BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E24 (1052 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 24 2.2 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 22 6.8 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 22 6.8 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 6.8 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 23.8 bits (49), Expect = 2.2 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -3 Query: 570 PQFFLIIRRMSSVTVSHINIYWLGVKXEEALEQAVSLEG 454 P FL+ R ++ S + I WL V + + VSL G Sbjct: 529 PAPFLLKRENYTLPASAVGIAWLYVDNDCCIRYDVSLSG 567 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 22.2 bits (45), Expect = 6.8 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +1 Query: 475 FQRFLRFNPKPIYIDMGNRYRRHASDDQEELRQYNEHFLIPRDIF 609 F R L N P+ + + + + +EEL ++ E L D++ Sbjct: 401 FNRHLNSNRAPLGLHFHASWLKSKKEFKEELIKFIEEMLQRNDVY 445 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 22.2 bits (45), Expect = 6.8 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = +1 Query: 475 FQRFLRFNPKPIYIDMGNRYRRHASDDQEELRQYNEHFLIPRDIF 609 F R L N P+ + + + + +EEL ++ E L D++ Sbjct: 408 FNRHLNSNRAPLGLHFHASWLKSKKEFKEELIKFIEEMLQRNDVY 452 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 6.8 Identities = 8/34 (23%), Positives = 17/34 (50%) Frame = +3 Query: 276 PILPSKIDDVQLDPNRRYVRSVTNPENNEASIEH 377 PI DD+ + + +S+TN + +++H Sbjct: 284 PIWTRNADDISQEEYGEFYKSLTNDWEDHLAVKH 317 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,470 Number of Sequences: 336 Number of extensions: 3895 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 58 effective length of database: 103,097 effective search space used: 30104324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -