BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_F01 (911 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 43 3e-04 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 39 0.005 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 34 0.14 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 33 0.24 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 0.35 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 32 0.56 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 32 0.74 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 30 2.3 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 30 3.0 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 30 3.0 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 3.9 SB_53106| Best HMM Match : PLAT (HMM E-Value=0) 29 5.2 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 29 5.2 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 29 6.9 SB_50285| Best HMM Match : SAP (HMM E-Value=0.0036) 28 9.1 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_35622| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_21784| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 28 9.1 SB_5311| Best HMM Match : GnsAB (HMM E-Value=5.6) 28 9.1 SB_44935| Best HMM Match : SAP (HMM E-Value=1.7e-09) 28 9.1 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = +3 Query: 660 PTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXPXPXX 839 P PP P PS P P P PP P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 840 PXPPPXPP 863 P PPP PP Sbjct: 425 PPPPPPPP 432 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +3 Query: 657 PPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXPXPX 836 PP PP P P P S P P PP P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 837 XPXPPPXPPXXXXXPP 884 P PPP PP Sbjct: 426 PPPPPPPALRLACAPP 441 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +3 Query: 648 SXXPPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXP 827 S PP PP P P P P P PP P P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Query: 828 XPXXPXPPP 854 P P PPP Sbjct: 424 PPPPPPPPP 432 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/68 (26%), Positives = 18/68 (26%) Frame = +1 Query: 640 PXXPXXPPLPPXXPXXSXXPXPXXXXXXPXXXXXXXXPXXXXXXXPPPXXPXXXXXXXXX 819 P P PP PP P P P P P PPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 820 XXPXPXXP 843 P P P Sbjct: 425 PPPPPPPP 432 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/82 (24%), Positives = 20/82 (24%) Frame = +2 Query: 659 PHSPPXTLXXXXXXXPXXXXXLLXPXPXXXXPPXXXPXXPPXXXPXXXSXPXXXPXPXXX 838 P PP P P P PP P PP P P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 839 PXSPXXXXXXXXXPPXXXXXXP 904 P P PP P Sbjct: 427 PPPPPPALRLACAPPRLRFTSP 448 Score = 32.7 bits (71), Expect = 0.42 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXX-PXPPPXPPXXXXXPP 884 P PP P P P P P PPP PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 731 PXPXXXXPPXXXPXXPPXXXPXXXSXPXXXPXPXXXPXSPXXXXXXXXXPPXXXXXXP 904 P P PP P PP P P P P P P PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/56 (26%), Positives = 15/56 (26%) Frame = +2 Query: 737 PXXXXPPXXXPXXPPXXXPXXXSXPXXXPXPXXXPXSPXXXXXXXXXPPXXXXXXP 904 P PP P PP P P P P P P PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/60 (25%), Positives = 16/60 (26%) Frame = +2 Query: 725 LXPXPXXXXPPXXXPXXPPXXXPXXXSXPXXXPXPXXXPXSPXXXXXXXXXPPXXXXXXP 904 + P P PP PP P P P P P P PP P Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/69 (27%), Positives = 21/69 (30%) Frame = +3 Query: 657 PPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXPXPX 836 PP PP P+ P P + P P P P P P Sbjct: 139 PPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPP 198 Query: 837 XPXPPPXPP 863 P PPP PP Sbjct: 199 PPPPPPPPP 207 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/95 (23%), Positives = 26/95 (27%), Gaps = 6/95 (6%) Frame = +3 Query: 618 PXNTTRXSTXSXXPPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPP----- 782 P + + PP PP P+ P P + P P PP Sbjct: 113 PPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 Query: 783 -XXXPXXXPXXXXXXPXPXXPXPPPXPPXXXXXPP 884 P P P PPP PP PP Sbjct: 173 AATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 31.5 bits (68), Expect = 0.98 Identities = 21/76 (27%), Positives = 23/76 (30%) Frame = +3 Query: 657 PPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXPXPX 836 PP PP P+ P P + P P PP P P P P Sbjct: 152 PPPPPIAPATGGPPPPPPIAPAATVP--APAVPLAAASPPPPSGGPPPPP------PPPP 203 Query: 837 XPXPPPXPPXXXXXPP 884 P PPP PP Sbjct: 204 PPPPPPILELAAPPPP 219 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/75 (26%), Positives = 22/75 (29%) Frame = +3 Query: 660 PTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXPXPXX 839 P PP P P+ P + P P PP P P P P Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN 184 Query: 840 PXPPPXPPXXXXXPP 884 P PP P PP Sbjct: 185 PPYPPPPNPPYPPPP 199 Score = 37.1 bits (82), Expect = 0.020 Identities = 21/76 (27%), Positives = 23/76 (30%) Frame = +3 Query: 657 PPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXPXPX 836 PP P P+ P+ P P P PP P P P P Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNA-PNPPPPNPPYPPPPN 216 Query: 837 XPXPPPXPPXXXXXPP 884 P PP PP PP Sbjct: 217 APNPPYPPPPNAPNPP 232 Score = 35.9 bits (79), Expect = 0.045 Identities = 24/101 (23%), Positives = 27/101 (26%) Frame = +3 Query: 582 WPPKIXAXYXXFPXNTTRXSTXSXXPPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXX 761 +PP Y P N + P PP P P+ P P Sbjct: 108 YPPPPNPPYPP-PPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN 166 Query: 762 XXXPXPPXXXPXXXPXXXXXXPXPXXPXPPPXPPXXXXXPP 884 P P P P P P P PP P PP Sbjct: 167 PPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 35.9 bits (79), Expect = 0.045 Identities = 27/103 (26%), Positives = 30/103 (29%), Gaps = 2/103 (1%) Frame = +3 Query: 582 WPPKIXAXYXXFPXNTTRXSTXSXXPPTP-PXXPSXXXPSXPXXXXXXSXXPXXXXXXXX 758 +PP Y P S + PP P P P P P + P Sbjct: 124 YPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Query: 759 XXXXPXPPXXXPXXXPXXXXXXPXPXXPXPPPX-PPXXXXXPP 884 P PP P P P P P PPP P PP Sbjct: 184 NPPYPPPPNP-PYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 35.1 bits (77), Expect = 0.079 Identities = 25/105 (23%), Positives = 27/105 (25%), Gaps = 4/105 (3%) Frame = +3 Query: 582 WPPKIXAXYXXFPXNTTRXSTXSXXPPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXX 761 +PP Y P + PP P P P P P Sbjct: 94 YPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPN 153 Query: 762 XXXPXPPXXXPXXXPXXXXXXPXPXXPXPP----PXPPXXXXXPP 884 P P P P P P P PP P PP PP Sbjct: 154 PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 34.7 bits (76), Expect = 0.10 Identities = 24/101 (23%), Positives = 28/101 (27%) Frame = +3 Query: 582 WPPKIXAXYXXFPXNTTRXSTXSXXPPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXX 761 +PP A Y P + PP+P P P+ P P Sbjct: 116 YPPPPNAPYPPPPNPPYPPPPNAPYPPSP-NAPYPPPPNPPYPPPLYPPPPNPPPPNAPY 174 Query: 762 XXXPXPPXXXPXXXPXXXXXXPXPXXPXPPPXPPXXXXXPP 884 P PP P P P P PP P PP Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 30.3 bits (65), Expect = 2.3 Identities = 28/116 (24%), Positives = 32/116 (27%), Gaps = 8/116 (6%) Frame = +3 Query: 561 CRXLMRNW-------PPKIXAXYXXFPXNTTRXSTXSXXPPTPPXXPSXXXPSXPXXXXX 719 C ++ NW P + A P + PP PP P P P Sbjct: 58 CAWMVNNWSVEHPDAPCLVSAKCGGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNP--- 114 Query: 720 XSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXPXPXXPXP-PPXPPXXXXXPP 884 P P PP P P P P P PP PP PP Sbjct: 115 ----PYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNA-PYPPPPNPPYPPPLYPPPP 165 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/58 (25%), Positives = 16/58 (27%) Frame = +2 Query: 731 PXPXXXXPPXXXPXXPPXXXPXXXSXPXXXPXPXXXPXSPXXXXXXXXXPPXXXXXXP 904 P P PP P PP P + P P P P PP P Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNP 204 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/82 (21%), Positives = 19/82 (23%) Frame = +2 Query: 659 PHSPPXTLXXXXXXXPXXXXXLLXPXPXXXXPPXXXPXXPPXXXPXXXSXPXXXPXPXXX 838 P+ PP P P P P P PP P P P Sbjct: 115 PYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPY 174 Query: 839 PXSPXXXXXXXXXPPXXXXXXP 904 P P PP P Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYP 196 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/71 (25%), Positives = 18/71 (25%), Gaps = 2/71 (2%) Frame = +3 Query: 657 PPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXPX-- 830 PP P P P P P PP P P P Sbjct: 169 PPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNA 228 Query: 831 PXXPXPPPXPP 863 P P PPP P Sbjct: 229 PNPPYPPPPNP 239 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 35.5 bits (78), Expect = 0.060 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = +3 Query: 660 PTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXPXPXX 839 P PP P PS P + P P P P P P P Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSA----PPPGGGAPPLPPPPGGSAPPPPP 986 Query: 840 PXPPPXPP 863 P PPP PP Sbjct: 987 PPPPPPPP 994 Score = 32.7 bits (71), Expect = 0.42 Identities = 21/79 (26%), Positives = 22/79 (27%) Frame = +3 Query: 648 SXXPPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXP 827 S PP PP + P P S P P P P P Sbjct: 918 SVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPP--PPPGGSAPPPGGGAPPLPP 975 Query: 828 XPXXPXPPPXPPXXXXXPP 884 P PPP PP PP Sbjct: 976 PPGGSAPPPPPPPPPPPPP 994 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXXPXPPPXPPXXXXXP 881 P PP P P P P P PPP PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 28.3 bits (60), Expect = 9.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 752 PPXXXPXXPPXXXPXXXSXPXXXPXPXXXPXSP 850 PP P PP P S P P P P P Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXXPXPPPXPP 863 P PP P P P P P PPP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXXPXPPPXP 860 P PP P P P P P PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 792 PXXXPXXXXXXPXPXXPXPPPXPPXXXXXPP 884 P P P P P PPP PP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXXPXPPPXPP 863 P PP P P P P P PPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 27.9 bits (59), Expect(2) = 0.35 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +3 Query: 777 PPXXXPXXXPXXXXXXPXPXXPXPPPXPP 863 P P P P P P PPP PP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPP 116 Score = 23.8 bits (49), Expect(2) = 0.35 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 840 PXPPPXPPXXXXXPP 884 P PPP PP PP Sbjct: 138 PPPPPPPPPAPCMPP 152 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 32.3 bits (70), Expect = 0.56 Identities = 23/90 (25%), Positives = 23/90 (25%) Frame = -1 Query: 908 GXXGXXXXXGXXXXXGXXXXGXGXXGXGXXXXXXXXXXXGXXGGGXXXXXXXGXXXXXXX 729 G G G G G G G G G GGG G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGD 838 Query: 728 XGXXXXXXGXGXXXXXGXXGGSGGXXGXCG 639 G G G G GG GG G G Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 29.9 bits (64), Expect = 3.0 Identities = 22/90 (24%), Positives = 22/90 (24%) Frame = -1 Query: 908 GXXGXXXXXGXXXXXGXXXXGXGXXGXGXXXXXXXXXXXGXXGGGXXXXXXXGXXXXXXX 729 G G G G G G G G G GGG G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGD 832 Query: 728 XGXXXXXXGXGXXXXXGXXGGSGGXXGXCG 639 G G G GG GG G G Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 31.9 bits (69), Expect = 0.74 Identities = 22/82 (26%), Positives = 23/82 (28%) Frame = +3 Query: 618 PXNTTRXSTXSXXPPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPX 797 P TT +T PT P P P P P P PP P Sbjct: 133 PAKTTSATTKPVMTPTTPA-PMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPR 191 Query: 798 XXPXXXXXXPXPXXPXPPPXPP 863 P P PPP PP Sbjct: 192 TQPPPIPPI-DPPRTQPPPIPP 212 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/52 (28%), Positives = 17/52 (32%) Frame = +1 Query: 637 DPXXPXXPPLPPXXPXXSXXPXPXXXXXXPXXXXXXXXPXXXXXXXPPPXXP 792 DP PP+PP P + P P P P PPP P Sbjct: 175 DPPRTQPPPIPPIDPPRT-QPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFP 225 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.9 bits (69), Expect = 0.74 Identities = 22/89 (24%), Positives = 25/89 (28%), Gaps = 3/89 (3%) Frame = +3 Query: 627 TTRXSTXSXXPPTP--PXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXX 800 T + +T + PP P P P P P P PP Sbjct: 900 TPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALP 959 Query: 801 XPXXXXXXPXPXXPX-PPPXPPXXXXXPP 884 P P P P PPP PP P Sbjct: 960 PPIPATQVPPPPLPPLPPPPPPVQTTTAP 988 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXXPXPPPXP 860 P PP P P P P P PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXXPXPPPXPPXXXXXPP 884 P PP P P P PPP PP PP Sbjct: 367 PPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/80 (25%), Positives = 20/80 (25%), Gaps = 4/80 (5%) Frame = +3 Query: 657 PPTPPXXPSXXXPSXPXXXXXX----SXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXX 824 PP PP S P P P P P P P Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRP 385 Query: 825 PXPXXPXPPPXPPXXXXXPP 884 P PPP PP PP Sbjct: 386 PSSLGNPPPPPPPGRGAPPP 405 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +1 Query: 649 PXXPPLPPXXPXXSXXPXPXXXXXXPXXXXXXXXPXXXXXXXPPPXXPXXXXXXXXXXXP 828 P PP PP P + P P P P PP P P Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPET-PLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPP 246 Query: 829 XPXXPLP 849 P PLP Sbjct: 247 MPETPLP 253 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXXPXPPPXPPXXXXXPP 884 P PP P P P P PPP P PP Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPP 247 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/58 (25%), Positives = 16/58 (27%) Frame = +2 Query: 731 PXPXXXXPPXXXPXXPPXXXPXXXSXPXXXPXPXXXPXSPXXXXXXXXXPPXXXXXXP 904 P P PP P P P + P P P P P PP P Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXXPX-PPPXPPXXXXXPP 884 P PP P P P P P PP PP PP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPP 385 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = +2 Query: 659 PHSPPXTLXXXXXXXPXXXXXLLXPXPXXXXPPXXXPXXPPXXXPXXXSXPXXXPXPXXX 838 P SPP P P P PP P P P + P P P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG 413 Query: 839 PXS 847 P S Sbjct: 414 PPS 416 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 3.9 Identities = 21/74 (28%), Positives = 22/74 (29%), Gaps = 2/74 (2%) Frame = +3 Query: 648 SXXPPTPPXXPSXXXPSXPXXXXXXSXXPXXXXXXXXXXXXPXPPXXXPXXXPXXXXXXP 827 S PP PP P P+ P P P P P P P Sbjct: 47 SSSPPPPPPSPPAAAPAAPPPPAAAPAAPPP----------PAAPPAAPPPPPPLPAPPP 96 Query: 828 XPXX--PXPPPXPP 863 P P PPP PP Sbjct: 97 PPAQPAPQPPPAPP 110 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXXPXPPPXPPXXXXXPP 884 P PP P P P P PPP PP PP Sbjct: 555 PPPPPGVDIPPPLPPSEDPKP--PPPPPEPPEECPPPP 590 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 780 PXXXPXXXPXXXXXXPXPXXPXPPPXPPXXXXXPP 884 P P P P P PPP PP PP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPP 576 >SB_53106| Best HMM Match : PLAT (HMM E-Value=0) Length = 1790 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +1 Query: 256 LTKSKDAQDFXQGLEGRLRVRAATAQRLRQESPAXRSETRTARPRRL 396 L ++KDA F QG R R+RA +LR + + R +RPR L Sbjct: 1090 LGENKDAMHFQQGQTDRFRIRAKDVGKLR--TFRVGHDNRGSRPRWL 1134 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 29.1 bits (62), Expect = 5.2 Identities = 22/90 (24%), Positives = 22/90 (24%) Frame = -1 Query: 908 GXXGXXXXXGXXXXXGXXXXGXGXXGXGXXXXXXXXXXXGXXGGGXXXXXXXGXXXXXXX 729 G G G G G G G G G GGG G Sbjct: 131 GYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGG 190 Query: 728 XGXXXXXXGXGXXXXXGXXGGSGGXXGXCG 639 G G G G GG G G G Sbjct: 191 YGGGGYGGGGGGYGGSGYGGGGGYGGGGYG 220 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 2/40 (5%) Frame = +3 Query: 771 PXPPXXXPXXXPXXXXXXPXPXXPXPPP--XPPXXXXXPP 884 P PP P P P P P PPP PP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 2/40 (5%) Frame = +3 Query: 771 PXPPXXX--PXXXPXXXXXXPXPXXPXPPPXPPXXXXXPP 884 P PP P P P P PPP PP PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPP 332 >SB_50285| Best HMM Match : SAP (HMM E-Value=0.0036) Length = 1136 Score = 28.3 bits (60), Expect = 9.1 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 181 APDFFKDIEHHTKEFHKTLXQQFNSLTKSKDAQDFXQGLEGRLRVRAATAQRLRQ 345 A D + HH + K + QQF S KSK F + ++ + +R T++ L + Sbjct: 425 AEDCDNENTHHQRSHCKNV-QQFLSSDKSKQKFSFIKSMDDKAYIRPGTSEGLEK 478 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 28.3 bits (60), Expect = 9.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 825 PXPXXPXPPPXPPXXXXXPP 884 P P P PPP PP PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPP 881 >SB_35622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 441 Score = 28.3 bits (60), Expect = 9.1 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 181 APDFFKDIEHHTKEFHKTLXQQFNSLTKSKDAQDFXQGLEGRLRVRAATAQRLRQ 345 A D + HH + K + QQF S KSK F + ++ + +R T++ L + Sbjct: 280 AEDCDNENTHHQRSHCKNV-QQFLSSDKSKQKFSFIKSMDDKAYIRPGTSEGLEK 333 >SB_21784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 28.3 bits (60), Expect = 9.1 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 181 APDFFKDIEHHTKEFHKTLXQQFNSLTKSKDAQDFXQGLEGRLRVRAATAQRLRQ 345 A D + HH + K + QQF S KSK F + ++ + +R T++ L + Sbjct: 80 AEDCDNENTHHQRSHCKNV-QQFLSSDKSKQKFSFIKSMDDKAYIRPGTSEGLEK 133 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 28.3 bits (60), Expect = 9.1 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +3 Query: 777 PPXXXPXXXPXXXXXXPXPXXPXPPPXPPXXXXXPP 884 PP P P P P PP PP PP Sbjct: 475 PPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPP 510 >SB_5311| Best HMM Match : GnsAB (HMM E-Value=5.6) Length = 199 Score = 28.3 bits (60), Expect = 9.1 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 181 APDFFKDIEHHTKEFHKTLXQQFNSLTKSKDAQDFXQGLEGRLRVRAATAQRLRQ 345 A D + HH + K + QQF S KSK F + ++ + +R T++ L + Sbjct: 105 AEDCDNENTHHQRSHCKNV-QQFLSSDKSKQKFSFIKSMDDKAYIRPGTSEGLEK 158 >SB_44935| Best HMM Match : SAP (HMM E-Value=1.7e-09) Length = 1487 Score = 28.3 bits (60), Expect = 9.1 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 181 APDFFKDIEHHTKEFHKTLXQQFNSLTKSKDAQDFXQGLEGRLRVRAATAQRLRQ 345 A D + HH + K + QQF S KSK F + ++ + +R T++ L + Sbjct: 401 AEDCDNENTHHQRSHCKNV-QQFLSSDKSKQKFSFIKSMDDKAYIRPGTSEGLEK 454 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,893,464 Number of Sequences: 59808 Number of extensions: 311578 Number of successful extensions: 2292 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1532 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2633701421 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -