BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E24 (1052 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U93847-1|AAB58269.1| 760|Caenorhabditis elegans elongation fact... 29 5.6 U93846-1|AAB58268.1| 768|Caenorhabditis elegans elongation fact... 29 5.6 U10414-7|AAN63383.1| 768|Caenorhabditis elegans Elongation fact... 29 5.6 U10414-6|AAN63384.1| 760|Caenorhabditis elegans Elongation fact... 29 5.6 >U93847-1|AAB58269.1| 760|Caenorhabditis elegans elongation factor-2 kinase EFK-1B isoform protein. Length = 760 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -3 Query: 339 HCEHTFGLDRAARRRFSKEESDGLQYLAHEEHCHLDTAIAVPGQL 205 H EH +D+ +R+ + S L +H E C I V QL Sbjct: 353 HVEHGISMDQLRKRKTLNQSSTDLSAKSHNEDCVCPECIPVVEQL 397 >U93846-1|AAB58268.1| 768|Caenorhabditis elegans elongation factor-2 kinase EFK-1A isoform protein. Length = 768 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -3 Query: 339 HCEHTFGLDRAARRRFSKEESDGLQYLAHEEHCHLDTAIAVPGQL 205 H EH +D+ +R+ + S L +H E C I V QL Sbjct: 353 HVEHGISMDQLRKRKTLNQSSTDLSAKSHNEDCVCPECIPVVEQL 397 >U10414-7|AAN63383.1| 768|Caenorhabditis elegans Elongation factor kinase protein1, isoform a protein. Length = 768 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -3 Query: 339 HCEHTFGLDRAARRRFSKEESDGLQYLAHEEHCHLDTAIAVPGQL 205 H EH +D+ +R+ + S L +H E C I V QL Sbjct: 353 HVEHGISMDQLRKRKTLNQSSTDLSAKSHNEDCVCPECIPVVEQL 397 >U10414-6|AAN63384.1| 760|Caenorhabditis elegans Elongation factor kinase protein1, isoform b protein. Length = 760 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -3 Query: 339 HCEHTFGLDRAARRRFSKEESDGLQYLAHEEHCHLDTAIAVPGQL 205 H EH +D+ +R+ + S L +H E C I V QL Sbjct: 353 HVEHGISMDQLRKRKTLNQSSTDLSAKSHNEDCVCPECIPVVEQL 397 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,608,184 Number of Sequences: 27780 Number of extensions: 377437 Number of successful extensions: 1211 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1211 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2803879784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -