BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F08 (845 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0852 - 6483280-6484416 29 4.7 01_07_0050 - 40751994-40752086,40752193-40752300,40752501-407526... 29 4.7 >06_01_0852 - 6483280-6484416 Length = 378 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +3 Query: 459 RILKNLPFITKDTGATSKYLPAKMAV*LSLSLESRAL 569 R+ KN+ F+T+D ++Y+ A+ + +S SLE R L Sbjct: 283 RLRKNVEFLTRDVKLETRYI-ARRPIMISYSLERRLL 318 >01_07_0050 - 40751994-40752086,40752193-40752300,40752501-40752667, 40752756-40752882,40752984-40753145,40753674-40753837, 40753931-40754024,40754160-40754284,40754387-40754532, 40754676-40754764,40755524-40755589,40755990-40756148 Length = 499 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 316 IAAFPAPWCNVIYNRLQTNFELALHCTLKFSMC 414 IA+ P W +V+ R T+ LHCT K S C Sbjct: 82 IASKPDAWFDVV-ERYSTDSNKTLHCTTKTSKC 113 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,696,228 Number of Sequences: 37544 Number of extensions: 404633 Number of successful extensions: 896 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 896 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2350456800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -