BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E23 (967 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 50 3e-06 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 42 7e-04 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 42 0.001 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 40 0.003 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 39 0.005 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 39 0.007 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 38 0.016 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 37 0.021 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 36 0.049 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 36 0.065 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 36 0.065 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.065 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.065 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.065 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 36 0.065 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 35 0.086 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 35 0.11 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 35 0.11 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 33 0.26 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 33 0.26 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 33 0.35 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 33 0.46 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 32 0.61 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 32 0.80 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 31 1.1 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 31 1.1 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 31 1.1 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 31 1.1 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 31 1.1 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.8 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 30 2.4 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 30 2.4 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 30 2.4 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 30 2.4 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 30 2.4 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 30 2.4 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 30 2.4 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 30 2.4 SB_41386| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 30 3.2 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 30 3.2 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 30 3.2 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 3.2 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 30 3.2 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 29 4.3 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 29 4.3 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 29 4.3 SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 5.6 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 5.6 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 29 5.6 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 7.5 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 29 7.5 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 28 9.9 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 28 9.9 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_42793| Best HMM Match : PARP (HMM E-Value=5.4e-22) 28 9.9 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 28 9.9 SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 28 9.9 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 28 9.9 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 28 9.9 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 50.0 bits (114), Expect = 3e-06 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P + P P PPPP P P P PP P PPPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 49.6 bits (113), Expect = 4e-06 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P+ P P PPPP P P P PP P PPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 48.8 bits (111), Expect = 7e-06 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PPPP P P P PP P PPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 48.8 bits (111), Expect = 7e-06 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PPPP P P P PP P PPPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 48.8 bits (111), Expect = 7e-06 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PPPP P P P PP P PPPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/59 (33%), Positives = 24/59 (40%) Frame = +2 Query: 788 RTXIXQLXXXXHPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 R + + + +PP P PSP PPP P P P PP P PPPP Sbjct: 351 RAIVTDISAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 46.8 bits (106), Expect = 3e-05 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 PP P P P PPPP P P P PP P PPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 46.8 bits (106), Expect = 3e-05 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P+PP P P P PPPP P P P PP P PPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P+PP P P P PPPP P P P PP P PPP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PPPP P P P PP PPPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P+ P PPPP P P P PP P PPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 46.0 bits (104), Expect = 5e-05 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PPP P P P PP P PPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 45.6 bits (103), Expect = 6e-05 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P P PP P P P PP P PPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 45.6 bits (103), Expect = 6e-05 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PP P P P P PP P PPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 45.6 bits (103), Expect = 6e-05 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P P PP P P P PP P PPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P PPPP P P P P P PPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPP 943 P PP P P P PPPP P P PP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 863 PSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P PPPP P P P PP P PPPP Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 42.3 bits (95), Expect = 6e-04 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 PP P P P PPPP P P P P P PPPP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P P PP P P P P P PPPP Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PPPP P P P PP P PP P Sbjct: 112 PNPPYPPPPNAPYPPP-PNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 +P PP P P P PPPP P P P P P PPPP Sbjct: 148 YPPPPNPPYPPPLYPPP----PNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPP 958 P PP P P P+ PP P P P P PP P PP Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPP--PXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PPP P P P P PP P PP P Sbjct: 191 PNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPP---XPXPPPP 964 +P PP P P PPPP P P P PP P PPPP Sbjct: 102 YPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPP 958 P PP P P P PPPP P P P PP P PP Sbjct: 183 PNPPYPPPPNPPYPPP-PNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPP-XPXPPPP 964 PP P P P PP P P P P PP P PPPP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 +P PP P P P PPPP P P P PP P P P Sbjct: 174 YPPPPYPPPPNPPYPPP-PNPPYPPPPNAPNPPPPNPPYPPPPNAPNP 220 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 +P PP P P PPPP P P P PP P P P Sbjct: 94 YPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSP-HXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P+P + PPPP P P P PP P PP P Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPP-PPYPPPPNP 185 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P P PPP P P P PP PPP Sbjct: 150 PPPNPPYPPP----LYPPPPNPPPPNAPYPPPPYPPPPNPPYPPP 190 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +2 Query: 821 HPTPPXXXXP-AXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 +P PP P A P P+ PP P P P P P P PP P Sbjct: 161 YPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 824 PTPPXXXXP-AXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P A PSP+ PPPP P P PP P PPPP Sbjct: 128 PNPPYPPPPNAPYPPSPNAPY--PPPP---NPPYPPPLYPPPPNPPPP 170 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPP-PXXPXPXXPXXXXPPXPXPPPP 964 +P PP P P P PPP P P P PP P PPP Sbjct: 166 NPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 828 PPPXXPXPXP--GXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPP 959 PPP P P P P PPP P P P PP PP Sbjct: 110 PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP 155 Score = 36.3 bits (80), Expect = 0.037 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXP---XPXXPXXXXPPXPXPPPP 964 P P P+ P P PPP P P P PP P PPPP Sbjct: 134 PPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXP-XPXXPXXXXPPXPXPPPP 964 P PP P P P PPP P P P PP P PP P Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 828 PPPXXPXPXP-GXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P P PPP P P P PP PPP Sbjct: 181 PPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP-PPPNAPNPPYPPP 225 Score = 35.5 bits (78), Expect = 0.065 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P P P P P P P PP PPP Sbjct: 126 PPPNPPYPPP-PNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 828 PPPXXP-XPXPGXXXXTPXXXXXPPPXXXXXP--XPXXXXPXPPXPPP 962 PPP P P P P PPP P P P PP PPP Sbjct: 189 PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P P P P PPP P P P P P PPPP Sbjct: 181 PPPNPPYPPPPNPPYPPPPNAPNPPPPNP-PYPPPPNAPNPPYPPPP 226 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 HP P P PP P P P P PP P PPPP Sbjct: 69 HPDAPCLVSAKCGGHPPTNFSPNPPYPPPPYPPYP----PPPPYPPPP 112 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P P P P P P P P PPP Sbjct: 134 PPPNAPYP-PSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP 177 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +3 Query: 828 PPPXXPXPXP-GXXXXTPXXXXXPP-PXXXXXPXPXXXXPXPPXPPP 962 PPP P P P P PP P P P P P PPP Sbjct: 118 PPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPP 164 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXX-PPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P PPP P P P PP PPP Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPP----PNPPYPPP 198 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXP 956 PPP P P P P PPP P P P PP P Sbjct: 175 PPPPYPPP-PNPPYPPPPNPPYPPPPNAPNPPPPNP-PYPPPP 215 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P PP A P P PPPP P P P P P PPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P PPPP P P PP P PPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPP---PPPPPPPPPP 325 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 843 PXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 P P P + PPP P P P PP PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPP----PPPPPPPP 325 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 HPT P P P PPPP P P P PP P PP P Sbjct: 194 HPTSPSQITQPP-PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P PP P+ P P P PP P P P P PPP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P PP P PSP PPPP P P P P P P P Sbjct: 209 PRPPPSPPPPPPPPSPSPPR--PPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +3 Query: 822 TQPPPXXPXPXPGXXXX----TPXXXXXPPPXXXXXPXP-XXXXPXPPXPP 959 TQPPP P P P +P PPP P P P PP P Sbjct: 202 TQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXP-XXPXXXXPPXPXPPP 961 P PP P+ P P PPPP P P PP P PP Sbjct: 216 PPPPPPPSPSPPRPPP------PPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P P P P P P PP PP Sbjct: 217 PPPPPPSPSP-PRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G G GGGG G G AG G G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G G GGGG G G G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 G GG G GG G G G GGGG G G G GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 G GG G GG G G G GGGG G G G GG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G G GGGG G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG GG G G G GGG G G G G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG GG G G G GGG G G G G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG GG G G G GGG G G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGG 830 G GGG GG G G G GGG G G G G G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGG 830 G GG GG G G G GGG G G G G GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGG 830 G GGG GG G G G GGG G G G G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P PP P PPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P PP P PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPP 961 PPPP P P P PP P PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 893 PPPXXPXPXXPXXXXPPXPXPPPP 964 PPP P P P PP P PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 863 PSPHXXXXXPPPPXXPXPXXPXXXXPPXPXP 955 P P PPPP P P P PP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P PPP P P P PP P P Sbjct: 464 PPPPPPPPPP------------PPPPPPPPPPPPPPFPPPPPPTP 496 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P PP P PPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P PP P PPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P PP P PPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P PP P PPPP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P PP P PP P Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +2 Query: 791 TXIXQLXXXXHPTPPXXXXPAXRXPSPHXXXXXPPPPXXP 910 T + + P PP P PSP PPPP P Sbjct: 1147 TLVFSVRDQIPPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 876 PXXXXXPPPXXXXXPXPXXXXPXPPXPP 959 P PPP P P P PP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 PP PA P PPPP P P P P P P PP Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP A P P PPP P P PP P PPPP Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAP-PPPPPLPAPPPP 97 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P P A P P PPP P P P P P PPP Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P PPP P P P PP PP Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +3 Query: 822 TQPPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 + PPP P P P P PP P P P P PPP Sbjct: 48 SSPPPPPPSP-PAAAPAAP----PPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = +2 Query: 869 PHXXXXXPPPPXXPXPXXPXXXXPPXP-----XPPPP 964 PH PPPP P P PP P PPPP Sbjct: 43 PHFISSSPPPP-PPSPPAAAPAAPPPPAAAPAAPPPP 78 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGV 826 GGG G GG G G G GGGG G G G GGV Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGV 877 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G G GGGG G G GG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGG 815 Score = 36.3 bits (80), Expect = 0.037 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 961 GGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 GGG GG G G G GGG G G G G GGG Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGG 857 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGG 829 GGGG G GG G G G GGGG G G GG Sbjct: 797 GGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G G G GGG Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGG 830 G GGG GG G G G GGG G G G G GG Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G G GGG G G G GG G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G GGGG G G G GG G Sbjct: 791 GGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFG 837 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG GG G G GGG G G G G GGG Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGG 863 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G G GGG G G G G GGG Sbjct: 825 GDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG G GG G G G GGGG G G GG G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G GGG G G G GG G Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGG 863 Score = 33.9 bits (74), Expect = 0.20 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = -2 Query: 963 GGGGXG----XGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G G GGGG G G G GG G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGG 829 GGGG G G G G GGGG G G G GG Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG GG G G G GGG G G G G GGG Sbjct: 770 GGGGGDGGDGGGG-GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGG 815 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G G GGGG Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G G GGGG Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G G GGGG Sbjct: 850 GGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G G GGGG Sbjct: 851 GGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G G GGGG Sbjct: 852 GGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G G GGG Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGG 819 Score = 32.3 bits (70), Expect = 0.61 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXG---XXGGGW 824 G GGG GG G G G GGG G G G G GGG+ Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGY 842 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGG 830 G GGG G G G G GGG G G G G GG Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG GG G G GGGG G G G GG G Sbjct: 827 GGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G GGG G G GG G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPP 958 +P PP P P + PPP P P P PP P PP Sbjct: 345 NPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPP 958 P PP P P + PPP P P P PP P PP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 PP P P P PPPP P P P PPPP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPP-XXPXPXXPXXXXPPXPXPP 958 P+PP P P PPPP P P P PP P PP Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 35.9 bits (79), Expect = 0.049 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P PP P+ P P PPPP P P P P PPP Sbjct: 347 PPPPTNNPPSP--PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 35.9 bits (79), Expect = 0.049 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 827 TPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 TPP P + P P PPPP P P P PPPP Sbjct: 364 TPPPPP-PTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 822 TQPPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 T PPP P T PPP P P PP PPP Sbjct: 364 TPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P PPP P P PP PPP Sbjct: 358 PPPTNNTPPPPPPTNKPPPP--PPPTNGPPPPPPPTNGPPPPPPP 400 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPP 958 PP P P P PPPP P P PP PP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPP-PPTNGPPPPPPPTNGPP 415 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPP 943 P PP P P + PPP P P P PP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P P PPPP P P P PP P PPP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P P P PPPP Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 863 PSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P P PPPP P P P PP P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P P PPPP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P P PPPP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P PP P P P Sbjct: 690 PPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P P PPP P P P P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P PP P PP Sbjct: 691 PPPPPPPPPPPQPSTPPPPPPSTPP 715 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG GG G G G GGG G G G G GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G GGG G G G GG G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 35.1 bits (77), Expect = 0.086 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G GGG G G GGVG Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 958 GGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 GG GG G G G GGG G G G G GGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG 105 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAG 847 GGG G GG G G G GGGG G G G Sbjct: 81 GGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P P PPP Sbjct: 558 HPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPP 604 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P P PPP Sbjct: 428 HPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 474 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P P PPP Sbjct: 448 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 494 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P P PPP Sbjct: 458 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPP 504 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P P PPP Sbjct: 478 HPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPP 524 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P P PPP Sbjct: 488 HPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 534 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P P PPP Sbjct: 508 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P P PPP Sbjct: 538 HPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPP 584 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P P PPP Sbjct: 438 HPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 484 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P PPP Sbjct: 468 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPP 514 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 H P P R P P PPP P P P P PPP Sbjct: 498 HQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 544 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P PPP Sbjct: 518 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPP 564 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PPP P P P PPP Sbjct: 528 HPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPP 574 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P R P P PPP P P P P PPP Sbjct: 548 HPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPP 594 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P P R P P PP P P P P PPP Sbjct: 398 HPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPP 444 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXP--XXXXPPXPXPPPP 964 HP P P R P P PPP P P P P P PP Sbjct: 578 HPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPP 627 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXP 940 HP P P R P P PPP P P P P Sbjct: 568 HPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 HP P R P PPP P P P P PPP Sbjct: 408 HPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPP 454 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P R P P PPP P P P P PPP Sbjct: 427 PHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPP 464 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P P P P P P P P P P PP P P Sbjct: 424 PGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHP 469 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P P P P P P P P P P PP P P Sbjct: 504 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHP 549 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G G GGG G G G GG G Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGG 213 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G G GGGG G G G GG G Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGG---GYGGSGYGGGGGYGGGGYG 220 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG G GG G G GGGG G G G GG G Sbjct: 151 GGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYG 197 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G G G G GGGG G G G GG G Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGG 202 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G G GG G G G GG G Sbjct: 182 GGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 961 GGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 GGG GG G G G GGG G G G GGG Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 32.7 bits (71), Expect = 0.46 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG GG G G G GGG G G G G GGG Sbjct: 131 GYGGGRGGGGGYRSGGGYR---GGGGYRGGGGGYRGRGRGGGGYGGG 174 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGGW 824 G GGG G G G G GGG G G G GGG+ Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGY 203 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G G GG G Sbjct: 138 GGGGYRSGGGYRGGGGYRG--GGGGYRGRGRGGGGYGGGGYGGGGYG 182 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG G GG G G GGGG G R G GG G Sbjct: 133 GGGRGGGGGYRSGG---GYRGGGGYRGGGGGYRGRGRGGGGYGGGG 175 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = -1 Query: 967 GXGGGX-GGXGXXXXGXGXXXXXGGG-XXXXXGVXXXXPGXGXGXXGGGW 824 G GGG GG G G G GGG G G G G GGG+ Sbjct: 170 GYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGY 219 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G GGG G G G GGG Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGG 211 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 36.3 bits (80), Expect = 0.037 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P R PSP PPP P P P PP PPPP Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPIPPPRKPSP-PPSEPAPPPRQPPPP 1079 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P P R PSP PPP P P PP P P Sbjct: 1049 PPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIP 1095 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PP P P P P PPP P P P P PPP Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPP-RKPSPPPSEPAPPPRQPPP 1078 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXP--XPXXXXPXPPXPPP 962 PPP P P P P PPP P P P PPP Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPP 1088 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 PP P R P P PPP P P P P P P Sbjct: 1065 PPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQP 1109 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +2 Query: 824 PTPPXXXX-PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PPP P P PP PPP Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPP 1073 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/60 (28%), Positives = 19/60 (31%) Frame = +2 Query: 785 TRTXIXQLXXXXHPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 T+ I + P P P R SP PPP P PP PPP Sbjct: 1007 TQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPP 1066 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P PPP P P P P PP Sbjct: 1064 PPPSEPAPPPRQPPPPSTSQPVPPP---RQPDPIPTNPAHPTEPP 1105 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXP 956 PPP P P P P PP P P P P P Sbjct: 1057 PPPRKPSPPPSEPAPPPRQPP-PPSTSQPVPPPRQPDPIPTNP 1098 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P PP PA P+P PP P PP P PPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 32.7 bits (71), Expect = 0.46 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +2 Query: 824 PTPPXXXXPAXRXP-SPHXXXXXPPPPXXP---XPXXPXXXXPPXPXPPPP 964 PTPP P R P +P PPPP P P P P PPPP Sbjct: 108 PTPP----PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPP 154 Score = 32.7 bits (71), Expect = 0.46 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +2 Query: 824 PTPPXXXXPAXRXP----SPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P PA P SP PPPP P P P PPPP Sbjct: 169 PIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +2 Query: 827 TPPXXXXPAXRXPSPHXXXXXPPPPXXP---XPXXPXXXXPPXPXPPPP 964 TP P SP PPPP P P P P PPPP Sbjct: 119 TPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXP---PPPXXPXPXXPXXXXPPXPXPPPP 964 PP PA R P P PPP P P P PP P P P Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPP--PPPIAPATGGPPPPPPIAP 172 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 6/53 (11%) Frame = +2 Query: 824 PTPPXXXXPAXRXP------SPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP PA P +P PPPP P P P PPP Sbjct: 138 PPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPP 190 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXG 862 GGGG G GG G G G GGGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXG 862 GGGG G GG G G G GGGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXG 862 GGGG G GG G G G GGGG G G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXG 875 G GGG GG G G G GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXG 875 G GGG GG G G G GGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXG 875 G GGG GG G G G GGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXG 875 G GGG GG G G G GGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXG 875 G GGG GG G G G GGG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXG 875 G GGG GG G G G GGG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXG 862 GGGG G GG G G G GGGG G G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAG 847 GGG GG G G G GGGG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGG 112 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXG 875 G GGG GG G G G GGG G Sbjct: 89 GGGGGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 35.5 bits (78), Expect = 0.065 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXX--PXPXXPXXXXPPXPXPPPP 964 P PP P P P PPP P P P PP P PPPP Sbjct: 945 PPPPGGNAPP---PPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPP----PPXXPXPXXPXXXXPPXPXPPPP 964 PP A P P PP PP P P PP P PPPP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPP 958 P PP P+ + P P PPPP P PP P PP Sbjct: 934 PPPPGGSAPS-QPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +3 Query: 822 TQPPPXX-----PXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 +QPPP P P PG P P P P P PP PPP Sbjct: 943 SQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXX-PPPPXXPXPXXPXXXXPPXPXPPPP 964 PP P P P PPPP P P PP P PPPP Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPP----PPPPPPPPP 994 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 827 TPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 +PP P P PPPP P P P PPPP Sbjct: 913 SPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P PPPP P P PP PPP Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP---PPGGSAPPP 966 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 G GG G GG G G G GGG G AG G VG Sbjct: 54 GAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVG 100 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GG G G GG G G G G G G G G GG G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAG 74 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG GG G G GG G G G G GG Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = -2 Query: 963 GGGGXGXG-GXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GG G G G G G G GGGG G G G G G Sbjct: 47 GGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG G GG G G GGG G G G G G Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNG 85 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXG 862 GGGG G GG G G GGG G G Sbjct: 78 GGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNG 111 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -1 Query: 961 GGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 GGG GG G G G GG G G G G GGG Sbjct: 36 GGGVGGGGGNGGGAGNGVG-AGGCGCGGGNDGGNGGGGAGNGGGG 79 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G G G GG G G GG G Sbjct: 35 GGGGVGGGGGNGGGA-GNG-VGAGGCGCGGGNDGGNGGGGAGNGGGG 79 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GG G GG G G G GG G GGVG Sbjct: 62 GGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVG 108 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G GGVG Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVG 329 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G G GGG GV G G GGG Sbjct: 297 GGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGG 343 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG GV G G G GGG Sbjct: 284 GGGGATGGGGGATGGGGGATGGGGG---ATGVGGGATGGGGGATGGG 327 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G GG G Sbjct: 318 GGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G GG G Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 294 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G GG G Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G GG G Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G GG G Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGG 322 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G G G GGG Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGG---GATGGGGGATGGG 285 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG G GG G G G GGGG G G GG G Sbjct: 243 GGGATGGGGGATGG--GGGATGGGGGATGGGGGATGGGGGATGGGGG 287 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G G G GGG Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGGG---GATGGGGGATGGG 292 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G G G GGG Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGGG---GATGGGGGATGGG 299 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G G G GGG Sbjct: 263 GGGGATGGGGGATGGGGGATGGGGGATGGGG---GATGGGGGATGGG 306 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G G G GGG Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGATGGGG---GATGVGGGATGGG 320 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G G G GGG Sbjct: 291 GGGGATGGGGGATGGGGGATGVGGGATGGGG---GATGGGVGATGGG 334 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G G GG G Sbjct: 297 GGGGGATGGGGGATGVGGGATGGGG-GATGGGVGATGGGGGATGGGG 342 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G G GG G Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGG--ATGGGGGATGGGGGATGGGG 286 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G G GGG G G G GGG Sbjct: 269 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGG 315 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G G GGG G G G G GGG Sbjct: 311 GVGGGATGGGGGATGGGVGATGGGGGATGGG--GGVTGGGGGATGGG 355 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVGCXXXXNC 802 GGG G GG G G G GGGG G G G GG G C Sbjct: 313 GGGATGGGGGATGG--GVGATGGGG-GATGGGGGVTGGGGGATGGGGGPGSGGC 363 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G G GVG Sbjct: 269 GGGGGATGGGGGATGGGGGATGGGG--GATGGGGGATGGGGGATGVG 313 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G G GGG G G G G G G Sbjct: 318 GGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG G G G G GGG G G G GG G Sbjct: 304 GGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGG 349 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXG 862 GGGG G GG G G G GGGG G G Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG GG G G G GGG G G G G GGG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGG---GGGGGGFGGGGGG 125 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXR 856 GGGG G GG G G G GGG G G R Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSR 130 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG G GG G G G GGGG G G G GG G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGG--GFGGGGGGGFG 128 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 35.1 bits (77), Expect = 0.086 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP + R P P PPPP P P P PPPP Sbjct: 326 PPPPPPSRSSQRPPPPSRGA--PPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 4/51 (7%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXP----XPPPP 964 P PP A P P PPPP P P P P PPPP Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPP 366 Score = 32.3 bits (70), Expect = 0.61 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 822 TQPPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 T PPP P P PPP P P PP PPP Sbjct: 324 TAPPPPPPS-RSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPP 369 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 833 PXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P A P P PPPP P P P PPPP Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 4/51 (7%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXP----PPP 964 P P P P P PPPP P PP P P PPP Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 PP P P PPP P P P PPPP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P G P PP P P P P P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P P PPPP P P PP P PPPP Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGL--PPPPPPPPP 748 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P P PPPP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 31.9 bits (69), Expect = 0.80 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +2 Query: 785 TRTXIXQLXXXXHPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 TRT Q PP P PPPP P PP P PPPP Sbjct: 662 TRTTTSQEQEKLKKVPPPPP-PLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 822 TQPPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 T P P P P P P PPP P P PP PPP Sbjct: 708 TLPMPPPPPPPP------PGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 7/52 (13%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXP-------XXXXPXPPXPPP 962 PPP P P P PPP P P P PP PPP Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P P P PPP P P PP P P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLP----PPPPSPQP 734 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 1/47 (2%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXX-PPPPXXPXPXXPXXXXPPXPXPPP 961 P PP PSP PPPP P P PP P P Sbjct: 717 PPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P P P PP P P PP P P P Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +2 Query: 851 AXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXP---PPP 964 A PSP PPPP P P P PP P P PPP Sbjct: 184 AANKPSP-MAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPP 950 PPP P P PG P PPP P P PP Sbjct: 195 PPPPPPPPPPGFPGGAP----PPPPPPFGAPPPPALNGGPP 231 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 PT P R P PPP P P PP P PPPP Sbjct: 937 PTTPTTQASTTRPTPPPPTSALPPP--IPATQVPPPPLPPLPPPPPP 981 Score = 32.3 bits (70), Expect = 0.61 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P +P PPPP P P PP P PPPP Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPP----PPLPPPPPP 928 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 PTPP P P P PPPP P P P PP Sbjct: 949 PTPPP---PTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 28.7 bits (61), Expect = 7.5 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 5/67 (7%) Frame = +2 Query: 779 PXTRTXIXQLXXXXHPTPPXXXXPAXRXPSPHXXXXXPPPP-XXPXPXXP----XXXXPP 943 P T T PT P P P P PPPP P P Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTT 947 Query: 944 XPXPPPP 964 P PPPP Sbjct: 948 RPTPPPP 954 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G G GGGG Sbjct: 82 GGGGDGDGGGGGDGDGGGGGDGGGG 106 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGG G GG G G G GGGG Sbjct: 77 GGGCDGGGGDGDGGGGGDGDGGGGG 101 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G G GGGG Sbjct: 90 GGGGDGDGGGGGDG--GGGGDGGGG 112 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXG---GGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G G G GG G G G G GGG Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG 100 Score = 28.7 bits (61), Expect = 7.5 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = -2 Query: 963 GGGGXGXG-GXXXXGXXGXGXXGG--GGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G G G G G GG GG G G G GG G Sbjct: 51 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG 100 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G G GGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP PA +P PPP P P PP PPPP Sbjct: 162 PQPPAP--PAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPP 958 P PP A P P P P P PP P PP Sbjct: 165 PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G G GGGG Sbjct: 97 GGGGDGDGGGGGDGDGGGGGDGGGG 121 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGG G GG G G G GGGG Sbjct: 92 GGGCDGGGGDGDGGGGGDGDGGGGG 116 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G G GGGG Sbjct: 105 GGGGDGDGGGGGDG--GGGGDGGGG 127 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXG---GGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G G G GG G G G G GGG Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG 115 Score = 28.7 bits (61), Expect = 7.5 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = -2 Query: 963 GGGGXGXG-GXXXXGXXGXGXXGG--GGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G G G G G GG GG G G G GG G Sbjct: 66 GGGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGG 115 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPP 961 PPPP P P PP P PPP Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPP 28 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +2 Query: 857 RXPSPHXXXXXPPPP-----XXPXPXXPXXXXPPXPXPPPP 964 R P+P PPPP P P P P P PPPP Sbjct: 643 RPPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPP 958 PP P P PPPP P P PP P PP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVP---GPPKPPPP 683 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G GGG G G G G GGG Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G G GGG G G G G GGG Sbjct: 148 GRGGGRG-RGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGG 193 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXG 832 GGG G GG G G G GGG G G R G G Sbjct: 156 GGGEGGWGGRGGNG-GGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 893 PPPXXPXPXXPXXXXPPXPXPPPP 964 P P P P P PP P PPPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 857 RXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 R P P PPPP P P PP P PPP Sbjct: 858 RRPRPRPRRPPPPPPPPPPP-------PPPPPPPP 885 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 857 RXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 R P PPPP P P PP P PPPP Sbjct: 856 RYRRPRPRPRRPPPPPPPPP-------PPPPPPPPP 884 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P G P P P P P P PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P PP P PP P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLP 684 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = +2 Query: 827 TPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPX-----PXPPPP 964 TP P P PPPP P P PP P PPPP Sbjct: 655 TPEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P P P P P+ PPP P P P P PPP Sbjct: 50 PGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPP 95 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P P P P P+ PPP P P P P PPP Sbjct: 60 PGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P P P P P+ PPP P P P P PPP Sbjct: 70 PGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 PP P P P+ PPP P P P P PPP Sbjct: 44 PPNTPIPGD--PPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPP 85 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 PP P R P+ PPP P P P P PPP Sbjct: 34 PPNTAIPGDR--PPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPP 75 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXP----PXPXPPPP 964 P P P P P P P P P P P P P PPP Sbjct: 65 PNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 PP P R P P+ PP P P P P PPP Sbjct: 24 PPNTTIP--RAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPP 65 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P P P P P P P P P P PP P P Sbjct: 45 PNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIP 90 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXP----PXPXPPPP 964 P P P P P P P P P P P P P PPP Sbjct: 55 PNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P PP PA P+P PPP P P PPP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPP 352 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P PP PPPP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPP 331 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 32.3 bits (70), Expect = 0.61 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXP-XXPXXXXPPXPXPP 958 P PP P P P PP P P P P PP PP Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPP 65 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = +2 Query: 824 PTPPXXXXP--AXRXPSPHXXXXXPP---PPXXPXPXX-PXXXXPPXPXPPPP 964 PTPP P P+P PP PP P P PP PPPP Sbjct: 25 PTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 32.3 bits (70), Expect = 0.61 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGGW 824 G GGG GG G G G GG G+ G G G GGG+ Sbjct: 1805 GGGGGMGGGGGGMGGGGEGMGAAGG-----GMGAGGEGGGAGGGGGGY 1847 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGG 829 GGG G GG G G G GGGG G G AG G Sbjct: 1793 GGGEGMGGGGMAG--GGGGMGGGGGGMGGGGEGMGAAGGGMGAG 1834 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGG-GXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G GGG G G G GG G Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGG 1808 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG G G G GGG G G G G GG Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGG 1806 Score = 29.5 bits (63), Expect = 4.3 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GGG GG G G GGG G G G G GGG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEF---GGGEGMGGGG 1802 Score = 29.5 bits (63), Expect = 4.3 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXX-GXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG G GG G G G GGG G G GG G Sbjct: 1776 GGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEG 1823 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 843 PXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 P P PG P PPP P P P PP P P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGP-PGPPGPPGPQP 1291 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 831 PPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPP 959 PP P G P PP P P P PP PP Sbjct: 1242 PPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXP 955 P P P PPPP P P PP P P Sbjct: 1256 PPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P PP P P PPP P P P PP PP Sbjct: 1235 PPPPPAMPPDG--PPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPP 1278 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P P P P P PP P P PP P PP Sbjct: 1239 PAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 863 PSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 P P P PP P P PP P PP Sbjct: 1255 PPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 PP P P PPP P P P P PPPP Sbjct: 254 PPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPP 298 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PP P P P PP P PPPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXP 949 P P P PPPP P P P PP P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPP P P P PP P P P Sbjct: 102 PPPTMPPTPPPPQTPAPPGPDTPAP 126 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P PP P PP Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPP 119 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 863 PSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P PP P P P P P PP P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G G G GG G G GGG G PG G G GG Sbjct: 283 GWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGG 329 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 863 PSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P PPPP P P P P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP 155 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXP 955 P PP P +P PPPP P P P PP P Sbjct: 123 PPPPTGTLPPPPV-TPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G G G GGG Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGG---GATGGGGGATGGG 107 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GG G GG G G GGGG G G GGVG Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVG 123 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G GGGG G G G GG G Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGG--ATGDGGGATGGGGGATGGGG 108 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGG 830 G GG GG G G G GGG G G G GG Sbjct: 71 GGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGG 116 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG G GG G G G GGGG G G G GG G Sbjct: 86 GGGATGDGGGATGG--GGGATGGGGGATGGHG-GATGGGVGATGGHG 129 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G GGGG G G GG G Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGG 109 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGG 830 G GG GG G G G GGG G G G G GG Sbjct: 127 GHGGATGGHGGATGGHGGATGGGGGATGGGG---GATGGGGGATGG 169 Score = 28.7 bits (61), Expect = 7.5 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGGG GG G G G GGGG G G G G Sbjct: 51 GGGGGATGGGATGG--GGGATGGGGGATGGHGGATGGGGGATGDGGG 95 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXR 856 GGG G GG G G G GGGG G R Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPPR 376 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXG 875 G GGG GG G G G GGG G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P PP PPPP Sbjct: 483 PPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P P PPPP P P PP P PPP Sbjct: 455 PPNLPPPPGGMRGMPPPPMGMYP--PPRGFPPPPFGPPP 491 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXP--XXXXPP---XPXPPPP 964 P P P P P+ PPPP P P PP P PPPP Sbjct: 289 PPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPP 340 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXG--XGXXGGGGXXXXXXGXGXRXAGXXXXGG 829 GGG G GG G G G GGGG G G G GG Sbjct: 169 GGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGG 889 GGG G GG G G G GGGG Sbjct: 30 GGGHGYGGGPNGGGGGGGGGGGGG 53 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G G G G G GGGG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGG 49 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG G GG G G GGGG Sbjct: 104 GGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVGC 820 GGG G GG G G GGGG G G GG GC Sbjct: 103 GGGGGYGGGGGYGGGGRSYGGGGG------GGGFYQDSYGGGGGGGC 143 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXG 862 GGG G GG G G GGGG G G Sbjct: 105 GGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGG 138 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P P P PPPP Sbjct: 755 PPPP--PPPAVPGEGARPPPPPPPP 777 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPPP 962 PPP P P G T PP P P PP PPP Sbjct: 685 PPPAPPPPPIGGGDPTIWVSGGPP--LSAPPLSSTLGPPPPAPPP 727 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXP---XPPXPPP 962 PPP P PG + PPP P P P PP PPP Sbjct: 282 PPPPPPSNTPGMFASS-GFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P S PP P P P P PPPP Sbjct: 283 PPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 4/50 (8%) Frame = +2 Query: 827 TPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPX----PXPPPP 964 TPP P P PPP P P P P PPPP Sbjct: 279 TPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 4/51 (7%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPP----XPXPPPP 964 P PP P +P P P P P PP P PPPP Sbjct: 342 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPP----XPXPPPP 964 P PP P P PPPP P PP P P PP Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPP 244 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPP 959 PPP P P P PPP P P PP PP Sbjct: 243 PPPGENRPPPPMRG--PTSGGEPPPPKNAPPPPKRGSSNPPPPP 284 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P PPPP Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPP 334 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P P P PPP Sbjct: 2 PPPPPPPGPPPPPSA-PSGPVKPPP 25 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P PPPP P PP P P Sbjct: 319 PPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAP 365 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 PT P +P PPPP P P P P PPP Sbjct: 350 PTSTRSAPPPPPGRAPQPLGGPPPPP--PGRRPPSGKINPPPPPPP 393 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P + P P P PP P P P P P PP P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAP-PTPPMP 209 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXP-XXXXPPXPXPPP 961 P PP P+ P+PH P P P P PP P PP Sbjct: 298 PAPPNLFIPSA-PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPP 343 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXG 862 GGG G GG G G G GGG G G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDG 340 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 4/51 (7%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPP----XPXPPPP 964 P PP P +P P P P P PP P PPPP Sbjct: 254 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 4/51 (7%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPP----XPXPPPP 964 P PP P P PPPP P PP P P PP Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPP 156 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPP 959 PPP P P P PPP P P PP PP Sbjct: 155 PPPGENRPPPPMRG--PTSGGEPPPPKNAPPPPKRGSSNPPPPP 196 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P PPPP Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPP 246 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P PPPP P PP P P Sbjct: 231 PPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAP 277 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 PT P +P PPPP P P P P PPP Sbjct: 262 PTSTRSAPPPPPGRAPQPLGGPPPPP--PGRRPPSGKINPPPPPPP 305 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGG--GGXXXXXXGXGXRXAG 847 G GG G GG G G G GG GG G G + G Sbjct: 205 GSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGG 829 GG G GG G G G GGGG G G G GG Sbjct: 196 GGSKGGYGGGSGGGGYGGGR-GGGGYGGGHGGGGYGGGGRHDYGG 239 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGG 827 G GG GG G G G GGG G G GGG Sbjct: 194 GYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGG 240 Score = 28.7 bits (61), Expect = 7.5 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGGGW 824 G G G GG G G G GGG G G G GGG+ Sbjct: 203 GGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG----RHDYGGGSKGGGY 246 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 967 GXGGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXGXXGG 830 G GGG GG G G G GGG G G G G GG Sbjct: 444 GDGGGDGGGGGDGGGDGIDGGDGGGDGGGDG-----GGDGGGDGGG 484 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +2 Query: 827 TPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 TP P+ + PP P P P PP P PPPP Sbjct: 324 TPATNAPPSDSPSTTTPTTPQPPTPTTPKTH-PQLGPPPPPPPPPP 368 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 827 TPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXP 925 TP P P H PPPP P P P Sbjct: 339 TPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPP 371 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGG 889 GGGG GG G G G GGGG Sbjct: 768 GGGGYRGGGGYGGGHRGGGGYGGGG 792 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG GG G G G GGG G G G G G Sbjct: 336 GGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHG 381 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG GG G G G GGG G G G G G Sbjct: 346 GGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHG 391 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG GG G G G GGG G G G G G Sbjct: 351 GGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHG 396 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG GG G G G GGG G G G G G Sbjct: 361 GGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGDGDHG 406 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGGVG 823 GGG GG G G G GGG G G G G G Sbjct: 341 GGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHG 386 >SB_41386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -3 Query: 554 FGDRIPSRPYRRLRGGXSXQDPTLXSLCXHSRSASDLSIYINXSFRI 414 F D +PS RL+GG + P+ S HSR S+ S+++ Sbjct: 230 FSDNLPSLELIRLQGGGRMEAPSPGSRAEHSRWHHKRSLNATISYKV 276 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXX--PXPXXPXXXXPPXPXPPP 961 PP P+ P+P PPP P P P P PPP Sbjct: 520 PPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGVPTPVTAPPPAPPP 565 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PP P PPPP Sbjct: 62 PIPPTLPPPPPP----PPPPLPPPP 82 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 P PP P P P PP P PPPP Sbjct: 286 PIPPTLPPPPPP----PPPPLPPPP 306 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 893 PPPXXPXPXXPXXXXPPXPXPPPP 964 PP P P P PP P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXP 949 PPPP P P P PP P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPP 961 P PP P P P PP PPP Sbjct: 432 PTPPPTPPPTPPPTTLPPTTQPPP 455 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 893 PPPXXPXPXXPXXXXPPXPXPPPP 964 P P P P PP P PPPP Sbjct: 365 PAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 831 PPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXP 926 PP P P P TP PPP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P PP P PPPP Sbjct: 54 PPPPPPPPP-------PPPPPPPPP 71 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 H TP P H P PP P P PP PPPP Sbjct: 42 HDTPHYHQPPPPPTRPSHSCGPHPVPPT-PLVQHPEPEAPPQLPPPPP 88 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 830 PPXXXXPAXRXPS-PHXXXXXP--PPPXXPXPXXPXXXXPPXPXPPP 961 PP PA PS P P PPP P P P PPP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPP 2196 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXX---PPXPXPPPP 964 PPPP P P P PP P PPP Sbjct: 513 PPPPASPPPPLPAEEDNSPPPLPAGPPP 540 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -1 Query: 961 GGGXGGXGXXXXGXGXXXXXGGGXXXXXGVXXXXPGXGXG-XXGGGW 824 G G GG G G GG G PG G G GGGW Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGW 48 >SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1297 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +1 Query: 226 GGGKVFGTLGQNDDGLFGKAGYNREIFXDDRGKLTGQAYG 345 G G FGT GLFG AG N G +TG +G Sbjct: 50 GFGSGFGTTQTTGTGLFGAAGTNTGTGLFGGGTVTGSMFG 89 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 866 SPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 SP P PP P P P PP P P PP Sbjct: 1352 SPIPSTPRPRPPTPPRPPTP-RPRPPTPRPGPP 1383 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPP--PXXPXPXXPXXXXPPXPXPPPP 964 P+ P P PPP P P PP PPPP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 822 TQPPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPP 959 T PPP P P PG P PPP P P P PP Sbjct: 782 TTPPPEYPPPPPGLARPNP-----PPP---NPPLQVTSIPGEPAPP 819 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 963 GGGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXGXRXAGXXXXGG 829 GGG G G G G GGG G G R G GG Sbjct: 196 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +2 Query: 821 HPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXP 955 H + P P + PS + PP P P P PP P P Sbjct: 159 HTSIPPTPHPTYKHPS-YPTYNIPPTPHTSIPPTPHTSIPPTPRP 202 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/52 (26%), Positives = 15/52 (28%) Frame = +3 Query: 804 NCXXXXTQPPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPP 959 +C PPP P P P P P P PP PP Sbjct: 24 SCCETPPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P P PP P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQPTTALP 448 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +3 Query: 804 NCXXXXTQPPPXXPXPX---PGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPP 959 N +QPPP P P P PPP P P P PP PP Sbjct: 272 NTQRPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAP----PPPPPPP 322 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 830 PPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPP 961 PP P+ P P PPP P P P P P PP Sbjct: 423 PPGGGVPSHPPPLPQ-----PPPSIIPPPTTPLPQTVPTPPRPP 461 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/44 (29%), Positives = 13/44 (29%) Frame = +3 Query: 828 PPPXXPXPXPGXXXXTPXXXXXPPPXXXXXPXPXXXXPXPPXPP 959 PPP P P P PP P P P P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKP 820 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXP---PPPXXPXPXXPXXXXPPXPXPPPP 964 P PP PA P+ P P P P P P P P PP Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 890 PPPPXXPXPXXPXXXXPPXPXPPPP 964 PPPP P P PP P PP Sbjct: 82 PPPPPPPPPASNVPAPPPPPPVMPP 106 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 893 PPPXXPXPXXPXXXXPPXPXPPPP 964 PPP P P PP P PPPP Sbjct: 73 PPPLCAPPPPP---PPPPPPPPPP 93 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 857 RXPSPHXXXXXPPPPXXPXPXXPXXXXP-PXPXPPP 961 R S PP P P P P P P P PPP Sbjct: 24 RPSSTRTKLAVPPIPHGPRPLPPLREPPTPAPTPPP 59 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 960 GGGXGXGGXXXXGXXGXGXXGGGGXXXXXXGXG 862 GGG GG G G G G GG G G Sbjct: 432 GGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 >SB_42793| Best HMM Match : PARP (HMM E-Value=5.4e-22) Length = 585 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -1 Query: 415 FLXAQSRTXTVVCTVPLRVPGPWCRRPARSICRGHHXRSLC--CNRLYQKAHHHF 257 F Q + VVC VP P C P ++C + C C R Q+ F Sbjct: 124 FRICQQKEEDVVCNVPCGRNRPGCGHPCTNLCGEDCSKGDCKLCERKQQETMKQF 178 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/62 (25%), Positives = 17/62 (27%) Frame = +2 Query: 779 PXTRTXIXQLXXXXHPTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPP 958 P T T PT P P P+P P P P P P P Sbjct: 41 PTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKTPTPTTSTLTKPTPATTP 100 Query: 959 PP 964 P Sbjct: 101 TP 102 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 893 PPPXXPXPXXPXXXXPPXPXPPPP 964 PPP P P PP P PPPP Sbjct: 274 PPPLCAPPPPP---PPPPPPPPPP 294 >SB_5453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2578 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/55 (29%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -1 Query: 415 FLXAQSRTXTVVCTVPLRVPGPWCRRPARSICRGHHXRSLC--CNRLYQKAHHHF 257 F Q + VVC VP P C P ++C + C C R Q+ F Sbjct: 1304 FRICQQKEEDVVCNVPCGRNRPGCGHPCTNLCGEDCSKGDCKLCERKQQETMKQF 1358 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPP 958 P P A P P PP P P PP P PP Sbjct: 437 PLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPP 481 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +2 Query: 824 PTPPXXXX-PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 PTPP P + PPPP P P P P PP Sbjct: 115 PTPPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPP 162 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 848 PAXRXPSPHXXXXXPPPPXXPXPXXPXXXXPPXPXPPPP 964 P P P PPP P P P PPPP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPP 212 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 824 PTPPXXXXPAXRXPSPHXXXXXPPPPXXPXPXXP-XXXXPPXPXP 955 P PP + P+P PPP P P P PP P P Sbjct: 749 PAPPLPPKVTPKPPAPPQFAPV-PPPCAPIPPMPCSAPLPPAPAP 792 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,610,621 Number of Sequences: 59808 Number of extensions: 520751 Number of successful extensions: 4905 Number of sequences better than 10.0: 99 Number of HSP's better than 10.0 without gapping: 1166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2644 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2848211039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -