BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F07 (883 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g78070.2 68414.m09098 WD-40 repeat family protein contains Pf... 29 3.1 At1g78070.1 68414.m09097 WD-40 repeat family protein contains Pf... 29 3.1 At3g44990.1 68416.m04847 xyloglucan:xyloglucosyl transferase, pu... 29 4.1 At1g36070.1 68414.m04484 WD-40 repeat family protein contains 2 ... 29 4.1 >At1g78070.2 68414.m09098 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 447 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 143 FNDRKEKAHSIYFQNTRNIFWCCSRHFSYYFQNKS 39 FN R K+ +FQ RN+ W S+H Y+ N S Sbjct: 122 FNTRLVKSTIAHFQ-LRNLVWATSKHDVYFMNNYS 155 >At1g78070.1 68414.m09097 WD-40 repeat family protein contains Pfam profile PF00400: WD domain, G-beta repeat Length = 229 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 143 FNDRKEKAHSIYFQNTRNIFWCCSRHFSYYFQNKS 39 FN R K+ +FQ RN+ W S+H Y+ N S Sbjct: 122 FNTRLVKSTIAHFQ-LRNLVWATSKHDVYFMNNYS 155 >At3g44990.1 68416.m04847 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative Length = 293 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 102 LKIYRMGFFFSIVKTSIIFGAGVYTGVYVAQNYQ 203 L+ YR G+F + +K F AGV T +Y++ N + Sbjct: 74 LRPYRSGYFGASIKLQPGFTAGVDTSLYLSNNQE 107 >At1g36070.1 68414.m04484 WD-40 repeat family protein contains 2 WD-40 repeats (PF0400);similar to guanine nucleotide-binding protein beta subunit GPBA (SP:P36408) [Dictyostelium discoideum (Slime mold)]; similar to katanin p80 (WD40-containing) subunit B 1 (GI:12655011) [Homo sapiens] Length = 418 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -3 Query: 143 FNDRKEKAHSIYFQNTRNIFWCCSRHFSYYFQNKS 39 FN R + ++FQ RN+ W S+H Y QN S Sbjct: 91 FNTRLVTSTIVHFQ-LRNLVWATSKHDVYLMQNYS 124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,449,910 Number of Sequences: 28952 Number of extensions: 142246 Number of successful extensions: 323 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 323 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2077687200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -