BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F06 (982 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03850.1 68418.m00356 40S ribosomal protein S28 (RPS28B) ribo... 66 3e-11 At3g10090.1 68416.m01209 40S ribosomal protein S28 (RPS28A) simi... 66 3e-11 At5g64140.1 68418.m08054 40S ribosomal protein S28 (RPS28C) 65 6e-11 At2g43890.1 68415.m05456 polygalacturonase, putative / pectinase... 31 1.5 At4g35500.2 68417.m05045 protein kinase family protein contains ... 29 6.2 At4g35500.1 68417.m05044 protein kinase family protein contains ... 29 6.2 >At5g03850.1 68418.m00356 40S ribosomal protein S28 (RPS28B) ribosomal protein S28, Arabidopsis thaliana, EMBL:ATRP28A Length = 64 Score = 66.5 bits (155), Expect = 3e-11 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = +3 Query: 96 MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 254 MD A VVKV+GRTGS+GQ TQV+V+F ++ R I+RNVKGPVR+GDILT Sbjct: 1 MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFT-DSDRYIMRNVKGPVREGDILT 52 >At3g10090.1 68416.m01209 40S ribosomal protein S28 (RPS28A) similar to ribosomal protein S28 GB:P34789 [Arabidopsis thaliana] Length = 64 Score = 66.5 bits (155), Expect = 3e-11 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = +3 Query: 96 MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 254 MD A VVKV+GRTGS+GQ TQV+V+F ++ R I+RNVKGPVR+GDILT Sbjct: 1 MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFT-DSDRYIMRNVKGPVREGDILT 52 >At5g64140.1 68418.m08054 40S ribosomal protein S28 (RPS28C) Length = 64 Score = 65.3 bits (152), Expect = 6e-11 Identities = 33/53 (62%), Positives = 42/53 (79%) Frame = +3 Query: 96 MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 254 MD A VVKV+GRTGS+GQ TQV+V+F ++ R I+RNVKGPVR+GD+LT Sbjct: 1 MDSQIKHAVVVKVMGRTGSRGQVTQVRVKFT-DSDRFIMRNVKGPVREGDVLT 52 >At2g43890.1 68415.m05456 polygalacturonase, putative / pectinase, putative similar to SP|P48979 Polygalacturonase precursor (EC 3.2.1.15) (PG) (Pectinase) {Prunus persica}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 392 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -3 Query: 254 SEDVSVTDGSFHVSDDLTAGLPNELDLHLSTL 159 S V+VTDG+FH DD + P +L++S L Sbjct: 204 SAGVTVTDGTFHTGDDCISIGPGTRNLYMSKL 235 >At4g35500.2 68417.m05045 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 439 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 72 LSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIR 215 LS+ +DK + R++ +G GQ + +EF+G++ ++IR Sbjct: 87 LSAAADGDLDKTKCVVRLIDHFKHSGPNGQHLCMVLEFLGDSLLRLIR 134 >At4g35500.1 68417.m05044 protein kinase family protein contains eukaryotic protein kinase domain, INTERPRO:IPR000719 Length = 438 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 72 LSSILQAKMDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIR 215 LS+ +DK + R++ +G GQ + +EF+G++ ++IR Sbjct: 86 LSAAADGDLDKTKCVVRLIDHFKHSGPNGQHLCMVLEFLGDSLLRLIR 133 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,836,174 Number of Sequences: 28952 Number of extensions: 163792 Number of successful extensions: 370 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2382734760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -