BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F03 (904 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0183 - 15522241-15523866 36 0.033 04_01_0445 + 5812277-5813893 35 0.077 04_01_0443 - 5776275-5777921 35 0.077 08_02_1613 + 28236989-28238593 34 0.18 03_01_0354 + 2785998-2787623 33 0.24 10_08_0182 + 15513693-15515273 33 0.41 04_01_0449 + 5830017-5830272,5830376-5830620,5831994-5833019 33 0.41 03_01_0355 - 2789680-2791263 33 0.41 03_01_0357 - 2797523-2799109 31 0.95 07_01_0365 + 2718707-2718839,2719335-2719405,2719512-2719955,272... 30 2.9 03_01_0256 - 1992298-1993878 30 2.9 11_04_0305 - 16162063-16162096,16162282-16164365,16165283-161653... 29 5.1 04_04_0481 - 25541355-25541849,25541933-25542535,25542730-255428... 29 5.1 07_01_0693 - 5242932-5243213,5245544-5245695,5246267-5246291 29 6.7 04_04_0345 - 24542869-24543540,24543725-24543805,24543845-245439... 29 6.7 03_05_0434 + 24252994-24253449,24254791-24254877,24255450-242557... 29 6.7 10_03_0021 + 7129786-7130117,7130227-7130347,7131048-7131136,713... 28 8.8 01_01_1224 - 9888726-9888820,9889042-9889085,9889194-9889282,988... 28 8.8 >10_08_0183 - 15522241-15523866 Length = 541 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 Query: 776 AATAXSVFFCGAILGGFIFGWIXDKYGR 859 AA V FCG + G FGW+ DK GR Sbjct: 74 AAAVNGVAFCGTLAGQLFFGWLGDKLGR 101 >04_01_0445 + 5812277-5813893 Length = 538 Score = 35.1 bits (77), Expect = 0.077 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 776 AATAXSVFFCGAILGGFIFGWIXDKYGR 859 +A V FCG + G FGW+ DK GR Sbjct: 69 SAAVNGVAFCGTLAGQLFFGWLGDKMGR 96 >04_01_0443 - 5776275-5777921 Length = 548 Score = 35.1 bits (77), Expect = 0.077 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 776 AATAXSVFFCGAILGGFIFGWIXDKYGR 859 +A V FCG + G FGW+ DK GR Sbjct: 69 SAAVNGVAFCGTLAGQLFFGWLGDKMGR 96 >08_02_1613 + 28236989-28238593 Length = 534 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 770 HYAATAXSVFFCGAILGGFIFGWIXDKYGR 859 H +A+ V F G + G FGW+ DK GR Sbjct: 73 HVSASVNGVAFVGTLSGQLFFGWLGDKLGR 102 >03_01_0354 + 2785998-2787623 Length = 541 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 776 AATAXSVFFCGAILGGFIFGWIXDKYGR 859 AA V CG + G FGW+ DK GR Sbjct: 72 AAAVNGVALCGTLSGQLFFGWLGDKLGR 99 >10_08_0182 + 15513693-15515273 Length = 526 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 776 AATAXSVFFCGAILGGFIFGWIXDKYGR 859 +A V CG + G FGW+ DK GR Sbjct: 70 SAAVNGVALCGTLAGQLFFGWLGDKLGR 97 >04_01_0449 + 5830017-5830272,5830376-5830620,5831994-5833019 Length = 508 Score = 32.7 bits (71), Expect = 0.41 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 779 ATAXSVFFCGAILGGFIFGWIXDKYGR 859 A + CG + G +FGW+ DK GR Sbjct: 65 AAVTGIALCGTVPGQLVFGWLGDKMGR 91 >03_01_0355 - 2789680-2791263 Length = 527 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 776 AATAXSVFFCGAILGGFIFGWIXDKYGR 859 +A V CG + G FGW+ DK GR Sbjct: 70 SAAVTGVALCGTLAGQLFFGWLGDKLGR 97 >03_01_0357 - 2797523-2799109 Length = 528 Score = 31.5 bits (68), Expect = 0.95 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 776 AATAXSVFFCGAILGGFIFGWIXDKYGR 859 ++ V CG + G FGW+ DK GR Sbjct: 70 SSAVTGVALCGTLAGQLFFGWLGDKLGR 97 >07_01_0365 + 2718707-2718839,2719335-2719405,2719512-2719955, 2720660-2721802 Length = 596 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 791 SVFFCGAILGGFIFGWIXDKYGR 859 S+ GAI+G I GW D+YGR Sbjct: 73 SMAVAGAIIGAAIGGWANDRYGR 95 >03_01_0256 - 1992298-1993878 Length = 526 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 776 AATAXSVFFCGAILGGFIFGWIXDKYGR 859 +A V F G + G FGW+ D+ GR Sbjct: 70 SAAVNGVAFVGTLTGQLFFGWLGDRVGR 97 >11_04_0305 - 16162063-16162096,16162282-16164365,16165283-16165351, 16168317-16169288,16169548-16169650,16170427-16170509 Length = 1114 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 502 ITPEEHWCSVPELANLSVIERRHLSIPMLNN 594 ++P+E+WCS+ EL LS E R L + L N Sbjct: 747 VSPKENWCSLEELECLS--ELRDLDLNCLEN 775 >04_04_0481 - 25541355-25541849,25541933-25542535,25542730-25542837, 25542925-25543260,25543391-25543461,25543692-25543824 Length = 581 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 782 TAXSVFFCGAILGGFIFGWIXDKYGR 859 T S+ GAI+G GW+ DK+GR Sbjct: 70 TIVSMAVAGAIVGAGFGGWMNDKFGR 95 >07_01_0693 - 5242932-5243213,5245544-5245695,5246267-5246291 Length = 152 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -1 Query: 586 TSVWIDDVVQSRSS--SLIPAQSTSAPPELW 500 TS W+DD + +L+P STS PE W Sbjct: 117 TSFWVDDWFPDSGAVANLVPIVSTSVKPEKW 147 >04_04_0345 - 24542869-24543540,24543725-24543805,24543845-24543910, 24543991-24544098,24545101-24545436,24545516-24545586, 24546105-24546252 Length = 493 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 Query: 782 TAXSVFFCGAILGGFIFGWIXDKYGR 859 T S+ GAI+G GWI D YGR Sbjct: 75 TIVSMALVGAIIGAAGGGWINDTYGR 100 >03_05_0434 + 24252994-24253449,24254791-24254877,24255450-24255748, 24256146-24256383,24256907-24257441,24257527-24257729, 24258311-24258520 Length = 675 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 791 SVFFCGAILGGFIFGWIXDKYGR 859 SV F G ++G +G++ DKYGR Sbjct: 258 SVVFAGMLIGASGWGFVSDKYGR 280 >10_03_0021 + 7129786-7130117,7130227-7130347,7131048-7131136, 7131375-7131459,7131609-7131771,7132861-7132937, 7133016-7133160,7133236-7133537,7133615-7133720, 7134781-7134935,7135556-7135712,7135799-7135891, 7136232-7136359,7136439-7136696,7136855-7137145, 7137235-7137318,7138335-7138468,7138557-7138784, 7139778-7139958,7140021-7140108,7140268-7140434, 7140750-7141012,7141117-7141120 Length = 1216 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +1 Query: 424 QRMLFLLMIPYAFFFAFVYFGQIFMAITPEEHWCSVPELANLSV 555 ++++ L+ + F F ++G + + +TP +H SV A S+ Sbjct: 1073 RKLVLYLIYMFLTFTYFTFYGMVAVGLTPTQHMASVVSSAFYSL 1116 >01_01_1224 - 9888726-9888820,9889042-9889085,9889194-9889282, 9889390-9889434,9889849-9889956,9890042-9890127, 9890324-9890411,9890669-9890872,9891251-9891326, 9891429-9891478,9891753-9891815,9891942-9891995, 9892079-9892181,9892266-9892368,9892563-9892623, 9892746-9892786,9893183-9893348 Length = 491 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +2 Query: 716 LMFLMKQLQXSXLGV*QGHYAATAXSVFFCGAILGGFIFGWIXDKYGR 859 L F+++ L+ + G YA + +F G + +G DKYGR Sbjct: 66 LYFMIRDLKVAKEEQDIGFYAGFVGATYFLGRTISAVPWGIFADKYGR 113 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,279,901 Number of Sequences: 37544 Number of extensions: 467622 Number of successful extensions: 1240 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1240 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2553813320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -