BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F06 (982 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37831| Best HMM Match : MAM (HMM E-Value=0) 30 2.5 SB_8910| Best HMM Match : MAM (HMM E-Value=1.9) 30 2.5 >SB_37831| Best HMM Match : MAM (HMM E-Value=0) Length = 563 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 138 GRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 248 G G + Q QV + + GET + ++ V+G GDI Sbjct: 151 GNQGQRWQMAQVPINYTGETIQLLLEGVRGSDYTGDI 187 >SB_8910| Best HMM Match : MAM (HMM E-Value=1.9) Length = 89 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 138 GRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 248 G G + Q QV + + GET + ++ V+G GDI Sbjct: 22 GNQGQRWQMAQVPINYTGETIQLLLEGVRGSDYTGDI 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,976,560 Number of Sequences: 59808 Number of extensions: 229632 Number of successful extensions: 535 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2907797044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -