BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F06 (982 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061320-1|AAL28868.1| 65|Drosophila melanogaster LD23674p pro... 98 1e-20 AE014298-1341|AAF46503.2| 65|Drosophila melanogaster CG2998-PA... 98 1e-20 AE014297-4512|AAF56992.1| 64|Drosophila melanogaster CG15527-P... 88 2e-17 BT030166-1|ABN49305.1| 73|Drosophila melanogaster IP17744p pro... 51 3e-06 >AY061320-1|AAL28868.1| 65|Drosophila melanogaster LD23674p protein. Length = 65 Score = 98.3 bits (234), Expect = 1e-20 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = +3 Query: 96 MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 254 MDKP V ARV+KVLGRTGSQGQCTQVKVEF+GE +RQIIRNVKGPVR+GDILT Sbjct: 1 MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGDILT 53 >AE014298-1341|AAF46503.2| 65|Drosophila melanogaster CG2998-PA protein. Length = 65 Score = 98.3 bits (234), Expect = 1e-20 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = +3 Query: 96 MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 254 MDKP V ARV+KVLGRTGSQGQCTQVKVEF+GE +RQIIRNVKGPVR+GDILT Sbjct: 1 MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGDILT 53 >AE014297-4512|AAF56992.1| 64|Drosophila melanogaster CG15527-PA protein. Length = 64 Score = 88.2 bits (209), Expect = 2e-17 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = +3 Query: 96 MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 254 MDKP ARVV++LGRTGSQGQCTQV+VEF+G+ SRQIIRNVKGPVR GDIL+ Sbjct: 1 MDKPQY-ARVVEILGRTGSQGQCTQVRVEFLGDQSRQIIRNVKGPVRVGDILS 52 >BT030166-1|ABN49305.1| 73|Drosophila melanogaster IP17744p protein. Length = 73 Score = 50.8 bits (116), Expect = 3e-06 Identities = 21/44 (47%), Positives = 32/44 (72%) Frame = +3 Query: 117 ARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 248 ARV+K+L R G++G T+V+V+ + + Q +R VKGPVR GD+ Sbjct: 7 ARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDV 50 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,037,851 Number of Sequences: 53049 Number of extensions: 340322 Number of successful extensions: 997 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 997 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4935487923 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -