGGGGGGGG 699 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXC 631 G GG G G GGG GGGG C Sbjct: 685 GIGGGGSGGGGGG-GGGGAYAC 705 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 683 GGGIGGGGSGGGGGGGGG 700 >AB107286-1|BAC67591.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGGG Sbjct: 678 GSGGAGGGIGGGGSGGGG 695 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 684 GGIGGGGSGGGGGGGG 699 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXC 631 G GG G G GGG GGGG C Sbjct: 685 GIGGGGSGGGGGG-GGGGAYAC 705 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 683 GGGIGGGGSGGGGGGGGG 700 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +2 Query: 623 PXXQXXTPPPPXPPP----XXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 512 PLANYGAPPPPPPPPPGSGSAPPPPPPAP 540 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPPPXXP----PPXPPXP 697 G++P PPPP PPP P PP PP P Sbjct: 477 GEKP--HAVAPPPPPPPPPLPAFVAPPPPPPP 506 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXP----PPXXPPPXPPXP 697 PPPP P PP PPP PP P Sbjct: 490 PPPPLPAFVAPPPPPPPPPPPP 511 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPP 682 P PPPP PPP PPP Sbjct: 493 PLPAFVAPPPPPPPPPPPPP 512 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P + PPP P Sbjct: 500 PPPPPP--PPPPPPPLANYGAPPPPPPP 525 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXPPPXX----PPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 505 PPPPPPPPLANYGAPPPPPPPP 526 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 4/53 (7%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXX----PPXPPKPXPXHNXPPPXXXP 792 PPP PP PP PP PP P P PP P Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 538 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPP PPP PPP PP Sbjct: 492 PPLPAFVAPPPPPPP--PPPPPP 512 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +2 Query: 623 PXXQXXTPPPPXPPP----XXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 607 PMANYGAPPPPPPPPPGSGSAPPPPPPAP 635 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPP--------PXXPPPXPPXP 697 G++P PPPP PP P PPP PP P Sbjct: 572 GEKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPP 607 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P + PPP P Sbjct: 595 PPPPPP--PPPPPPPMANYGAPPPPPPP 620 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXPPPXX----PPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 600 PPPPPPPPMANYGAPPPPPPPP 621 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 4/53 (7%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXX----PPXPPKPXPXHNXPPPXXXP 792 PPP PP PP PP PP P P PP P Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPP 633 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +2 Query: 623 PXXQXXTPPPPXPPP----XXPPPXPPXP 697 P PPPP PPP PPP PP P Sbjct: 740 PMANYGAPPPPPPPPPGSGSAPPPPPPAP 768 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 8/36 (22%) Frame = +2 Query: 614 GKRPXXQXXTPPPPXPP--------PXXPPPXPPXP 697 G++P PPPP PP P PPP PP P Sbjct: 705 GEKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPP 740 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP PP P + PPP P Sbjct: 728 PPPPPP--PPPPPPPMANYGAPPPPPPP 753 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 4/22 (18%) Frame = +2 Query: 644 PPPPXPPPXX----PPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 733 PPPPPPPPMANYGAPPPPPPPP 754 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 4/53 (7%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXX----PPXPPKPXPXHNXPPPXXXP 792 PPP PP PP PP PP P P PP P Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPP 766 >AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p protein. Length = 217 Score = 33.1 bits (72), Expect = 0.60 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP P P PP Sbjct: 98 PPPPPPPPPAPAPPPP 113 Score = 33.1 bits (72), Expect = 0.60 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 99 PPPPPPPPAPAPPPPP 114 Score = 29.9 bits (64), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 650 PPXPPPXXPPPXPPXP 697 PP PPP P P PP P Sbjct: 98 PPPPPPPPPAPAPPPP 113 Score = 29.5 bits (63), Expect = 7.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP P PP P Sbjct: 98 PPPPPPPPPAPAPPPPP 114 >AY069647-1|AAL39792.1| 337|Drosophila melanogaster LD41395p protein. Length = 337 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 GG GGG GGG GGGGV Sbjct: 312 GGPGGGGGGGGGGGGGV 328 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 313 GPGGGGGGGGGGGGGVGG 330 >AE014296-2974|AAF49295.1| 337|Drosophila melanogaster CG5546-PA protein. Length = 337 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 GG GGG GGG GGGGV Sbjct: 312 GGPGGGGGGGGGGGGGV 328 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 313 GPGGGGGGGGGGGGGVGG 330 >X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein protein. Length = 188 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGVXXCXXGRF 616 GG GGG GGG GGGG G F Sbjct: 43 GGFGGGLGGGGGGGGGGYQAVSGGF 67 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 36 GFGGGFGGGFGGGLGGGG 53 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 40 GFGGGFGGGLGGGGGGGG 57 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 690 GGXGGGXXGGGXGGG 646 GG GGG GGG GGG Sbjct: 30 GGGGGGGFGGGFGGG 44 >M57889-1|AAA28920.1| 1322|Drosophila melanogaster su(s) protein protein. Length = 1322 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GG GGG GGGGV Sbjct: 1149 GGGGDSGGGVGGGGGGGGV 1167 >AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p protein. Length = 188 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGVXXCXXGRF 616 GG GGG GGG GGGG G F Sbjct: 43 GGFGGGLGGGGGGGGGGYQAVSGGF 67 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 36 GFGGGFGGGFGGGLGGGG 53 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 40 GFGGGFGGGLGGGGGGGG 57 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 690 GGXGGGXXGGGXGGG 646 GG GGG GGG GGG Sbjct: 30 GGGGGGGFGGGFGGG 44 >AY094731-1|AAM11084.1| 708|Drosophila melanogaster GH25793p protein. Length = 708 Score = 32.7 bits (71), Expect = 0.79 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 4 PPPPGPPPPPGPPPPP 19 >AY089487-1|AAL90225.1| 293|Drosophila melanogaster AT31162p protein. Length = 293 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPP 691 ++P Q TPP P PPP P P PP Sbjct: 15 RKPTGQRSTPP-PRPPPHVPAPAPP 38 >AY071563-1|AAL49185.1| 1220|Drosophila melanogaster RE63043p protein. Length = 1220 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GG GGG GGGGV Sbjct: 1152 GGGGDSGGGVGGGGGGGGV 1170 >AL031581-8|CAA20886.1| 1325|Drosophila melanogaster EG:115C2.3,FBgn0003575;su(s) protein. Length = 1325 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GG GGG GGGGV Sbjct: 1152 GGGGDSGGGVGGGGGGGGV 1170 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 32.7 bits (71), Expect = 0.79 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP PPP PP PP P Sbjct: 170 PPPPPPPPPPPTAPPRP 186 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PPP PP P P Sbjct: 173 PPPPPPPPTAPPRPRPRP 190 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/56 (30%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Frame = +1 Query: 631 TTXXXPPPXXXXXXXXXXXXXXXXXTPPXKPPXXPP--XPPKPXPXHNXPPPXXXP 792 TT PPP PP PP PP PP+P P P P Sbjct: 144 TTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPPRPRPRPRPRPQQPDP 199 >AE014298-82|AAF45534.1| 1325|Drosophila melanogaster CG6222-PA protein. Length = 1325 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GG GGG GGGGV Sbjct: 1152 GGGGDSGGGVGGGGGGGGV 1170 >AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA protein. Length = 193 Score = 32.7 bits (71), Expect = 0.79 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -2 Query: 795 GGXXXGGGXVVXXXWXXXXXXXXXXXXXXXXXXGXGGXGGGXXGGGXGGGG 643 GG GGG V G GG GGG GG GGGG Sbjct: 36 GGGHGGGGDVQIIKVITESGSSGGGGGGGGWSSGGGGGGGGWSSGGGGGGG 86 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 168 GHGGAGGGGGHGGGGGGG 185 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GG GGGG Sbjct: 23 GGSGGGWSSGGGGGGG 38 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GG GGG GGGG Sbjct: 167 GGHGGAGGGGGHGGGG 182 >AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA protein. Length = 188 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGVXXCXXGRF 616 GG GGG GGG GGGG G F Sbjct: 43 GGFGGGLGGGGGGGGGGYQAVSGGF 67 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 36 GFGGGFGGGFGGGLGGGG 53 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 40 GFGGGFGGGLGGGGGGGG 57 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 690 GGXGGGXXGGGXGGG 646 GG GGG GGG GGG Sbjct: 30 GGGGGGGFGGGFGGG 44 >AE014297-1179|AAF54542.1| 293|Drosophila melanogaster CG4073-PA protein. Length = 293 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPP 691 ++P Q TPP P PPP P P PP Sbjct: 15 RKPTGQRSTPP-PRPPPHVPAPAPP 38 >AE013599-3336|AAM68207.1| 751|Drosophila melanogaster CG13503-PD, isoform D protein. Length = 751 Score = 32.7 bits (71), Expect = 0.79 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 4 PPPPGPPPPPGPPPPP 19 >AE013599-3335|AAM68206.1| 751|Drosophila melanogaster CG13503-PC, isoform C protein. Length = 751 Score = 32.7 bits (71), Expect = 0.79 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 4 PPPPGPPPPPGPPPPP 19 >AE013599-3334|AAM68205.1| 751|Drosophila melanogaster CG13503-PB, isoform B protein. Length = 751 Score = 32.7 bits (71), Expect = 0.79 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 4 PPPPGPPPPPGPPPPP 19 >AE013599-3333|AAF46800.2| 751|Drosophila melanogaster CG13503-PA, isoform A protein. Length = 751 Score = 32.7 bits (71), Expect = 0.79 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 4 PPPPGPPPPPGPPPPP 19 >AE013599-3332|AAM68204.1| 708|Drosophila melanogaster CG13503-PF, isoform F protein. Length = 708 Score = 32.7 bits (71), Expect = 0.79 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 4 PPPPGPPPPPGPPPPP 19 >AE013599-3331|AAM68208.2| 761|Drosophila melanogaster CG13503-PE, isoform E protein. Length = 761 Score = 32.7 bits (71), Expect = 0.79 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP PP PP Sbjct: 14 PPPPGPPPPPGPPPPP 29 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 617 KRPXXQXXTPPPPXPPPXXPPPXPPXP 697 KR Q PPP PP PPP PP P Sbjct: 4 KRSSKQKMAIPPPPGPP--PPPGPPPP 28 >X54251-1|CAA38152.1| 1596|Drosophila melanogaster nuclear protein protein. Length = 1596 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFP 613 G GG G G G G G GGV GRFP Sbjct: 1234 GGGGVGVGGVGVGVGVGGVGGANGGRFP 1261 >BT023751-1|AAZ41759.1| 1594|Drosophila melanogaster RH56202p protein. Length = 1594 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFP 613 G GG G G G G G GGV GRFP Sbjct: 1233 GGGGVGVGGVGVGVGVGGVGGANGGRFP 1260 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 599 PPPPMAPSMMPPPPPPCP 616 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP P P PPP P Sbjct: 602 PMAPSMMPPPPPPCPGAPPPPP 623 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 709 PPXKPPXXP---PXPPKPXPXHNXPPP 780 PP PP P P PP P P PPP Sbjct: 597 PPPPPPMAPSMMPPPPPPCPGAPPPPP 623 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 560 PPPPMAPSMMPPPPPPCP 577 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP P P PPP P Sbjct: 563 PMAPSMMPPPPPPCPGAPPPPP 584 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 709 PPXKPPXXP---PXPPKPXPXHNXPPP 780 PP PP P P PP P P PPP Sbjct: 558 PPPPPPMAPSMMPPPPPPCPGAPPPPP 584 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 384 PPPPAPPAGVPPAPPPMP 401 Score = 29.5 bits (63), Expect = 7.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PP PP PP Sbjct: 383 PPPPPAPPAGVPPAPP 398 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 T PPP PPP P P PP P PPP PP Sbjct: 73 TRPPPPPPP--PQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPP 122 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP PP P+P P + PPP P Sbjct: 207 QPPPPPPPRPQPTPGYGPPPPPPPP 231 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPP 691 +P PPP PP PPP PP Sbjct: 132 QPTPSAPAPPPSYGPPQTPPPRPP 155 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 R RP PP P P P PP PP P Sbjct: 200 RPTPSRPQPPPPPPPRPQPTPGYGPPPPPPP 230 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +P PP PP+P P PP P Sbjct: 203 PSRPQPPPPPPPRPQPTPGYGPPPPPP 229 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 TP PP PP PPKP P PP P Sbjct: 219 TPGYGPPPPPP-PPKPQPTPGYGPPTPPP 246 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 620 RPXXQXXTPPPP-XPPPXXPPPXPP 691 +P PPPP PP PPP PP Sbjct: 106 QPTPSAPAPPPPSYGPPQTPPPRPP 130 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +1 Query: 706 TPPXKPPXXP-PXPPKPXPXHNXP--PPXXXP 792 TPP +PP P P P P P + P PP P Sbjct: 124 TPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPP 155 Score = 29.1 bits (62), Expect = 9.7 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PPP PP PP P P P P PP P Sbjct: 79 PPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPP 127 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +1 Query: 709 PPXKPPXXPP--XPPKPXPXHNXPPPXXXP 792 P PP PP PP+P P PPP P Sbjct: 117 PSYGPPQTPPPRPPPQPTPSAPAPPPSYGP 146 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 721 PPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP P+P P + P P P Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPPGP 248 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP P P P P PP P Sbjct: 244 PPPGPGPAQPAPQPPRP 260 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 405 PPPPMAPSMMPPPPPPCP 422 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP P P PPP P Sbjct: 408 PMAPSMMPPPPPPCPGAPPPPP 429 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 709 PPXKPPXXP---PXPPKPXPXHNXPPP 780 PP PP P P PP P P PPP Sbjct: 403 PPPPPPMAPSMMPPPPPPCPGAPPPPP 429 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 560 PPPPMAPSMMPPPPPPCP 577 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP P P PPP P Sbjct: 563 PMAPSMMPPPPPPCPGAPPPPP 584 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 709 PPXKPPXXP---PXPPKPXPXHNXPPP 780 PP PP P P PP P P PPP Sbjct: 558 PPPPPPMAPSMMPPPPPPCPGAPPPPP 584 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 599 PPPPMAPSMMPPPPPPCP 616 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP P P PPP P Sbjct: 602 PMAPSMMPPPPPPCPGAPPPPP 623 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 709 PPXKPPXXP---PXPPKPXPXHNXPPP 780 PP PP P P PP P P PPP Sbjct: 597 PPPPPPMAPSMMPPPPPPCPGAPPPPP 623 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP P PPP PP P Sbjct: 901 PPPPMAPSMMPPPPPPCP 918 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXP 688 P PPPP P P PPP P Sbjct: 904 PMAPSMMPPPPPPCPGAPPPPP 925 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 709 PPXKPPXXP---PXPPKPXPXHNXPPP 780 PP PP P P PP P P PPP Sbjct: 899 PPPPPPMAPSMMPPPPPPCPGAPPPPP 925 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 384 PPPPAPPAGVPPAPPPMP 401 Score = 29.5 bits (63), Expect = 7.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PP PP PP Sbjct: 383 PPPPPAPPAGVPPAPP 398 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 500 PPPPAPPAGVPPAPPPMP 517 Score = 29.5 bits (63), Expect = 7.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PP PP PP Sbjct: 499 PPPPPAPPAGVPPAPP 514 >AE014296-2144|AAF49916.1| 733|Drosophila melanogaster CG10663-PA protein. Length = 733 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P T PP PPP PP PP P Sbjct: 175 PAAHPPTQPPTYPPPTHPPTPPPTP 199 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P Q T PPP PP PPP PP Sbjct: 179 PPTQPPTYPPPTHPP-TPPPTPP 200 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +2 Query: 641 TPPPPXPPPXXP--PPXPPXP 697 T PPP PPP P PP PP P Sbjct: 269 TTPPPPPPPMAPAAPPPPPPP 289 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHN--XPPPXXXP 792 PP PP P PP P P N PPP P Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 706 TPPXKPPXXPP--XPPKPXPXHNXPPPXXXP 792 TPP PP P PP P P + PP P Sbjct: 270 TPPPPPPPMAPAAPPPPPPPINGAAPPPPPP 300 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP P PP P Sbjct: 276 PPMAPAAPPPPPPPINGAAPPPPPP 300 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 T PPP PPP P P PP P PPP PP Sbjct: 73 TRPPPPPPP--PQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPP 122 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 718 KPPXXPPXPPKPXPXHNXPPPXXXP 792 +PP PP P+P P + PPP P Sbjct: 207 QPPPPPPPRPQPTPGYGPPPPPPPP 231 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 620 RPXXQXXTPPPPXPPPXXPPPXPP 691 +P PPP PP PPP PP Sbjct: 132 QPTPSAPAPPPSYGPPQTPPPRPP 155 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 605 RXXGKRPXXQXXTPPPPXPPPXXPPPXPPXP 697 R RP PP P P P PP PP P Sbjct: 200 RPTPSRPQPPPPPPPRPQPTPGYGPPPPPPP 230 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 712 PXKPPXXPPXPPKPXPXHNXPPPXXXP 792 P +P PP PP+P P PP P Sbjct: 203 PSRPQPPPPPPPRPQPTPGYGPPPPPP 229 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 706 TPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 TP PP PP PPKP P PP P Sbjct: 219 TPGYGPPPPPP-PPKPQPTPGYGPPTPPP 246 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +2 Query: 620 RPXXQXXTPPPP-XPPPXXPPPXPP 691 +P PPPP PP PPP PP Sbjct: 106 QPTPSAPAPPPPSYGPPQTPPPRPP 130 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +1 Query: 706 TPPXKPPXXP-PXPPKPXPXHNXP--PPXXXP 792 TPP +PP P P P P P + P PP P Sbjct: 124 TPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPP 155 Score = 29.1 bits (62), Expect = 9.7 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +1 Query: 646 PPPXXXXXXXXXXXXXXXXXTPPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PPP PP PP P P P P PP P Sbjct: 79 PPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPP 127 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +1 Query: 709 PPXKPPXXPP--XPPKPXPXHNXPPPXXXP 792 P PP PP PP+P P PPP P Sbjct: 117 PSYGPPQTPPPRPPPQPTPSAPAPPPSYGP 146 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 721 PPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP P+P P + P P P Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPPGP 248 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 647 PPPXPPPXXPPPXPPXP 697 PPP P P P P PP P Sbjct: 244 PPPGPGPAQPAPQPPRP 260 >AE013599-1817|AAF58300.2| 1594|Drosophila melanogaster CG8118-PB, isoform B protein. Length = 1594 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFP 613 G GG G G G G G GGV GRFP Sbjct: 1233 GGGGVGVGGVGVGVGVGGVGGANGGRFP 1260 >AE013599-1816|AAF58299.1| 1594|Drosophila melanogaster CG8118-PA, isoform A protein. Length = 1594 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRFP 613 G GG G G G G G GGV GRFP Sbjct: 1233 GGGGVGVGGVGVGVGVGGVGGANGGRFP 1260 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +2 Query: 641 TPPPPXPPPXXP--PPXPPXP 697 T PPP PPP P PP PP P Sbjct: 269 TTPPPPPPPMAPAAPPPPPPP 289 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHN--XPPPXXXP 792 PP PP P PP P P N PPP P Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 706 TPPXKPPXXPP--XPPKPXPXHNXPPPXXXP 792 TPP PP P PP P P + PP P Sbjct: 270 TPPPPPPPMAPAAPPPPPPPINGAAPPPPPP 300 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP P PP P Sbjct: 276 PPMAPAAPPPPPPPINGAAPPPPPP 300 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PP PP P Sbjct: 548 PGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 5/23 (21%) Frame = +2 Query: 644 PPPPXPPP-----XXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPP 561 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +1 Query: 709 PPXKPPXXP-----PXPPKPXPXHNXPPPXXXP 792 PP PP P P PP P P PPP P Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 >BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p protein. Length = 1378 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G G GGG GGG GGGGV Sbjct: 990 GGGTVGGGVGGGGVGGGGV 1008 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 G GGG GGG GGGGV Sbjct: 987 GAIGGGTVGGGVGGGGV 1003 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 995 GGGVGGGGVGGGGVGGGG 1012 >BT030124-1|ABN49263.1| 655|Drosophila melanogaster IP13804p protein. Length = 655 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXC 631 G GG GGG GGG GGG C Sbjct: 601 GSGGGGGGGGGGGAGGGTGSGC 622 >BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p protein. Length = 1196 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G G GGG GGG GGGGV Sbjct: 808 GGGTVGGGVGGGGVGGGGV 826 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 G GGG GGG GGGGV Sbjct: 805 GAIGGGTVGGGVGGGGV 821 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 813 GGGVGGGGVGGGGVGGGG 830 >BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p protein. Length = 1255 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G G GGG GGG GGGGV Sbjct: 756 GGGTVGGGVGGGGVGGGGV 774 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 G GGG GGG GGGGV Sbjct: 753 GAIGGGTVGGGVGGGGV 769 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 761 GGGVGGGGVGGGGVGGGG 778 >BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p protein. Length = 1373 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G G GGG GGG GGGGV Sbjct: 874 GGGTVGGGVGGGGVGGGGV 892 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 G GGG GGG GGGGV Sbjct: 871 GAIGGGTVGGGVGGGGV 887 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 879 GGGVGGGGVGGGGVGGGG 896 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PP PP P Sbjct: 548 PGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 5/23 (21%) Frame = +2 Query: 644 PPPPXPPP-----XXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPP 561 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +1 Query: 709 PPXKPPXXP-----PXPPKPXPXHNXPPPXXXP 792 PP PP P P PP P P PPP P Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP P P PP P Sbjct: 194 PPPPPPPKAAPRPPPPAP 211 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P P PP PPP P PP P Sbjct: 185 PPPAAGAPKPPPPPPPKAAPRPPPP 209 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP P P PP P Sbjct: 194 PPPPPPPKAAPRPPPPAP 211 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P P PP PPP P PP P Sbjct: 185 PPPAAGAPKPPPPPPPKAAPRPPPP 209 >AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p protein. Length = 218 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -2 Query: 792 GXXXGGGXVVXXXWXXXXXXXXXXXXXXXXXXGXGGXGGGXXGGGXGGGG 643 G GG + W G GG GGG GGG GGG Sbjct: 45 GGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGG 94 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 82 GGGGYGGGGYGGGGHGGG 99 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP KP PP+P P + PPP P Sbjct: 130 PPPKPAPQYGPPPQPAPQYGPPPPKPAP 157 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P P PPKP P + PP P Sbjct: 141 PPQPAPQYGPPPPKPAPQYGPPPTQYGP 168 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q PPPP P P PP P P Sbjct: 125 QQYGPPPPKPAPQYGPPPQPAP 146 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP P P N PP P Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPP 462 >AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH07910 protein. Length = 1266 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G G GGG GGG GGGGV Sbjct: 767 GGGTVGGGVGGGGVGGGGV 785 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 G GGG GGG GGGGV Sbjct: 764 GAIGGGTVGGGVGGGGV 780 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 772 GGGVGGGGVGGGGVGGGG 789 >AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-PA protein. Length = 193 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -2 Query: 792 GXXXGGGXVVXXXWXXXXXXXXXXXXXXXXXXGXGGXGGGXXGGGXGGGG 643 G GG + W G GG GGG GGG GGG Sbjct: 20 GGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGG 69 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 57 GGGGYGGGGYGGGGHGGG 74 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP KP PP+P P + PPP P Sbjct: 130 PPPKPAPQYGPPPQPAPQYGPPPPKPAP 157 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP P P PPKP P + PP P Sbjct: 141 PPQPAPQYGPPPPKPAPQYGPPPTQYGP 168 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPPXP 697 Q PPPP P P PP P P Sbjct: 125 QQYGPPPPKPAPQYGPPPQPAP 146 Score = 29.1 bits (62), Expect = 9.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 709 PPXKPPXXPPXPPKPXPXHNXPPPXXXP 792 PP PP PP P P N PP P Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPP 462 >AE014298-1814|AAF48205.2| 963|Drosophila melanogaster CG32648-PA protein. Length = 963 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXC 631 G GG GGG GGG GGG C Sbjct: 407 GSGGGGGGGGGGGAGGGTGSGC 428 >AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD, isoform D protein. Length = 1254 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G G GGG GGG GGGGV Sbjct: 755 GGGTVGGGVGGGGVGGGGV 773 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 G GGG GGG GGGGV Sbjct: 752 GAIGGGTVGGGVGGGGV 768 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 760 GGGVGGGGVGGGGVGGGG 777 >AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC, isoform C protein. Length = 1254 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G G GGG GGG GGGGV Sbjct: 755 GGGTVGGGVGGGGVGGGGV 773 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGGV 640 G GGG GGG GGGGV Sbjct: 752 GAIGGGTVGGGVGGGGV 768 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 760 GGGVGGGGVGGGGVGGGG 777 >AE014297-2408|AAF55467.1| 1493|Drosophila melanogaster CG14318-PA protein. Length = 1493 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXP 688 TPPPP PPP PP P Sbjct: 610 TPPPPPPPPVPPPRKP 625 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP P P PP P Sbjct: 194 PPPPPPPKAAPRPPPPAP 211 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P P PP PPP P PP P Sbjct: 185 PPPAAGAPKPPPPPPPKAAPRPPPP 209 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PP PP P Sbjct: 548 PGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 5/23 (21%) Frame = +2 Query: 644 PPPPXPPP-----XXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPP 561 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +1 Query: 709 PPXKPPXXP-----PXPPKPXPXHNXPPPXXXP 792 PP PP P P PP P P PPP P Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPPXP 697 P PPPP PP PP PP P Sbjct: 548 PGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 5/23 (21%) Frame = +2 Query: 644 PPPPXPPP-----XXPPPXPPXP 697 PPPP PPP PPP PP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPP 561 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +1 Query: 709 PPXKPPXXP-----PXPPKPXPXHNXPPPXXXP 792 PP PP P P PP P P PPP P Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 315 GGGGGGGYGGGGGGGG 330 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 91 GPGGYSGGGGGGGGGGGG 108 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 221 GRGGFGGRRGGGGGGGGG 238 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 224 GFGGRRGGGGGGGGGGGG 241 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRF 616 G GG GGG G GGGG GR+ Sbjct: 236 GGGGGGGGRFDRGGGGGGNGGGGGGRY 262 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 277 GGGGGGGYGGGGGGGG 292 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 53 GPGGYSGGGGGGGGGGGG 70 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 183 GRGGFGGRRGGGGGGGGG 200 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 186 GFGGRRGGGGGGGGGGGG 203 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRF 616 G GG GGG G GGGG GR+ Sbjct: 198 GGGGGGGGRFDRGGGGGGNGGGGGGRY 224 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 315 GGGGGGGYGGGGGGGG 330 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 91 GPGGYSGGGGGGGGGGGG 108 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 221 GRGGFGGRRGGGGGGGGG 238 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 224 GFGGRRGGGGGGGGGGGG 241 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRF 616 G GG GGG G GGGG GR+ Sbjct: 236 GGGGGGGGRFDRGGGGGGNGGGGGGRY 262 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >BT024428-1|ABC86490.1| 627|Drosophila melanogaster IP02644p protein. Length = 627 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 86 GGGGGGAGGGGTGGGG 101 >BT022134-1|AAY51529.1| 543|Drosophila melanogaster IP08802p protein. Length = 543 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 166 GGAGGGGGGGGGGGGG 181 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 166 GGAGGGGGGGGGGGGGGG 183 >BT015257-1|AAT94486.1| 988|Drosophila melanogaster LP04173p protein. Length = 988 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXP 688 Q PPPP PPP P P P Sbjct: 594 QPPAPPPPPPPPVEPAPAP 612 Score = 29.9 bits (64), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 650 PPXPPPXXPPPXPPXP 697 PP PPP PPP P P Sbjct: 595 PPAPPPPPPPPVEPAP 610 >BT011461-1|AAR99119.1| 638|Drosophila melanogaster RE27685p protein. Length = 638 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 148 GGGGGGGGGGGGGGGG 163 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 149 GGGGGGGGGGGGGGGG 164 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 148 GGGGGGGGGGGGGGGGG 164 >BT011351-1|AAR96143.1| 638|Drosophila melanogaster RE74788p protein. Length = 638 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 148 GGGGGGGGGGGGGGGG 163 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 149 GGGGGGGGGGGGGGGG 164 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 148 GGGGGGGGGGGGGGGGG 164 >BT011350-1|AAR96142.1| 489|Drosophila melanogaster RH05790p protein. Length = 489 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 451 PPPPPPPSLTLPPLPPPP 468 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 294 GGYGGGGGGGGGGGGG 309 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 95 GGGGVGGGPFAGGHAGGGV 113 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 225 GGGGHGGGGFGPGGGGGG 242 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 288 GGGGFKGGYGGGGGGGGG 305 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 159 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 186 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 60 GGDGGGKLGGGYGSGG 75 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 310 GGGGGGGYGGGGGGGG 325 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 91 GHGGYSGGGGGGGGGGGG 108 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 222 GRGGFGGRRGGGGGGGGG 239 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 225 GFGGRRGGGGGGGGGGGG 242 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 97 GGGGGGGGGGGGGSGG 112 >BT003578-1|AAO39582.1| 739|Drosophila melanogaster LD24631p protein. Length = 739 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 474 GGSGGGGGGGGGGGGG 489 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 474 GGSGGGGGGGGGGGGGGG 491 >BT003171-1|AAO24926.1| 443|Drosophila melanogaster SD07604p protein. Length = 443 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 398 GGGGGGGGGGGGGGGG 413 >BT001477-1|AAN71232.1| 443|Drosophila melanogaster LD21345p protein. Length = 443 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 398 GGGGGGGGGGGGGGGG 413 >AY119224-1|AAM51084.1| 469|Drosophila melanogaster SD16903p protein. Length = 469 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 204 GGSGGGGGGGGGGGGG 219 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 204 GGSGGGGGGGGGGGGGGG 221 >AY119154-1|AAM51014.1| 380|Drosophila melanogaster RE65163p protein. Length = 380 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 342 PPPPPPPSLTLPPLPPPP 359 >AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p protein. Length = 158 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 92 GGGGGGGGGGGSGGGG 107 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 89 GRGGGGGGGGGGGGSGGG 106 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 95 GGGGGGGGSGGGGRGGG 111 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 94 GGGGGGGGGSGGGGRGGG 111 >AY075437-1|AAL68252.1| 155|Drosophila melanogaster LP09837p protein. Length = 155 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 55 GGGGGGGSGGGGGGGG 70 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 56 GGGGGGSGGGGGGGGG 71 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 58 GGGGSGGGGGGGGGAGGG 75 >AY058479-1|AAL13708.1| 700|Drosophila melanogaster GH28722p protein. Length = 700 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXP 688 Q PPPP PPP P P P Sbjct: 306 QPPAPPPPPPPPVEPAPAP 324 Score = 29.9 bits (64), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 650 PPXPPPXXPPPXPPXP 697 PP PPP PPP P P Sbjct: 307 PPAPPPPPPPPVEPAP 322 >AL023893-1|CAA19655.1| 485|Drosophila melanogaster EG:132E8.1 protein. Length = 485 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 398 GGGGGGGGGGGGGGGG 413 >AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-PA protein. Length = 991 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G G GGG GGG GGGG+ Sbjct: 23 GGAGGGGGGGGGGGGGGGL 41 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 28 GGGGGGGGGGGGGLGGYG 45 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 26 GGGGGGGGGGGGGGGLGG 43 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 31 GGGGGGGGGGLGGYGGGG 48 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 310 GGGGGGGYGGGGGGGG 325 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 91 GHGGYSGGGGGGGGGGGG 108 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 222 GRGGFGGRRGGGGGGGGG 239 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 225 GFGGRRGGGGGGGGGGGG 242 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 97 GGGGGGGGGGGGGSGG 112 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 310 GGGGGGGYGGGGGGGG 325 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 91 GHGGYSGGGGGGGGGGGG 108 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 222 GRGGFGGRRGGGGGGGGG 239 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 225 GFGGRRGGGGGGGGGGGG 242 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 97 GGGGGGGGGGGGGSGG 112 >AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA protein. Length = 158 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 92 GGGGGGGGGGGSGGGG 107 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 89 GRGGGGGGGGGGGGSGGG 106 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 95 GGGGGGGGSGGGGRGGG 111 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 94 GGGGGGGGGSGGGGRGGG 111 >AE014298-190|AAS65244.1| 443|Drosophila melanogaster CG3056-PB, isoform B protein. Length = 443 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 398 GGGGGGGGGGGGGGGG 413 >AE014298-189|AAF45613.1| 485|Drosophila melanogaster CG3056-PA, isoform A protein. Length = 485 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 398 GGGGGGGGGGGGGGGG 413 >AE014297-461|AAN13377.1| 646|Drosophila melanogaster CG1021-PB, isoform B protein. Length = 646 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 156 GGGGGGGGGGGGGGGG 171 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 157 GGGGGGGGGGGGGGGG 172 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 156 GGGGGGGGGGGGGGGGG 172 >AE014297-460|AAF54123.2| 646|Drosophila melanogaster CG1021-PA, isoform A protein. Length = 646 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 156 GGGGGGGGGGGGGGGG 171 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 157 GGGGGGGGGGGGGGGG 172 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 156 GGGGGGGGGGGGGGGGG 172 >AE014296-3616|AAF51781.3| 627|Drosophila melanogaster CG7152-PB, isoform B protein. Length = 627 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 86 GGGGGGAGGGGTGGGG 101 >AE014296-723|AAF47815.1| 155|Drosophila melanogaster CG10853-PA protein. Length = 155 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 55 GGGGGGGSGGGGGGGG 70 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 56 GGGGGGSGGGGGGGGG 71 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 58 GGGGSGGGGGGGGGAGGG 75 >AE014296-443|AAF47637.2| 988|Drosophila melanogaster CG1317-PB protein. Length = 988 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXP 688 Q PPPP PPP P P P Sbjct: 594 QPPAPPPPPPPPVEPAPAP 612 Score = 29.9 bits (64), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 650 PPXPPPXXPPPXPPXP 697 PP PPP PPP P P Sbjct: 595 PPAPPPPPPPPVEPAP 610 >AE014134-2970|AAF53700.1| 530|Drosophila melanogaster CG10348-PA protein. Length = 530 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 153 GGAGGGGGGGGGGGGG 168 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 153 GGAGGGGGGGGGGGGGGG 170 >AE014134-2891|AAN11175.1| 475|Drosophila melanogaster CG5674-PC, isoform C protein. Length = 475 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 437 PPPPPPPSLTLPPLPPPP 454 >AE014134-2886|AAN11174.1| 489|Drosophila melanogaster CG5674-PA, isoform A protein. Length = 489 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPPXP 697 PPPP PP PP PP P Sbjct: 451 PPPPPPPSLTLPPLPPPP 468 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 280 GGYGGGGGGGGGGGGG 295 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G GG GGG GG GGGV Sbjct: 81 GGGGVGGGPFAGGHAGGGV 99 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 211 GGGGHGGGGFGPGGGGGG 228 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 274 GGGGFKGGYGGGGGGGGG 291 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G+GG G GG GG Sbjct: 145 GIGGGGGHSGGGSGIGGGPGFGGGIGGG 172 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG G GG Sbjct: 46 GGDGGGKLGGGYGSGG 61 >AE013599-2734|AAF57660.2| 1271|Drosophila melanogaster CG30122-PB protein. Length = 1271 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGGG Sbjct: 1007 GGSGGGGGGGGGGGGG 1022 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 1007 GGSGGGGGGGGGGGGGGG 1024 >AE013599-1064|AAM68780.2| 1734|Drosophila melanogaster CG18408-PB, isoform B protein. Length = 1734 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPP 682 P + TPPP PPP PPP Sbjct: 144 PVRKAATPPPAPPPPPPPPP 163 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 151 PPPAPPP--PPPPPP 163 >AB053479-1|BAB62018.1| 1743|Drosophila melanogaster DCAPL2 protein. Length = 1743 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPP 682 P + TPPP PPP PPP Sbjct: 144 PVRKAATPPPAPPPPPPPPP 163 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 151 PPPAPPP--PPPPPP 163 >X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. Length = 127 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G GG GG GG GG Sbjct: 100 GGRPGGGFGGPGGGFGGPGGGFGGGFGG 127 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 779 GGGXLWXGXGLGGXGGXXGGXXGG 708 GGG G G GG GG GG GG Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGG 73 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 779 GGGXLWXGXGLGGXGGXXGGXXGG 708 GGG G G GG GG GG GG Sbjct: 57 GGGFGGPGGGFGGQGGGFGGPGGG 80 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 779 GGGXLWXGXGLGGXGGXXGGXXGG 708 GGG G G GG GG GG GG Sbjct: 64 GGGFGGQGGGFGGPGGGFGGQGGG 87 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 779 GGGXLWXGXGLGGXGGXXGGXXGG 708 GGG G G GG GG GG GG Sbjct: 78 GGGFGGQGGGFGGQGGFGGGGFGG 101 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 696 GXGGXGGGXXG-GGXGGGGVXXCXXGRF 616 G GG GGG G GG GGGG G F Sbjct: 80 GFGGQGGGFGGQGGFGGGGFGGRPGGGF 107 >U41808-1|AAC47016.1| 452|Drosophila melanogaster Cyclin D protein. Length = 452 Score = 31.1 bits (67), Expect = 2.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 60 PPPPPPPPPPPPP 72 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPP 679 Q PPPP PPP PP Sbjct: 57 QLEPPPPPPPPPPPPP 72 >U21717-1|AAA92045.1| 743|Drosophila melanogaster nervy protein. Length = 743 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 703 GSGGQSGGGGGGGGGGGG 720 >M25292-1|AAA17840.1| 397|Drosophila melanogaster dsx protein. Length = 397 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 274 GGGGGGGGSSGGGAGGG 290 >BT029258-1|ABK30895.1| 427|Drosophila melanogaster FI01107p protein. Length = 427 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 274 GGGGGGGGSSGGGAGGG 290 >BT029145-1|ABJ17079.1| 428|Drosophila melanogaster RT01021p protein. Length = 428 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 254 GGGGGGGGGTGGGGGGG 270 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 84 GVGGGGGGGFGGGFGGG 100 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 96 GFGGGSGGGSGGGFGGGG 113 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRF 616 G GG GG GGG GGGG G F Sbjct: 55 GIGGGFGGGFGGGSGGGGFSSGGGGGF 81 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 110 GGGGSIGGFGGGGGGGGG 127 >BT024335-1|ABC86397.1| 257|Drosophila melanogaster IP09958p protein. Length = 257 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 94 GGGGGGGGGGGGGSGAGG 111 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 96 GGGGGGGGGGGSGAGGGG 113 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 690 GGXGGGXXGGGXGGG 646 GG GGG GGG GGG Sbjct: 92 GGGGGGGGGGGGGGG 106 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 687 GXGGGXXGGGXGGGG 643 G GGG GGG GGGG Sbjct: 92 GGGGGGGGGGGGGGG 106 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GG G Sbjct: 93 GGGGGGGGGGGGGGSG 108 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 185 GGSGFGGGGAGGGSGGGG 202 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 190 GGGGAGGGSGGGGGGAGG 207 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 269 GQGGAGGGYGGGGGGGRG 286 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 298 GGGGFGGQGGGGGFGGGG 315 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 334 GQGGAGGGYGGGGGRGGG 351 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 364 GGGGFGGQGGGGGFGGGG 381 Score = 29.9 bits (64), Expect = 5.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 272 GAGGGYGGGGGGGRGGGG 289 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 696 GXGGXGG-GXXGGGXGGGG 643 G GG GG G GGG GGGG Sbjct: 263 GGGGFGGQGGAGGGYGGGG 281 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 696 GXGGXGG-GXXGGGXGGGG 643 G GG GG G GGG GGGG Sbjct: 328 GGGGYGGQGGAGGGYGGGG 346 >BT015199-1|AAT94428.1| 335|Drosophila melanogaster RE69682p protein. Length = 335 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 206 GAAGGGGGSVGGGGGGGG 223 >BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p protein. Length = 515 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 Query: 641 TPPPPXPPPXXPPPXP 688 TPPPP PPP PPP P Sbjct: 393 TPPPPPPPP--PPPMP 406 Score = 30.3 bits (65), Expect = 4.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 653 PXPPPXXPPPXPPXP 697 P PPP PPP PP P Sbjct: 392 PTPPPPPPPPPPPMP 406 >BT010035-1|AAQ22504.1| 1596|Drosophila melanogaster LD47819p protein. Length = 1596 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 26 GGGGAGGGGGGGGGGSGG 43 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPP 691 Q PP P PP PPP PP Sbjct: 631 QQQQPPIPPPPANVPPPEPP 650 >BT009951-1|AAQ22420.1| 295|Drosophila melanogaster RH51767p protein. Length = 295 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 230 GGGGGGGGWSSGGGGGGG 247 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 231 GGGGGGGWSSGGGGGGGG 248 >BT004898-1|AAO47876.1| 743|Drosophila melanogaster LD17501p protein. Length = 743 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 703 GSGGQSGGGGGGGGGGGG 720 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 84 GGGGGGGGGFGGGFGGG 100 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 96 GFGGGSGGGSGGGFGGGG 113 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRF 616 G GG GG GGG GGGG G F Sbjct: 55 GIGGGFGGGFGGGSGGGGFSSGGGGGF 81 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 110 GGGGSIGGFGGGGGGGGG 127 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 623 PXXQXXTPPPPXPPPXXPPPXPP 691 P PPPP PP PP PP Sbjct: 706 PTASSAAPPPPPPPAPPAPPPPP 728 Score = 29.9 bits (64), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 650 PPXPPPXXPPPXPPXP 697 PP PPP PP PP P Sbjct: 713 PPPPPPPAPPAPPPPP 728 Score = 29.1 bits (62), Expect = 9.7 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 6/57 (10%) Frame = +2 Query: 644 PPPPXPPPXXP------PPXPPXPXXXXXXXXXXXXXXXXXXHXXXTTXPPPXXXPP 796 PPPP P P P PP PP P +T P P PP Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPP 752 >BT003529-1|AAO39533.1| 987|Drosophila melanogaster RE18590p protein. Length = 987 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 82 GGSGSGGGGGGGGGGGGG 99 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 83 GSGSGGGGGGGGGGGGGG 100 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 85 GSGGGGGGGGGGGGGGG 101 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GG G Sbjct: 88 GGGGGGGGGGGGGGSG 103 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGR 619 G GG GGG GGG GGG G+ Sbjct: 71 GGGGRGGGGRGGGGRGGGAGGFKGGK 96 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 14 GGGGGGGGFRGRGGGGGG 31 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 27 GGGGGGGGGFGGGRGRGG 44 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 62 GGRGGGGGRGGGGRGGGG 79 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GGG Sbjct: 66 GGGGRGGGGRGGGGRGGG 83 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 67 GGGRGGGGRGGGGRGGGG 84 Score = 29.1 bits (62), Expect = 9.7 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Frame = -2 Query: 696 GXGGXGGGXXGG-GXGGGG 643 G GG GGG GG G GGGG Sbjct: 28 GGGGGGGGFGGGRGRGGGG 46 >AY121649-1|AAM51976.1| 950|Drosophila melanogaster LD23647p protein. Length = 950 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 417 GGGGGGGGRSGGGGGGG 433 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 421 GGGGRSGGGGGGGAGGGG 438 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGV 640 G G GGG GG GGGGV Sbjct: 422 GGGRSGGGGGGGAGGGGGV 440 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GG GGGG Sbjct: 418 GGGGGGGRSGGGGGGG 433 >AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p protein. Length = 263 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 141 GAGGAGGGGSAGGGGGGG 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 146 GGGGSAGGGGGGGGGGGG 163 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 147 GGGSAGGGGGGGGGGGGG 164 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 G GGG GGG GGGG Sbjct: 144 GAGGGGSAGGGGGGGG 159 >AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p protein. Length = 127 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXGG 708 G GGG G G GG GG GG GG Sbjct: 100 GGRPGGGFGGPGGGFGGPGGGFGGGFGG 127 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 779 GGGXLWXGXGLGGXGGXXGGXXGG 708 GGG G G GG GG GG GG Sbjct: 50 GGGFGGPGGGFGGPGGGFGGQGGG 73 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 779 GGGXLWXGXGLGGXGGXXGGXXGG 708 GGG G G GG GG GG GG Sbjct: 57 GGGFGGPGGGFGGQGGGFGGPGGG 80 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 779 GGGXLWXGXGLGGXGGXXGGXXGG 708 GGG G G GG GG GG GG Sbjct: 64 GGGFGGQGGGFGGPGGGFGGQGGG 87 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 779 GGGXLWXGXGLGGXGGXXGGXXGG 708 GGG G G GG GG GG GG Sbjct: 78 GGGFGGQGGGFGGQGGFGGGGFGG 101 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 696 GXGGXGGGXXG-GGXGGGGVXXCXXGRF 616 G GG GGG G GG GGGG G F Sbjct: 80 GFGGQGGGFGGQGGFGGGGFGGRPGGGF 107 >AY069509-1|AAL39654.1| 481|Drosophila melanogaster LD22957p protein. Length = 481 Score = 31.1 bits (67), Expect = 2.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 89 PPPPPPPPPPPPP 101 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPP 679 Q PPPP PPP PP Sbjct: 86 QLEPPPPPPPPPPPPP 101 >AY060257-1|AAL25296.1| 427|Drosophila melanogaster GH08308p protein. Length = 427 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 274 GGGGGGGGSSGGGAGGG 290 >AY051919-1|AAK93343.1| 255|Drosophila melanogaster LD40489p protein. Length = 255 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 196 GGGGGGSGGGGGGSGGGG 213 >AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p protein. Length = 263 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 141 GAGGAGGGGSAGGGGGGG 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 146 GGGGSAGGGGGGGGGGGG 163 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 147 GGGSAGGGGGGGGGGGGG 164 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 G GGG GGG GGGG Sbjct: 144 GAGGGGSAGGGGGGGG 159 >AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 55 GGGGGGGGGGSGGGGGGG 72 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 57 GGGGGGGGSGGGGGGGSG 74 >AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 55 GGGGGGGGGGSGGGGGGG 72 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 57 GGGGGGGGSGGGGGGGSG 74 >AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 55 GGGGGGGGGGSGGGGGGG 72 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 57 GGGGGGGGSGGGGGGGSG 74 >AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 56 GGGGGGGGGSGGGGGGG 72 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 57 GGGGGGGGSGGGGGGGSG 74 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG G G GGGG Sbjct: 56 GGGGGGGGGSGGGGGG 71 >AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 56 GGGGGGGGGSGGGGGGG 72 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 57 GGGGGGGGSGGGGGGGSG 74 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG G G GGGG Sbjct: 56 GGGGGGGGGSGGGGGG 71 >AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 56 GGGGGGGGGSGGGSGGG 72 >AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 55 GGGGGGGGGGSGGGGGGG 72 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 57 GGGGGGGGSGGGGGGGSG 74 >AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 55 GGGGGGGGGGSGGGGGGG 72 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 57 GGGGGGGGSGGGGGGGSG 74 >AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 56 GGGGGGGGGSGGGGGGG 72 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 57 GGGGGGGGSGGGGGGGSG 74 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG G G GGGG Sbjct: 56 GGGGGGGGGSGGGGGG 71 >AM294871-1|CAL26857.1| 148|Drosophila melanogaster CG10853 protein. Length = 148 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 51 GGGGGGGGGGSGGGGGGG 68 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 53 GGGGGGGGSGGGGGGGSG 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 60 GSGGGGGGGSGSGDGGGG 77 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 31.1 bits (67), Expect = 2.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 642 PPPPPPPPPPPPP 654 Score = 29.9 bits (64), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 650 PPXPPPXXPPPXPPXP 697 P PPP PPP PP P Sbjct: 639 PSYPPPPPPPPPPPPP 654 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 647 PPPXPPPXXPPPXPP 691 PPP PPP PPP PP Sbjct: 642 PPPPPPP--PPPPPP 654 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 644 PPPPXPPPXXPPPXPP 691 PPPP PPP P P P Sbjct: 673 PPPPPPPPPVPYPYTP 688 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 84 GGGGGGGGGFGGGFGGG 100 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 96 GFGGGSGGGSGGGFGGGG 113 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXGRF 616 G GG GG GGG GGGG G F Sbjct: 55 GIGGGFGGGFGGGSGGGGFSSGGGGGF 81 >AF260583-1|AAG13285.1| 481|Drosophila melanogaster cyclin D protein. Length = 481 Score = 31.1 bits (67), Expect = 2.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 89 PPPPPPPPPPPPP 101 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPP 679 Q PPPP PPP PP Sbjct: 86 QLEPPPPPPPPPPPPP 101 >AF234157-1|AAF60294.1| 255|Drosophila melanogaster SR family splicing factor protein. Length = 255 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 196 GGGGGGSGGGGGGSGGGG 213 >AF232773-1|AAF43413.1| 255|Drosophila melanogaster SR family splicing factor SF2 protein. Length = 255 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 196 GGGGGGSGGGGGGSGGGG 213 >AF086820-1|AAC36333.1| 428|Drosophila melanogaster paired-like homeodomain proteinUNC-4 protein. Length = 428 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 254 GGGGGGGGGTGGGGGGG 270 >AE014298-2938|AAN09519.1| 1596|Drosophila melanogaster CG12701-PB, isoform B protein. Length = 1596 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 26 GGGGAGGGGGGGGGGSGG 43 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPP 691 Q PP P PP PPP PP Sbjct: 631 QQQQPPIPPPPANVPPPEPP 650 >AE014298-2937|AAF49020.1| 1596|Drosophila melanogaster CG12701-PA, isoform A protein. Length = 1596 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG G GG Sbjct: 26 GGGGAGGGGGGGGGGSGG 43 Score = 29.9 bits (64), Expect = 5.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPPPXPP 691 Q PP P PP PPP PP Sbjct: 631 QQQQPPIPPPPANVPPPEPP 650 >AE014298-2608|AAF48762.1| 428|Drosophila melanogaster CG6269-PA protein. Length = 428 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 254 GGGGGGGGGTGGGGGGG 270 >AE014298-2505|AAF48684.1| 335|Drosophila melanogaster CG13001-PA protein. Length = 335 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 206 GAAGGGGGSVGGGGGGGG 223 >AE014298-2283|AAF48537.1| 481|Drosophila melanogaster CG9096-PC, isoform C protein. Length = 481 Score = 31.1 bits (67), Expect = 2.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 89 PPPPPPPPPPPPP 101 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPP 679 Q PPPP PPP PP Sbjct: 86 QLEPPPPPPPPPPPPP 101 >AE014298-2282|AAN09375.1| 481|Drosophila melanogaster CG9096-PB, isoform B protein. Length = 481 Score = 31.1 bits (67), Expect = 2.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 89 PPPPPPPPPPPPP 101 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPP 679 Q PPPP PPP PP Sbjct: 86 QLEPPPPPPPPPPPPP 101 >AE014298-2281|AAN09374.1| 481|Drosophila melanogaster CG9096-PA, isoform A protein. Length = 481 Score = 31.1 bits (67), Expect = 2.4 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +2 Query: 644 PPPPXPPPXXPPP 682 PPPP PPP PPP Sbjct: 89 PPPPPPPPPPPPP 101 Score = 29.1 bits (62), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 632 QXXTPPPPXPPPXXPP 679 Q PPPP PPP PP Sbjct: 86 QLEPPPPPPPPPPPPP 101 >AE014298-1582|AAF48018.1| 267|Drosophila melanogaster CG12625-PA protein. Length = 267 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G G GGG GGG GGGG Sbjct: 22 GGSGSGGGGGGGGAGGGG 39 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGG 646 G GG GGG GGG GGG Sbjct: 27 GGGGGGGGAGGGGAGGG 43 Score = 29.1 bits (62), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 690 GGXGGGXXGGGXGGGG 643 GG GGG GGG GGG Sbjct: 28 GGGGGGGAGGGGAGGG 43 >AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-PA protein. Length = 679 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GGG GG G Sbjct: 193 GGGGGGGGGGGGGIGGAG 210 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 197 GGGGGGGGGIGGAGGGGG 214 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG G G GGGG Sbjct: 198 GGGGGGGGIGGAGGGGGG 215 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGGVXXCXXG 622 G GGG GGG GGGG+ G Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGG 212 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 791 GXXXGGGXLWXGXGLGGXGGXXGGXXG 711 G GGG G G+GG GG GG G Sbjct: 192 GGGGGGGGGGGGGGIGGAGGGGGGGGG 218 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GGG GG GGGG Sbjct: 196 GGGGGGGGGGIGGAGGGG 213 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG G G GGG GGGG Sbjct: 200 GGGGGGIGGAGGGGGGGG 217 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 696 GXGGXGGGXXGGGXGGGG 643 G GG GG GGG GGGG Sbjct: 201 GGGGGIGGAGGGGGGGGG 218 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.311 0.146 0.499 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,280,924 Number of Sequences: 53049 Number of extensions: 448356 Number of successful extensions: 25734 Number of sequences better than 10.0: 460 Number of HSP's better than 10.0 without gapping: 3604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16865 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4894529517 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -