BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E24 (1052 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 27 1.2 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 26 2.2 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 26.6 bits (56), Expect = 1.2 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 245 CSSCAKYCRPSDSSFENRRRAARSKPKVCSQCHQSR 352 CS YC P S + +R++PK+ +QC +R Sbjct: 59 CSDATHYCCPDRSE----QLPSRNRPKLLTQCDSNR 90 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 25.8 bits (54), Expect = 2.2 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -1 Query: 317 WIELHVVDFRRKNRMVCSTWRTRNIVTLIQP*RFLASLSRCTCYRALCWRW 165 W+ L+VV+ ++WR N++ I L ++S TCY + W Sbjct: 336 WLPLNVVNMCNDFNSDINSWRFYNLIFFI---AHLTAMS-STCYNPFLYAW 382 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 816,387 Number of Sequences: 2352 Number of extensions: 17328 Number of successful extensions: 81 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 563,979 effective HSP length: 65 effective length of database: 411,099 effective search space used: 117163215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -