BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E22 (991 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 67 4e-12 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 58 2e-09 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 58 3e-09 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 53 5e-08 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 46 1e-05 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 45 2e-05 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 43 6e-05 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 42 2e-04 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 41 3e-04 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 38 0.003 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 37 0.004 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 36 0.009 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 34 0.027 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 31 0.19 SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein ... 30 0.58 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 29 0.77 SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 29 0.77 SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schi... 29 1.3 SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 28 2.3 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 27 3.1 SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 27 3.1 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 27 4.1 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 27 5.4 SPBC19C7.05 |||cell wall organization protein |Schizosaccharomyc... 26 9.4 SPAC688.11 |end4|sla2|Huntingtin-interacting protein homolog|Sch... 26 9.4 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 66.9 bits (156), Expect = 4e-12 Identities = 45/143 (31%), Positives = 47/143 (32%), Gaps = 7/143 (4%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXN--PPXPPXSXXP 745 P P A P PP P PPP P P P + PP P S P Sbjct: 1033 PIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIP 1092 Query: 746 PXXPXPPXXXPP---PPXXXPPXPPXXXPPPXXXXXXSXPP-PXPP-XPPXPXXPXXXPP 910 P P P PP P PP P PP + PP P P PP P PP Sbjct: 1093 PV-PKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPP 1151 Query: 911 XXPPPXXXPXXXPXXXXPPXPXP 979 P P P PP P P Sbjct: 1152 VPAPSGAPPVPKPSVAAPPVPAP 1174 Score = 66.9 bits (156), Expect = 4e-12 Identities = 47/147 (31%), Positives = 47/147 (31%), Gaps = 11/147 (7%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXP---PXPXXPPXXXX-GPPPPPXPXXX--PXXXPXXNPPXPPX 733 P P P P P P PP G PP P P P P PP P Sbjct: 1086 PAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKP 1145 Query: 734 SXXPPXXPXPPXXXP--PPPXXXPPXP-PXXXPPPXXXXXXSXPPPXPP--XPPXPXXPX 898 S P P P P P PP P P PP PP PP PP P Sbjct: 1146 SVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSV 1205 Query: 899 XXPPXXPPPXXXPXXXPXXXXPPXPXP 979 PP PP P P PP P P Sbjct: 1206 GVPPVPPPSTAPPVPTPSAGLPPVPVP 1232 Score = 66.1 bits (154), Expect = 7e-12 Identities = 42/139 (30%), Positives = 43/139 (30%), Gaps = 5/139 (3%) Frame = +2 Query: 578 PPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXP 757 P A P PP P P P P P P P PP P S P P Sbjct: 1077 PAPSGAPPVPAPSGIPPVPK--PSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVP 1134 Query: 758 XP--PXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPP---PXPPXPPXPXXPXXXPPXXPP 922 P P P PP P PP + PP P PP P PP PP Sbjct: 1135 VPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPP 1194 Query: 923 PXXXPXXXPXXXXPPXPXP 979 P P PP P P Sbjct: 1195 SEAPPVPKPSVGVPPVPPP 1213 Score = 61.7 bits (143), Expect = 2e-10 Identities = 44/142 (30%), Positives = 46/142 (32%), Gaps = 8/142 (5%) Frame = +2 Query: 578 PPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXN---PPXPPXSXXPP 748 PP PA P P G PP P P P + PP P S PP Sbjct: 1063 PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Query: 749 XXPXPPXXXPPPPXXX--PPXP-PXXXPPPXXXXXXSXPPPXPPX--PPXPXXPXXXPPX 913 P P PP P PP P P PP + P P P PP P PP Sbjct: 1123 V-PKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPV 1181 Query: 914 XPPPXXXPXXXPXXXXPPXPXP 979 P P P PP P P Sbjct: 1182 PKPAAGVPPVPPPSEAPPVPKP 1203 Score = 60.5 bits (140), Expect = 4e-10 Identities = 42/135 (31%), Positives = 43/135 (31%), Gaps = 5/135 (3%) Frame = +2 Query: 590 PASPXXGAXXXP-PXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPXPP 766 P P A P P P P PP P P PP P S P P P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGA-PSAPPPVPAPSSEIPSIPAPS 1080 Query: 767 XXXP-PPPXXXPPXP-PXXXPPPXXXXXXSXPPPXPP--XPPXPXXPXXXPPXXPPPXXX 934 P P P PP P P PP + PP P PP P PP P Sbjct: 1081 GAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAP 1140 Query: 935 PXXXPXXXXPPXPXP 979 P P PP P P Sbjct: 1141 PVPKPSVAAPPVPAP 1155 Score = 59.7 bits (138), Expect = 6e-10 Identities = 40/141 (28%), Positives = 42/141 (29%), Gaps = 5/141 (3%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPX 751 P P P P + P P P P P P PP P S P Sbjct: 1044 PIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPP 1103 Query: 752 XPXPPXXXPP--PPXXXPPXP-PXXXPPPXXXXXXSXPPPXP--PXPPXPXXPXXXPPXX 916 P P PP P PP P P PP + P P P PP P P Sbjct: 1104 VPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPK 1163 Query: 917 PPPXXXPXXXPXXXXPPXPXP 979 P P P PP P P Sbjct: 1164 PSVAAPPVPAPSSGIPPVPKP 1184 Score = 59.3 bits (137), Expect = 8e-10 Identities = 41/138 (29%), Positives = 41/138 (29%), Gaps = 5/138 (3%) Frame = +2 Query: 581 PXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXX--PXXXPXXNPPXPPXSXXPPXX 754 P PA P P G PP P P P P PP P S P Sbjct: 1112 PPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPV 1171 Query: 755 PXPPXXXPP---PPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPP 925 P P PP P PP PP PP P P PP P P P Sbjct: 1172 PAPSSGIPPVPKPAAGVPPVPPPSEAPPV-------PKPSVGVPPVPPPSTAPPVPTPSA 1224 Query: 926 XXXPXXXPXXXXPPXPXP 979 P P PP P P Sbjct: 1225 GLPPVPVPTAKAPPVPAP 1242 Score = 50.4 bits (115), Expect = 4e-07 Identities = 35/121 (28%), Positives = 35/121 (28%), Gaps = 3/121 (2%) Frame = +1 Query: 628 PPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXPP---PPXXXP 798 PP P P P P P PS PP P PP P PP P P Sbjct: 1121 PPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPK-PSVAAPPVPAPSSGIP 1179 Query: 799 PXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPPPXXPPPPXPPXXXXXXXXPXXXXP 978 P P P P P P PPP PP P P P P Sbjct: 1180 PVPKPAAGVPPVPPPSEAPPV--PKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAP 1237 Query: 979 P 981 P Sbjct: 1238 P 1238 Score = 49.6 bits (113), Expect = 7e-07 Identities = 39/142 (27%), Positives = 40/142 (28%), Gaps = 8/142 (5%) Frame = +2 Query: 578 PPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXP 757 PP P S + P PP P P P P P S P P Sbjct: 970 PPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVP----PVPKLSSKAPPVP 1025 Query: 758 XPPXXXPP---PPXXXP-PXPPXXXPPPXXXXXXSXPPPXPPXP----PXPXXPXXXPPX 913 P PP P P P P P P PP P P P P PP Sbjct: 1026 LPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPV 1085 Query: 914 XPPPXXXPXXXPXXXXPPXPXP 979 P P P PP P P Sbjct: 1086 PAPSGIPPVPKPSVAAPPVPKP 1107 Score = 46.0 bits (104), Expect = 8e-06 Identities = 37/115 (32%), Positives = 37/115 (32%), Gaps = 10/115 (8%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXP-PXPXXPPXXXX---GPPPPPXP--XXXPXXXPXXN-PPXPP 730 P P P P P P P P PP P P P P PP PP Sbjct: 1134 PVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPP 1193 Query: 731 XSXXPPXXPXPPXXXP--PPPXXXPPXP-PXXXPPPXXXXXXSXPPPXPPXPPXP 886 S PP P P P PPP PP P P PP PP P P Sbjct: 1194 PSEAPP-VPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAP 1247 Score = 44.0 bits (99), Expect = 3e-05 Identities = 38/131 (29%), Positives = 40/131 (30%), Gaps = 13/131 (9%) Frame = +2 Query: 626 PXPXXPPXXXXGPPPPPXPXXXPXXX---PXXNPPXPPXSXXPPXXPXPPXXXPPP---- 784 P P PP PPP P P +PP P S P P PP Sbjct: 961 PRPAAPPSI---PPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKL 1017 Query: 785 PXXXPPXP-PXXXPPPXXXXXXSXPPPXPPX-PPXPXX----PXXXPPXXPPPXXXPXXX 946 PP P P PP + P P P PP P P PP P P Sbjct: 1018 SSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIP 1077 Query: 947 PXXXXPPXPXP 979 PP P P Sbjct: 1078 APSGAPPVPAP 1088 Score = 43.6 bits (98), Expect = 4e-05 Identities = 35/134 (26%), Positives = 35/134 (26%) Frame = +1 Query: 580 PXXPRLPXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXX 759 P P LP P P T PP PP P PS P P P P Sbjct: 1022 PPVP-LPSADAPPIPVPSTAPPVPIP-TSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAP 1079 Query: 760 PPXXXPPPPXXXPPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPPPXXPPPPXPPX 939 P P PP P P P P P P P PP P Sbjct: 1080 SGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAP--PVPKPSVAAPPVPVPS 1137 Query: 940 XXXXXXXPXXXXPP 981 P PP Sbjct: 1138 GAPPVPKPSVAAPP 1151 Score = 41.9 bits (94), Expect = 1e-04 Identities = 31/109 (28%), Positives = 32/109 (29%), Gaps = 2/109 (1%) Frame = +2 Query: 665 PPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXPPPXXXXX 844 P P P P P N P S P P P P P P PP Sbjct: 961 PRPAAPPSIPPPLPVSNILSSPTSEPPKDHP-PSAPLSKPVSTSPAAPLARVPPVPKLSS 1019 Query: 845 XSXPPPXPPX--PPXPXXPXXXPPXXPPPXXXPXXXPXXXXPPXPXPXP 985 + P P P PP P P PP P P P P P P Sbjct: 1020 KAPPVPLPSADAPPIPV-PSTAPPVPIPTSTPPVPKSSSGAPSAPPPVP 1067 Score = 41.9 bits (94), Expect = 1e-04 Identities = 34/130 (26%), Positives = 35/130 (26%) Frame = +1 Query: 592 RLPXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXX 771 R+P S PP P PP P P P P PP P PP Sbjct: 1010 RVPPVPKLSSKAPPV--PLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPV- 1066 Query: 772 XPPPPXXXPPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPPPXXPPPPXPPXXXXX 951 P P P P P P P P P P P PP P Sbjct: 1067 --PAPSSEIPSIPAPSGAPPVPAPSGIPPV--PKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Query: 952 XXXPXXXXPP 981 P PP Sbjct: 1123 VPKPSVAAPP 1132 Score = 41.5 bits (93), Expect = 2e-04 Identities = 35/112 (31%), Positives = 36/112 (32%), Gaps = 7/112 (6%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPX---PXXXPXXXPXXNPPXPPXSXX 742 P P A+P A P P P PPP P P PP PP S Sbjct: 1160 PVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGV---PPVPPPSTA 1216 Query: 743 PPXXPXPPXXXPP---PPXXXPPXP-PXXXPPPXXXXXXSXPPPXPPXPPXP 886 PP P P PP P PP P P P S P P P P Sbjct: 1217 PP-VPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSSVPSPHSNASPSP 1267 Score = 35.5 bits (78), Expect = 0.012 Identities = 27/117 (23%), Positives = 27/117 (23%), Gaps = 2/117 (1%) Frame = +3 Query: 642 PXXXXXAPPPPXXXPXXPXPXPXPTPPXPPXPX--PPXPXXXXXXXXXXXXXXXXXXXXX 815 P APP P P P P P P P PP P Sbjct: 1124 PKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPK 1183 Query: 816 XXXPXXXXXPXXXXPPXPPPPPXXXPXXXXPXXPPPPXXXXPXXPXXXPXXXXXPXP 986 P PP P P P PP P P P P P Sbjct: 1184 PAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVP 1240 Score = 33.5 bits (73), Expect = 0.047 Identities = 22/74 (29%), Positives = 24/74 (32%) Frame = +1 Query: 580 PXXPRLPXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXX 759 P P+ P G PPP T PP P P P P+ PP P P Sbjct: 1198 PPVPK-PSVGVPPVPPPSTAPPV-----PTPSAGLPPVPVPTAKAPPVPAPSSEAPSVST 1251 Query: 760 PPXXXPPPPXXXPP 801 P P P P Sbjct: 1252 PRSSVPSPHSNASP 1265 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 58.0 bits (134), Expect = 2e-09 Identities = 38/87 (43%), Positives = 38/87 (43%), Gaps = 1/87 (1%) Frame = -2 Query: 879 GGXGGXGGGXXXXXXXXGGGXXXGGXGGXXXGGGGXXXGGXGXXGGXXEXGGXGGLXXGX 700 GG GG GGG GG GG GG GG GG G G E GG GG G Sbjct: 188 GGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGH--GGFGGGPGGFE-GGPGGFGGGP 244 Query: 699 XXGXXXGXGG-GGGPXXXXGGXXGXGG 622 G G GG GGGP GG G GG Sbjct: 245 G-GFGGGLGGFGGGPGGFGGGPGGHGG 270 Score = 56.0 bits (129), Expect = 8e-09 Identities = 35/92 (38%), Positives = 35/92 (38%) Frame = -3 Query: 932 GXGGGGXXGGGGXGXXGXGGXGGXGXGXXXXXXXXGXXXXXGXXGGXXXGGGGXXXGGXX 753 G G GG GG G G GG GG G G G GG G GG G Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGG-------FGGEGHHHGGHGGFGGGPGGFEGGPGG 239 Query: 752 XXGGXXXXGGGGGWXXXGXGXXXXGXGGGGGP 657 GG GGG G G G G GG GGP Sbjct: 240 FGGGPGGFGGGLGGFGGGPGGFGGGPGGHGGP 271 Score = 52.8 bits (121), Expect = 7e-08 Identities = 35/87 (40%), Positives = 35/87 (40%), Gaps = 1/87 (1%) Frame = -2 Query: 828 GGGXXXGGXGGXXXGGGGXXXGGXGXXGGXXEXGGXGGLXXGXXXGXXXGXGG-GGGPXX 652 G G GG GG G GG GG G GG G G G G G GG GGGP Sbjct: 189 GFGGFGGGSGGPPPGPGGF--GGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGG 246 Query: 651 XXGGXXGXGGXXXAPXXGEAGXXGGXG 571 GG G GG G G GG G Sbjct: 247 FGGGLGGFGGGPGG-FGGGPGGHGGPG 272 Score = 48.8 bits (111), Expect = 1e-06 Identities = 30/87 (34%), Positives = 30/87 (34%), Gaps = 1/87 (1%) Frame = -3 Query: 899 GXGXXGXGGXGGXGXGXXXXXXXXGXXXXXGXXGGXXXGGGGXXXGGXXXXGGXXXXGGG 720 G G GG GG G G G G G GG G GG GGG Sbjct: 184 GHNGGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGG 243 Query: 719 GGWXXXGXGXXXXGXGG-GGGPXXXXG 642 G G G G GG GGGP G Sbjct: 244 PGGFGGGLGGFGGGPGGFGGGPGGHGG 270 Score = 47.6 bits (108), Expect = 3e-06 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 1/82 (1%) Frame = -2 Query: 984 GXGXGXGGXXXXGXXXGXXXGGGXXGGXXXGXXGXGGXGGXGGGXXXXXXXXGGGXXXGG 805 G G GG G G G GG G GG GG GG GGG G Sbjct: 189 GFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFG 248 Query: 804 XG-GXXXGGGGXXXGGXGXXGG 742 G G GG G GG G GG Sbjct: 249 GGLGGFGGGPGGFGGGPGGHGG 270 Score = 42.7 bits (96), Expect = 8e-05 Identities = 30/78 (38%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = -2 Query: 984 GXGXGXGGXXXXGXXXGXXXGGGXXGGXXXGXXGX-GGXGGXGGGXXXXXXXXGGGXXXG 808 G G GG G G G GG G G GG GG GGG GG G Sbjct: 199 GPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGG--FGG 256 Query: 807 GXGGXXXGGGGXXXGGXG 754 G GG G GG GG G Sbjct: 257 GPGGFGGGPGG--HGGPG 272 Score = 42.3 bits (95), Expect = 1e-04 Identities = 34/100 (34%), Positives = 35/100 (35%), Gaps = 1/100 (1%) Frame = -3 Query: 875 GXGGXGXGXXXXXXXXGXXXXXGXXGGXXXGGGGXXXGGXXXXGGXXXXGGGGGWXXXGX 696 G GG G G GG G GG G GG GG GG+ G Sbjct: 162 GLGGLALGGLASHALGNLFHHRGHNGGGFGGFGGGSGGPPPGPGGF---GGFGGF--GGE 216 Query: 695 GXXXXGXGG-GGGPXXXXGGXVGGGGXEXPPXXGRRGXXG 579 G G GG GGGP GG G GG G G G Sbjct: 217 GHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGG 256 Score = 28.3 bits (60), Expect = 1.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -1 Query: 991 GXGXGXXXXXGXXXGXXGXXXXGGGGXXGXXXXGXXXGGG-GGXGG 857 G G G G G G GGG G GGG GG GG Sbjct: 225 GFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPGGHGG 270 Score = 26.2 bits (55), Expect = 7.1 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 10/70 (14%) Frame = -1 Query: 751 GXGGXGXGGXGGVGXGX--------GXGXXGXXXGGGGAXXXXXGXXWXGG-GXXGPRXR 599 G GG GG G G G G G GG G GG G G Sbjct: 162 GLGGLALGGLASHALGNLFHHRGHNGGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHG 221 Query: 598 G-GGXXGGXG 572 G GG GG G Sbjct: 222 GHGGFGGGPG 231 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 57.6 bits (133), Expect = 3e-09 Identities = 46/154 (29%), Positives = 48/154 (31%), Gaps = 16/154 (10%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPX-----PXXPPXXXX--GPPPPPXPXXXPXXXPXXNPPXPP 730 P PP P S G+ PP P PP G PPP P PP P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIP 396 Query: 731 XSXXPPXXPX--------PPXXXPPP-PXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPX 883 P P PP PP P PP P PP + PP P P Sbjct: 397 GRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIA 456 Query: 884 PXXPXXXPPXXPPPXXXPXXXPXXXXPPXPXPXP 985 P P P P P P PP P P P Sbjct: 457 PPLPAGMPAAPPLPPAAP------APPPAPAPAP 484 Score = 52.0 bits (119), Expect = 1e-07 Identities = 39/133 (29%), Positives = 39/133 (29%), Gaps = 12/133 (9%) Frame = +2 Query: 623 PPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPXPPXXX---PPPPXX 793 PP P P G PP P PP PP S P PP PPPP Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPP---PPPPPRSNAAGSIPLPPQGRSAPPPPPPR 367 Query: 794 XPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXP---------PXXPPPXXXPXXX 946 P PP S PP PP P P P P P P P Sbjct: 368 SAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSA 427 Query: 947 PXXXXPPXPXPXP 985 P P P P Sbjct: 428 PPSLPPSAPPSLP 440 Score = 49.2 bits (112), Expect = 9e-07 Identities = 30/106 (28%), Positives = 31/106 (29%) Frame = +1 Query: 616 SXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXPPPPXXX 795 S PPPP P G P P P P + P PP PP P Sbjct: 335 SLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAP--- 391 Query: 796 PPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPPPXXPPPPXP 933 PP P PP P P P PP PP P Sbjct: 392 PPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPP 437 Score = 47.6 bits (108), Expect = 3e-06 Identities = 30/112 (26%), Positives = 31/112 (27%) Frame = +1 Query: 598 PXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXP 777 P + PP PP P P S P PP L PP P Sbjct: 378 PLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPP 437 Query: 778 PPPXXXPPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPPPXXPPPPXP 933 P P P P PP PP P PPP P P P Sbjct: 438 SLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPP--AAPAPPPAPAPAPAAP 487 Score = 39.5 bits (88), Expect = 7e-04 Identities = 42/156 (26%), Positives = 44/156 (28%), Gaps = 22/156 (14%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXP--PXSXXP 745 P PP P+S P P PPP P P P +PP P P S P Sbjct: 231 PIPPSIPSSR--------PPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNP 282 Query: 746 PXXPXPPXXXPPPP-----------XXXPPXPP-----XXXPPP--XXXXXXSXPPPXPP 871 PPP PP PP PP S PPP PP Sbjct: 283 AINSTSKPPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPP 342 Query: 872 XPPXPXXPXXXPP--XXPPPXXXPXXXPXXXXPPXP 973 PP PP P P P P Sbjct: 343 PRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPP 378 Score = 38.3 bits (85), Expect = 0.002 Identities = 31/116 (26%), Positives = 32/116 (27%), Gaps = 14/116 (12%) Frame = +1 Query: 631 PTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXPP-------PPX 789 P PP PP P P P PP + PP PP P Sbjct: 230 PPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPP--NSPPRPIAPVSMNPAINST 287 Query: 790 XXPPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPP-------PXXPPPPXPP 936 PP P P PP PP PP PPPP PP Sbjct: 288 SKPPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPP 343 Score = 36.3 bits (80), Expect = 0.007 Identities = 28/94 (29%), Positives = 29/94 (30%), Gaps = 7/94 (7%) Frame = +2 Query: 725 PPXSXXPPXXPXPPXXXPPP--PXXXPPXPPXXXPPPXXXXXXSXPPPXPPXP--PXPXX 892 P + PP P P PP P P PP PP S PP PP P P Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTV--SSPPNSPPRPIAPVSMN 281 Query: 893 P---XXXPPXXPPPXXXPXXXPXXXXPPXPXPXP 985 P P PPP P P P Sbjct: 282 PAINSTSKPPLPPPSSRVSAAALAANKKRPPPPP 315 Score = 31.5 bits (68), Expect = 0.19 Identities = 25/96 (26%), Positives = 25/96 (26%), Gaps = 3/96 (3%) Frame = +2 Query: 659 GPPPPPXPXXXPXXXPXXNPP--XPPXS-XXPPXXPXPPXXXPPPPXXXPPXPPXXXPPP 829 G P P P PP P S PP P P P PP P Sbjct: 222 GTPTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMN 281 Query: 830 XXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXXXP 937 S PP PP PPP P Sbjct: 282 PAINSTSKPPLPPPSSRVSAAALAANKKRPPPPPPP 317 Score = 31.1 bits (67), Expect = 0.25 Identities = 31/123 (25%), Positives = 32/123 (26%), Gaps = 6/123 (4%) Frame = +2 Query: 623 PPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXP--XPPXXXPP----P 784 P PP P P P P PP PP S P PP P P Sbjct: 224 PTSTSAPPIPPSIPSSRP-PERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNP 282 Query: 785 PXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXXXPXXXPXXXXP 964 PP PPP + PP P P PP P Sbjct: 283 AINSTSKPP--LPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPP 340 Query: 965 PXP 973 P P Sbjct: 341 PPP 343 Score = 28.3 bits (60), Expect = 1.8 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +1 Query: 580 PXXPRLPXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPP 720 P P LP + P PP P PPP P P P S + P Sbjct: 454 PIAPPLPAGMPAAPPLPPAAP-----APPPAPAPAPAAPVASIAELP 495 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 53.2 bits (122), Expect = 5e-08 Identities = 42/138 (30%), Positives = 44/138 (31%), Gaps = 6/138 (4%) Frame = +2 Query: 578 PPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXP 757 PP PA P + PP P PPP P P P PP P S PP P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSI----PPPSPASAP-PIPSKAPPI-PSSLPPPAQP 177 Query: 758 XPPXXXPPP----PXXXPPXPPXXXPPPXXXXXXSXPPPXPP--XPPXPXXPXXXPPXXP 919 P PP P PP PP PPP + P PP P Sbjct: 178 AAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPK 237 Query: 920 PPXXXPXXXPXXXXPPXP 973 P P P PP P Sbjct: 238 FPNRGP-SIPSASVPPVP 254 Score = 45.6 bits (103), Expect = 1e-05 Identities = 33/103 (32%), Positives = 33/103 (32%) Frame = +1 Query: 616 SXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXPPPPXXX 795 S P PPT P PP P P PS PP P P PP P P Sbjct: 126 SAPAPPT--PQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKS 183 Query: 796 PPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPPPXXPPP 924 PP P P PP PP PPPP P Sbjct: 184 PPSAP------------SLPSAVPPMPP----KVPPPPLSQAP 210 Score = 43.2 bits (97), Expect = 6e-05 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 5/81 (6%) Frame = +1 Query: 700 PSXXQPPPPPXLXXPPXXXXP-PXXXPPPPXXXPPXXPXXXXXPXXXXXXXXPXPX---- 864 PS PP P PP P P PP P PP P P Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSP 184 Query: 865 PPXPPXPXXPXPPPPXXPPPP 927 P P P P PP PPPP Sbjct: 185 PSAPSLPSAVPPMPPKVPPPP 205 Score = 42.7 bits (96), Expect = 8e-05 Identities = 25/76 (32%), Positives = 28/76 (36%), Gaps = 2/76 (2%) Frame = +1 Query: 580 PXXPRLPXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPP--PPPXLXXPPXX 753 P P+ S PP P+ PP PP P P PS PP P + PP Sbjct: 130 PPTPQSELRPPTSAPPRPSIPPPSPAS--APPIPSKAPPIPSSLPPPAQPAAPVKSPPSA 187 Query: 754 XXPPXXXPPPPXXXPP 801 P PP P PP Sbjct: 188 PSLPSAVPPMPPKVPP 203 Score = 40.7 bits (91), Expect = 3e-04 Identities = 29/114 (25%), Positives = 31/114 (27%) Frame = +2 Query: 581 PXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPX 760 P P+ P PP P P PPP P P P P P P Sbjct: 144 PPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQP-AAPVKSPPSAPSLPSAVPPMPPKVP 202 Query: 761 PPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPP 922 PP P P PP + P P P P P PP Sbjct: 203 PPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKFPN-RGPSIPSASVPPVPP 255 Score = 30.7 bits (66), Expect = 0.33 Identities = 20/69 (28%), Positives = 21/69 (30%) Frame = +2 Query: 779 PPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXXXPXXXPXXX 958 PP PP P PP + PP P P P P PP P P Sbjct: 124 PPSAPAPPTPQSELRPP------TSAPPRPSIP--PPSPASAPPIPSKAPPIPSSLPPPA 175 Query: 959 XPPXPXPXP 985 P P P Sbjct: 176 QPAAPVKSP 184 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 45.6 bits (103), Expect = 1e-05 Identities = 21/56 (37%), Positives = 24/56 (42%) Frame = +2 Query: 713 NPPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPP 880 +PP PP + P P PPP PP PPP + PPP PP PP Sbjct: 731 SPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPP---PPPPPGVAGAGPPPPPPPPP 783 Score = 43.6 bits (98), Expect = 4e-05 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 1/76 (1%) Frame = +2 Query: 662 PPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXPPPXXXX 841 PPPPP P P P PP P PP PPP PP PPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPP----APIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSA 787 Query: 842 XXS-XPPPXPPXPPXP 886 S P P P P Sbjct: 788 GGSRYYAPAPQAEPEP 803 Score = 43.6 bits (98), Expect = 4e-05 Identities = 25/74 (33%), Positives = 26/74 (35%) Frame = +2 Query: 716 PPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXP 895 PP PP P P P PP P P PP PP + PPP PP PP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPP----PPPPGVAGAGPPP-PPPPPPAVSA 787 Query: 896 XXXPPXXPPPXXXP 937 P P P Sbjct: 788 GGSRYYAPAPQAEP 801 Score = 43.6 bits (98), Expect = 4e-05 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 1/71 (1%) Frame = +2 Query: 776 PPPPXXXPPXP-PXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXXXPXXXPX 952 PPPP P P P P P PPP PP PP PP PPP Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPP-PPPPPGVAGAGPPPPPPPPPAVSAGGSRY 792 Query: 953 XXXPPXPXPXP 985 P P P Sbjct: 793 YAPAPQAEPEP 803 Score = 41.1 bits (92), Expect = 2e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +1 Query: 625 PPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPP--XXXXPPXXXPPPP 786 PPP P P P P P P P PPPPP PP PP PPPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPP-PAPIMGGPPPPP---PPPGVAGAGPPPPPPPPP 783 Score = 39.9 bits (89), Expect = 5e-04 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +2 Query: 578 PPXXPASPXXGAXXXPPXPXXPPXXXX-GPPPPPXPXXXPXXXPXXNPPXPP 730 PP P + P P PP GPPPPP P P PP PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 39.5 bits (88), Expect = 7e-04 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 775 PPPPXXXPPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPPPXXPPPP 927 PPP P P P P P PP PP PPPP PPPP Sbjct: 735 PPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPP-PPGVAGAGPPPP-PPPPP 783 Score = 37.1 bits (82), Expect = 0.004 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 580 PXXPRLPXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPP 723 P P P GG PPPP PPPPP P P P Sbjct: 750 PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPAP 797 Score = 36.7 bits (81), Expect = 0.005 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 6/69 (8%) Frame = +2 Query: 797 PPXPPXXXPPPXXXXXXSXPPP------XPPXPPXPXXPXXXPPXXPPPXXXPXXXPXXX 958 PP PP P PPP PP PP P PP PPP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRY 792 Query: 959 XPPXPXPXP 985 P P P Sbjct: 793 YAPAPQAEP 801 Score = 35.9 bits (79), Expect = 0.009 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPP-XXXXGPPPPPXP 682 P P P P PP P PP GPPPPP P Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 33.9 bits (74), Expect = 0.036 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 660 APPPPXXXPXXPXPXPXPTPPXPPXP---XPPXP 752 +PPPP P P P P P PP P PP P Sbjct: 731 SPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPP 764 Score = 33.9 bits (74), Expect = 0.036 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = +2 Query: 821 PPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXXXPXXXPXXXXPPXPXPXP 985 PPP P P P P P P PPP P PP P P P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPP---PPGVAGAGPPPPPPPPP 783 Score = 32.3 bits (70), Expect = 0.11 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 3/50 (6%) Frame = +1 Query: 796 PPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPP---PXXPPPPXPP 936 PP P P P P P P PPP PPPP PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 44.8 bits (101), Expect = 2e-05 Identities = 32/116 (27%), Positives = 34/116 (29%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPX 751 P PP P +P + PP P P PP P P P P P Sbjct: 575 PQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAP-VAPEVPSVPQRPAVPVVPEAPS 633 Query: 752 XPXPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXP 919 P PP P P P P PP P P P P PP P Sbjct: 634 VPQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQ-PPAAPVVPEVPSVP--QPPAVP 686 Score = 42.3 bits (95), Expect = 1e-04 Identities = 32/128 (25%), Positives = 34/128 (26%), Gaps = 2/128 (1%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPX 751 P P P P + PP P P PP P P PP P + P Sbjct: 560 PQRPAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAP-VVPEAPSVPQPPVAPVAPEVPS 618 Query: 752 XPXPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXP--PPXPPXPPXPXXPXXXPPXXPPP 925 P P P P PP P P P P P P P P Sbjct: 619 VPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPS 678 Query: 926 XXXPXXXP 949 P P Sbjct: 679 VPQPPAVP 686 Score = 41.1 bits (92), Expect = 2e-04 Identities = 28/103 (27%), Positives = 30/103 (29%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPX 751 P PP P +P + P P P PP P P P P P Sbjct: 605 PQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQPPAAP-VVPEVPSVPQRPAVPVVPEAPS 663 Query: 752 XPXPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPP 880 P PP P P PP P P PP PP Sbjct: 664 VPQPPAAPVVPEVPSVPQPPAVPVVPEAGQLNE--PVVPPLPP 704 Score = 37.5 bits (83), Expect = 0.003 Identities = 32/121 (26%), Positives = 34/121 (28%), Gaps = 2/121 (1%) Frame = +1 Query: 580 PXXPRL-PXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXX 756 P P++ P S P P PP PS QPP P P Sbjct: 486 PAMPKVFPERDISSASQKAAQPSVITPSVPQPPAAPVVPEAPSVHQPPAAPVA---PEVP 542 Query: 757 XPPXXXPPPPXXXPPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPX-PPPPXXPPPPXP 933 P P P P P P P P P P P P PP P P Sbjct: 543 SAPQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQP-PVAPVAPEVPSVPQPPVAPVVPEA 601 Query: 934 P 936 P Sbjct: 602 P 602 Score = 35.9 bits (79), Expect = 0.009 Identities = 35/141 (24%), Positives = 37/141 (26%), Gaps = 3/141 (2%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXP--PXSXXP 745 P PP P P + PP P P P P P P P + Sbjct: 515 PQPPAAPVVPEAPSVHQPPAAPVAPEVPSAPQRPAAPVVPEAPSVPQRPAVPVVPEALSV 574 Query: 746 PXXPXPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPP-XPXXPXXXPPXXPP 922 P P P P PP P P P PP P P P P P Sbjct: 575 PQPPVAPVAPEVPSVPQPPVAPVVPEAPSV--------PQPPVAPVAPEVPSV--PQRPA 624 Query: 923 PXXXPXXXPXXXXPPXPXPXP 985 P P PP P Sbjct: 625 VPVVP-EAPSVPQPPAAPVVP 644 Score = 34.7 bits (76), Expect = 0.020 Identities = 30/134 (22%), Positives = 31/134 (23%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPX 751 P P P P P PP P PP P + P Sbjct: 484 PPPAMPKVFPERDISSASQKAAQPSVITPSVPQPPAAPVVPEAPSVHQPPAAPVAPEVPS 543 Query: 752 XPXPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXX 931 P P P P P P PP P P P P PP P Sbjct: 544 APQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQ-PPVAPVAPEVPSVP--QPPVAPVVPE 600 Query: 932 XPXXXPXXXXPPXP 973 P P P Sbjct: 601 APSVPQPPVAPVAP 614 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 43.2 bits (97), Expect = 6e-05 Identities = 24/64 (37%), Positives = 24/64 (37%) Frame = +2 Query: 704 PXXNPPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPX 883 P PP P S PP P PPPP PP P PP S PPP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAP--TPPPPPMSVPPPP---SAPPMPAGPPSAPPPPLPASSA 1740 Query: 884 PXXP 895 P P Sbjct: 1741 PSVP 1744 Score = 41.5 bits (93), Expect = 2e-04 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = +1 Query: 607 GGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXPPP- 783 GG + P + PP PP P P PPPP PP PP PPP Sbjct: 1679 GGMAPAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPP---SAPPMPAGPPSAPPPPL 1735 Query: 784 PXXXPPXXP 810 P P P Sbjct: 1736 PASSAPSVP 1744 Score = 39.5 bits (88), Expect = 7e-04 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = +2 Query: 776 PPPPXXXPPXPPXXXPPPXXXXXXSXPPP--XPPXPPXPXXPXXXPPXXPPPXXXPXXXP 949 P P PP P PP PPP PP P P P PP PPP P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMP-AGPPSAPPPPLPASSAP 1741 Query: 950 XXXXP 964 P Sbjct: 1742 SVPNP 1746 Score = 37.5 bits (83), Expect = 0.003 Identities = 28/114 (24%), Positives = 31/114 (27%), Gaps = 9/114 (7%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXP--PXSXXP 745 P P +P + P P P P P + P P P S P Sbjct: 1427 PLKASQPTNPGAPSNHAPQVVPPAPMHAVAPVQPKAPGMVTNAPAPSSAPAPPAPVSQLP 1486 Query: 746 PXXP-------XPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXP 886 P P P PP P P PP P P PP P P Sbjct: 1487 PAVPNVPVPSMIPSVAQQPPSSVAPATAPSSTLPPSQSSFAHVPSPAPPAPQHP 1540 Score = 36.7 bits (81), Expect = 0.005 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = +2 Query: 755 PXPPXXXPP--PPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPX 928 P P PP P PP PPP S PPP P PP P P PP P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPM---SVPPP-PSAPPMPAGPPSAPPPPLPAS 1738 Query: 929 XXP 937 P Sbjct: 1739 SAP 1741 Score = 34.7 bits (76), Expect = 0.020 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +1 Query: 616 SXPP--PPTXPPXXXXGPPPPPXPXXXXPXPS-XXQPPPPPXLXXPPXXXXPPXXXPPP 783 S PP P + P P PPP P P PS P PP PP P P Sbjct: 1688 STPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 34.3 bits (75), Expect = 0.027 Identities = 20/70 (28%), Positives = 21/70 (30%) Frame = +2 Query: 659 GPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXPPPXXX 838 G P P P P PP P P P PPP P P PPP Sbjct: 1679 GGMAPAHPVSTPPVRP--QSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Query: 839 XXXSXPPPXP 868 + P P Sbjct: 1737 ASSAPSVPNP 1746 Score = 34.3 bits (75), Expect = 0.027 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +2 Query: 590 PASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPXPPX 769 PA P P P PPPPP P P PP PP P PP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPP-------PSAPPMPAGPPSAPPPPL 1735 Query: 770 XXPPPPXXXPP 802 P P Sbjct: 1736 PASSAPSVPNP 1746 Score = 33.5 bits (73), Expect = 0.047 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 644 PXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXP 823 P PP P PP PP PP PP PP PP P P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPP-MSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 31.9 bits (69), Expect = 0.14 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 859 PXPPXPPXPXXPXPPPPXXPPPPXPPXXXXXXXXPXXXXPP 981 P PP P PPPP PP P P PP Sbjct: 1694 PQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 31.5 bits (68), Expect = 0.19 Identities = 26/105 (24%), Positives = 27/105 (25%), Gaps = 4/105 (3%) Frame = +2 Query: 671 PPXPXXXPXXXPXXNPPXPPXSXXP--PXXPXPPXXXPPPPXXXPPXPPXXXPPP--XXX 838 P P P PP P + P P P P P P P PP Sbjct: 1433 PTNPGAPSNHAPQVVPPAPMHAVAPVQPKAPGMVTNAPAPSSAPAPPAPVSQLPPAVPNV 1492 Query: 839 XXXSXPPPXPPXPPXPXXPXXXPPXXPPPXXXPXXXPXXXXPPXP 973 S P PP P P PP PP P Sbjct: 1493 PVPSMIPSVAQQPPSSVAPATAPSSTLPPSQSSFAHVPSPAPPAP 1537 Score = 31.5 bits (68), Expect = 0.19 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 2/66 (3%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPP--PPXPXXXPXXXPXXNPPXPPXSXXP 745 P P A P A PP P P PPP PP P P P PP P S Sbjct: 1691 PVRPQSAAPPQMSAPTPPPPPMSVP-----PPPSAPPMPAGPPSAPP---PPLPASS--A 1740 Query: 746 PXXPXP 763 P P P Sbjct: 1741 PSVPNP 1746 Score = 30.7 bits (66), Expect = 0.33 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +1 Query: 715 PPPPPXLXXPPXXXXPPXXXPPPPXXXPPXXPXXXXXPXXXXXXXXPXPXPPXPPXP 885 PP P PP P PP PP P P P P P P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 30.3 bits (65), Expect = 0.44 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +1 Query: 598 PXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPP 723 P + PPPP P PP P P P P P Sbjct: 1700 PQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 28.3 bits (60), Expect = 1.8 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 843 PXXXXPPXPPPPPXXXPXXXXPXXPPPPXXXXPXXPXXXP 962 P P PPPPP P P PP P P P Sbjct: 1699 PPQMSAPTPPPPPMSVP--PPPSAPPMPAGPPSAPPPPLP 1736 Score = 27.5 bits (58), Expect = 3.1 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 5/49 (10%) Frame = +2 Query: 848 SXPPPXPP--XPPXPXXPXXXPP---XXPPPXXXPXXXPXXXXPPXPXP 979 S PP P PP P PP PPP P PP P P Sbjct: 1688 STPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 25.8 bits (54), Expect = 9.4 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +1 Query: 763 PXXXPPPPXXXPPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPPPXXPPP 924 P PP P P P P P PP P P P P P Sbjct: 1694 PQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPP-PPLPASSAPSVPNP 1746 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 41.5 bits (93), Expect = 2e-04 Identities = 32/135 (23%), Positives = 33/135 (24%) Frame = +2 Query: 581 PXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPX 760 P P G PP P PPP P + PP Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE 267 Query: 761 PPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXXXPX 940 P PPPP P PPP P PP P PP P Sbjct: 268 PGEHMPPPPMHHEPGE--HMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMP 325 Query: 941 XXPXXXXPPXPXPXP 985 P P P P Sbjct: 326 PPPMHHEPGEHMPPP 340 Score = 39.5 bits (88), Expect = 7e-04 Identities = 36/137 (26%), Positives = 37/137 (27%), Gaps = 5/137 (3%) Frame = +2 Query: 590 PASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXP-PXXPXPP 766 PA G PP P PPPP P + P PP P P PP Sbjct: 198 PAHHEPGEHMPPPPMHHKPGEHM--PPPPM-----HHEPGEHMPPPPMHHEPGEHMPPPP 250 Query: 767 XXXPPPPXXXPP----XPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXXX 934 P PP P PPP P PP P PP P Sbjct: 251 MHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEH 310 Query: 935 PXXXPXXXXPPXPXPXP 985 P P P P Sbjct: 311 MPPPPMHHEPGEHMPPP 327 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 40.7 bits (91), Expect = 3e-04 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -3 Query: 797 GXXXGGGGXXXGGXXXXGGXXXXGGG-GGWXXXGXGXXXXGXGGGGGPXXXXGGXVGGGG 621 G G GG G GG GGG GG G G G GG GG GG GG G Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRG 65 Score = 39.1 bits (87), Expect = 0.001 Identities = 28/73 (38%), Positives = 28/73 (38%) Frame = -2 Query: 879 GGXGGXGGGXXXXXXXXGGGXXXGGXGGXXXGGGGXXXGGXGXXGGXXEXGGXGGLXXGX 700 G GG GG G G GG GG G GG GG G G GG GG G Sbjct: 6 GSRGGRGGSRG------GRGGFNGGRGGFGGGRGGARGGGRG--GARGGRGGRGGARGGR 57 Query: 699 XXGXXXGXGGGGG 661 G G GG G Sbjct: 58 G-GSSGGRGGAKG 69 Score = 37.9 bits (84), Expect = 0.002 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = -3 Query: 809 GXXGGXXXGGGGXXXGGXXXXGGXXXXGGGG-GWXXXGXGXXXXGXGGGGGPXXXXGGXV 633 G GG G GG G GG GGG G G G GG GG GG Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAK 68 Query: 632 GG 627 GG Sbjct: 69 GG 70 Score = 37.5 bits (83), Expect = 0.003 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = -2 Query: 906 GXXXGXXGX-GGXGGXGGGXXXXXXXXGGGXXXGGXGGXXXGGGGXXXGGXGXXGGXXEX 730 G G G GG GG GG GG GG G GG G G G GG Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGA--RGGGRGGARGGRGGRGGARGGRGG--SS 61 Query: 729 GGXGGLXXG 703 GG GG G Sbjct: 62 GGRGGAKGG 70 Score = 37.1 bits (82), Expect = 0.004 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -2 Query: 921 GGXXGGXXXGXXGXGGXGG-XGGGXXXXXXXXGGGXXXGGXGGXXXGGGGXXXGGXGXXG 745 GG GG G GG GG GG GG GG GG G GG G G G Sbjct: 12 GGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGG--RGGRGGARGGRGGSSGGRGGAKG 69 Query: 744 G 742 G Sbjct: 70 G 70 Score = 35.9 bits (79), Expect = 0.009 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = -2 Query: 828 GGGXXXGGXGGXXXGGGGXXXGGXGXXGGXXEXGGXGGLXXGXXXGXXXGXGGG-GGPXX 652 G G GG GG G GG G G GG G GG G G G GG GG Sbjct: 10 GRGGSRGGRGGFNGGRGGFGGGRGGARGGG-RGGARGG--RGGRGGARGGRGGSSGGRGG 66 Query: 651 XXGG 640 GG Sbjct: 67 AKGG 70 Score = 34.7 bits (76), Expect = 0.020 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -2 Query: 786 GGGGXXXGGXGXXGGXXEXGGXGGLXXGXXXGXXXGXGGGGGPXXXXGGXXGXGGXXXAP 607 G G G G GG GG GG G G G GG GG GG G G Sbjct: 6 GSRGGRGGSRGGRGGFN--GGRGGF--GGGRGGARG-GGRGGARGGRGGRGGARGGRGGS 60 Query: 606 XXGEAGXXGG 577 G G GG Sbjct: 61 SGGRGGAKGG 70 Score = 33.5 bits (73), Expect = 0.047 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Frame = -1 Query: 751 GXGGXGXGGXGGVGXGXGXGXXGXXXGGGGAXXXXXGXXWXG-GGXXGPRXRGGGXXGGX 575 G GG GG GG G G G G GGA G G GG G R GG GG Sbjct: 10 GRGGSR-GGRGGFNGGRG----GFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGR 64 Query: 574 G 572 G Sbjct: 65 G 65 Score = 32.7 bits (71), Expect = 0.082 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -2 Query: 984 GXGXGXGGXXXXGXXXGXXXGGGXXGGXXXGXXGXGGXGGXGGGXXXXXXXXGG 823 G G GG G GG GG G GG GG GG GG Sbjct: 13 GSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGG 66 Score = 32.7 bits (71), Expect = 0.082 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -2 Query: 984 GXGXGXGGXXXXGXXXGXXXGGGXXGGXXXGXXGXGGX-GGXGGGXXXXXXXXGG 823 G G GG G G GGG GG G G GG GG GG GG Sbjct: 17 GRGGFNGGRGGFGGGRGGARGGGR-GGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 32.3 bits (70), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 751 GXGGXGXGGXGGVGXGXGXGXXGXXXGGGGAXXXXXGXXWXGGGXXG 611 G GG G GG GG G G G G GGA G GG G Sbjct: 24 GRGGFG-GGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKG 69 Score = 31.9 bits (69), Expect = 0.14 Identities = 23/66 (34%), Positives = 25/66 (37%) Frame = -3 Query: 785 GGGGXXXGGXXXXGGXXXXGGGGGWXXXGXGXXXXGXGGGGGPXXXXGGXVGGGGXEXPP 606 GG G GG GG GG GG+ G G GG G GG GG G Sbjct: 9 GGRGGSRGGR---GGFN--GGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGG 63 Query: 605 XXGRRG 588 G +G Sbjct: 64 RGGAKG 69 Score = 31.9 bits (69), Expect = 0.14 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -3 Query: 935 GGXGGGGXXGGGGXGXXGXGGXGGXGXGXXXXXXXXGXXXXXGXXGGXXXGGGGXXXG 762 GG GG GGG G GG GG G G G GG G GG G Sbjct: 19 GGFNGGRGGFGGGRGGARGGGRGGARGG------RGGRGGARGGRGGSSGGRGGAKGG 70 Score = 29.1 bits (62), Expect = 1.0 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = -3 Query: 917 GXXGGGGXGXXGXGGXGGXGXGXXXXXXXXGXXXXXGXXGGXXXGGGGXXXGGXXXXGGX 738 G GG G G GG G G G G G G GG G GG Sbjct: 6 GSRGGRGGSRGGRGGFNG-GRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGR 64 Query: 737 XXXGGG 720 GG Sbjct: 65 GGAKGG 70 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 37.5 bits (83), Expect = 0.003 Identities = 33/123 (26%), Positives = 33/123 (26%) Frame = +2 Query: 581 PXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPX 760 P A P A P P P P P P P P S P Sbjct: 423 PAPWAKPASSAAPSNPAPWQQPA---APQSAPALSMNPSSLPPWQQPTQQ-SAVQPSNLV 478 Query: 761 PPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXXXPX 940 P P P P PP PP PP P P P PP PP P Sbjct: 479 PSQNAPFIPGTSAPLPPTTFAPPGVPL-----PPIPGAPGMPNLNMSQPPMVPPGMALPP 533 Query: 941 XXP 949 P Sbjct: 534 GMP 536 Score = 35.1 bits (77), Expect = 0.015 Identities = 34/132 (25%), Positives = 35/132 (26%), Gaps = 3/132 (2%) Frame = +2 Query: 581 PXXPASPXXGAXXXPPX-PXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXP 757 P A+P A P P P P P P P P S P P Sbjct: 429 PASSAAPSNPAPWQQPAAPQSAPALSMNPSSLP-PWQQPTQQSAVQPSNLVPSQNAPFIP 487 Query: 758 XPPXXXPPPPXXXP--PXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXX 931 PP P P PP P S PP PP P P P Sbjct: 488 GTSAPLPPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAVPA 547 Query: 932 XPXXXPXXXXPP 967 P P PP Sbjct: 548 MP-GIPGATAPP 558 Score = 27.5 bits (58), Expect = 3.1 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 2/67 (2%) Frame = +2 Query: 572 PXPPXXPASPXXGAXXXPPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXP-- 745 P PP A P P P P PP P P P P P P Sbjct: 492 PLPPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAVPAMPGI 551 Query: 746 PXXPXPP 766 P PP Sbjct: 552 PGATAPP 558 Score = 25.8 bits (54), Expect = 9.4 Identities = 24/84 (28%), Positives = 24/84 (28%) Frame = +1 Query: 670 PPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXPPPPXXXPPXXPXXXXXPXXXXXXX 849 P P P P PP L PP P P PP P P Sbjct: 484 PFIPGTSAPLPPTTFAPPGVPL--PPIPGAP--GMPNLNMSQPPMVP-----PGMALPPG 534 Query: 850 XPXPXPPXPPXPXXPXPPPPXXPP 921 P P P P P P P PP Sbjct: 535 MPAPFPGYPAVPAMPGIPGATAPP 558 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 37.1 bits (82), Expect = 0.004 Identities = 26/106 (24%), Positives = 27/106 (25%), Gaps = 2/106 (1%) Frame = +2 Query: 626 PXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXP-PXXPXPPXXXPPPPXXXPP 802 P P P P P PP P PP PPPP Sbjct: 143 PASQEPSASGVNAPTVSAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPPPAVEDQ 202 Query: 803 XPPXXXPPPXXXXXXSXPPPXPP-XPPXPXXPXXXPPXXPPPXXXP 937 P + P PP P P PP PPP P Sbjct: 203 AADANEPDDYYSSGRAVSPEIPPTYTPKQADPLPAPPPPPPPTLPP 248 Score = 37.1 bits (82), Expect = 0.004 Identities = 27/102 (26%), Positives = 27/102 (26%) Frame = +2 Query: 644 PXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXP 823 P PPPPP P N P S P P P P PP P Sbjct: 184 PSDYNPPPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYTPKQADPLPAPP--PP 241 Query: 824 PPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPPPXXXPXXXP 949 PP S P P PPP P P Sbjct: 242 PPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATPSQPP 283 Score = 34.3 bits (75), Expect = 0.027 Identities = 27/109 (24%), Positives = 28/109 (25%), Gaps = 12/109 (11%) Frame = +1 Query: 616 SXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPP------------PXLXXPPXXXX 759 S P T P PPPPP P + P P P Sbjct: 175 SAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYTPKQADP 234 Query: 760 PPXXXPPPPXXXPPXXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPP 906 P PPPP PP P PP P P PP Sbjct: 235 LPAPPPPPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATPSQPP 283 Score = 34.3 bits (75), Expect = 0.027 Identities = 27/105 (25%), Positives = 27/105 (25%) Frame = +1 Query: 622 PPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXPPPPXXXPP 801 PPPP PP P P PP P P PPPP PP Sbjct: 190 PPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYT-PKQADPLPAPPPPPPPTLPP 248 Query: 802 XXPXXXXXPXXXXXXXXPXPXPPXPPXPXXPXPPPPXXPPPPXPP 936 P PP P P PP PP Sbjct: 249 QSTNTSQLPMPSRNVNNLGSQVNIPPPPATP-------SQPPRPP 286 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 35.9 bits (79), Expect = 0.009 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 743 PPXXPXPPXXXPPPPXXXPPXPPXXXPPP 829 PP P PP PPPP PP P PPP Sbjct: 5 PPGNPPPP---PPPPGFEPPSQPPPPPPP 30 Score = 35.1 bits (77), Expect = 0.015 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +1 Query: 853 PXPXPPXPPXPXXPXPPPPXXPPPPXPP 936 P PP PP P P PP PPPP PP Sbjct: 5 PPGNPPPPPPP--PGFEPPSQPPPPPPP 30 Score = 34.7 bits (76), Expect = 0.020 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 661 PPPPPXPXXXXPXPSXXQPPPPP 729 PPPPP P P PS PPPPP Sbjct: 9 PPPPPPPPGFEP-PSQPPPPPPP 30 Score = 33.9 bits (74), Expect = 0.036 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 858 PPXPPPPPXXXPXXXXPXXPPP 923 PP PPPPP P P PPP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPPP 30 Score = 31.1 bits (67), Expect = 0.25 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 797 PPXPPXXXPPPXXXXXXSXPPPXPP 871 PP P PPP S PPP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 31.1 bits (67), Expect = 0.25 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 704 PXXNPPXPPXSXXPPXXPXPPXXXPPPP 787 P NPP PP PP PP PPPP Sbjct: 5 PPGNPPPPP----PPPGFEPPSQPPPPP 28 Score = 29.9 bits (64), Expect = 0.58 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 595 LPXXGGXSXPPPPTXPPXXXXGPPPPP 675 LP PPPP P PPPPP Sbjct: 4 LPPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 29.5 bits (63), Expect = 0.77 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 797 PPXPPXXXPPPXXXXXXSXPPPXPP 871 P PP PPP PPP PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 29.1 bits (62), Expect = 1.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 904 PPXXPPPPXPPXXXXXXXXPXXXXPP 981 PP PPPP PP P PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 29.1 bits (62), Expect = 1.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 700 PSXXQPPPPPXLXXPPXXXXPPXXXPPPP 786 P PPPPP PP P PPPP Sbjct: 5 PPGNPPPPPP----PPGFEPPSQPPPPPP 29 Score = 29.1 bits (62), Expect = 1.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 700 PSXXQPPPPPXLXXPPXXXXPPXXXPPP 783 P PPPPP PP PP PPP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPP---PPP 30 Score = 29.1 bits (62), Expect = 1.0 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +1 Query: 622 PPPPTXPP--XXXXGPPPPPXP 681 PPPP PP PPPPP P Sbjct: 9 PPPPPPPPGFEPPSQPPPPPPP 30 Score = 28.7 bits (61), Expect = 1.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 669 PPXXXPXXPXPXPXPTPPXPPXPXPP 746 PP P P P P PP P PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 28.7 bits (61), Expect = 1.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 809 PXXXPPPXXXXXXSXPPPXPPXPPXP 886 P PPP PP PP PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 28.3 bits (60), Expect = 1.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 659 GPPPPPXPXXXPXXXPXXNPPXPP 730 G PPPP P P P PP PP Sbjct: 7 GNPPPPPP--PPGFEPPSQPPPPP 28 Score = 27.5 bits (58), Expect = 3.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 728 PXSXXPPXXPXPPXXXPPPPXXXPPXPP 811 P PP P PP PP PP PP Sbjct: 5 PPGNPPP--PPPPPGFEPPSQPPPPPPP 30 Score = 26.6 bits (56), Expect = 5.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 672 PXXXPXXPXPXPXPTPPXPPXPXPPXP 752 P P P P P PP P P PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQP-PPPPPP 30 Score = 26.6 bits (56), Expect = 5.4 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +2 Query: 806 PPXXXPPPXXXXXXSXPPPXPPXPP 880 PP PPP P PP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 26.2 bits (55), Expect = 7.1 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +2 Query: 893 PXXXPPXXPPPXXXPXXXPXXXXPP 967 P PP PPP P P PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 34.3 bits (75), Expect = 0.027 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 825 GGXXXGGXGGXXXGGGGXXXGGXGXXGGXXEXGGXGGLXXGXXXGXXXGXGGG 667 G GG GG G GG G G G G GG G G G GG Sbjct: 133 GPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGG 185 Score = 32.3 bits (70), Expect = 0.11 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 2/70 (2%) Frame = -2 Query: 906 GXXXGXXGXGGXGGXGGGXXXXXXXXGGGXXXGGXGGXXXGG--GGXXXGGXGXXGGXXE 733 G G G GG GG GG G GG GG GG GG G G G Sbjct: 129 GARNGPAGRGGRGGFRGGR---------GGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSR 179 Query: 732 XGGXGGLXXG 703 G GG G Sbjct: 180 GGFRGGSRGG 189 Score = 30.3 bits (65), Expect = 0.44 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 797 GXXXGGGGXXXGGXXXXGGXXXXGGGGGWXXXGXGXXXXGXGGGGGPXXXXGGXVGG 627 G G G G G GG GG G G G GGG GG GG Sbjct: 129 GARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGG 185 Score = 29.9 bits (64), Expect = 0.58 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 801 GGXXXGGGGXXXGGXGXXGGXXEXGGXGGLXXGXXXGXXXGXGGGGGPXXXXGGXXG 631 G GG G GG G GG GG G G G GGG GG G Sbjct: 133 GPAGRGGRGGFRGGRG-----GSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRG 184 Score = 28.7 bits (61), Expect = 1.3 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -1 Query: 751 GXGGXGXGGXGGVGXGXGXGXXGXXXGG-GGAXXXXXGXXWXGGGXXGPRXRGGGXXGGX 575 G GG G G GG G G G G GG GG G GG G RGG G Sbjct: 136 GRGGRG-GFRGGRGGSRG-GFGGNSRGGFGGGSRGGFGGGSRGGSRGG--FRGGSRGGFR 191 Query: 574 G 572 G Sbjct: 192 G 192 Score = 26.2 bits (55), Expect = 7.1 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = -1 Query: 745 GGXGXGGXGGVGXGXGXGXXGXXXGG-GGAXXXXXGXXWXGGGXXGPRXR 599 GG G G GG G G G GG GG + GG G R R Sbjct: 145 GGRG-GSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGGFRGR 193 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 31.5 bits (68), Expect = 0.19 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = +1 Query: 661 PPPPPXPXXXXPXPSXXQPPPPP--XLXXPP---XXXXPPXXXPPPPXXXPPXXP 810 PPPPP P+ PPPP PP PP P P P P Sbjct: 908 PPPPPTASMTASAPAIASPPPPKVGETYHPPTASGTRVPPVQQPSHPNPYTPVAP 962 Score = 26.2 bits (55), Expect = 7.1 Identities = 21/73 (28%), Positives = 21/73 (28%), Gaps = 8/73 (10%) Frame = +1 Query: 607 GGXSXPPPPTXPPXXXXGPPPP--------PXPXXXXPXPSXXQPPPPPXLXXPPXXXXP 762 GG PPP P PP P P PS P P L P P Sbjct: 1004 GGSQIVPPPKQPANRVVPLPPTASQRASAYEPPTVSVPSPSALSPSVTPQL-PPVSSRLP 1062 Query: 763 PXXXPPPPXXXPP 801 P P PP Sbjct: 1063 PVSATRPQIPQPP 1075 Score = 25.8 bits (54), Expect = 9.4 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +1 Query: 625 PPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXPPPP 786 PP PP P PS PP PP P PPP Sbjct: 1023 PPTASQRASAYEPPTVSVPSPSALSPSVTPQLPPVSSRLPPVSATRPQIPQPPP 1076 >SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein Lsb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 296 Score = 29.9 bits (64), Expect = 0.58 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 776 PPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXP 895 PPPP P PP + PP P PP P Sbjct: 208 PPPPQQNYPPAASSSAPPMQYQQTAYPPQQAPYPPVQAYP 247 Score = 26.2 bits (55), Expect = 7.1 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 661 PPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXPPPPXXXPPXXP 810 PPPPP P S PP PP P PP P P Sbjct: 206 PPPPPPQQNYPPAASSSAPP-----MQYQQTAYPPQQAPYPPVQAYPQAP 250 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 29.5 bits (63), Expect = 0.77 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 853 PXPXPPXPPXPXXPXPPPPXXPPPPXPP 936 P P P P P P P P P P PP Sbjct: 113 PVPEEPLPGEPPLPDEPVPEEPLPGEPP 140 Score = 28.7 bits (61), Expect = 1.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 859 PXPPXPPXPXXPXPPPPXXPPPPXP 933 P P PP P P P P PP P Sbjct: 102 PLPREPPLPNEPVPEEPLPGEPPLP 126 Score = 28.7 bits (61), Expect = 1.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 859 PXPPXPPXPXXPXPPPPXXPPPPXP 933 P P PP P P P P PP P Sbjct: 118 PLPGEPPLPDEPVPEEPLPGEPPLP 142 Score = 27.1 bits (57), Expect = 4.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 859 PXPPXPPXPXXPXPPPPXXPPPPXPP 936 P P P P P P P P P PP Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPP 124 Score = 27.1 bits (57), Expect = 4.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 853 PXPXPPXPPXPXXPXPPPPXXPPPPXP 933 P P P P P PP P P P P Sbjct: 108 PLPNEPVPEEPLPGEPPLPDEPVPEEP 134 Score = 26.2 bits (55), Expect = 7.1 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 1/49 (2%) Frame = +3 Query: 843 PXXXXPPXPPPPPXXXPXXXXPXXPPPPXXXXPXXP-XXXPXXXXXPXP 986 P P PP P P P PP P P P P P P Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEPVP 147 Score = 25.8 bits (54), Expect = 9.4 Identities = 19/69 (27%), Positives = 20/69 (28%) Frame = +2 Query: 704 PXXNPPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPX 883 P P + P P P PP P P P PP P P P P Sbjct: 85 PTSEASKPLLNELVPEEPLP--REPPLPNEPVPEEPLPGEPPLP----DEPVPEEPLPGE 138 Query: 884 PXXPXXXPP 910 P P P Sbjct: 139 PPLPNEPVP 147 >SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 29.5 bits (63), Expect = 0.77 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 580 PXXPRLPXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPP 726 P P LP G S P P P PP P P PPPP Sbjct: 109 PKEPALPSRGTPSLPSRPGSRPSVLNQEQVPPPP--VRPNVMSQMPPPP 155 Score = 27.5 bits (58), Expect = 3.1 Identities = 29/123 (23%), Positives = 30/123 (24%), Gaps = 17/123 (13%) Frame = +2 Query: 578 PPXXPASPXXGAXXXPPXPXXPPXXXXG---PPPPPXPXXXPXXXP-------------- 706 PP PA P G P P P PPPP P P Sbjct: 108 PPKEPALPSRGTPSLPSRPGSRPSVLNQEQVPPPPVRPNVMSQMPPPPSYSSSGSYSQTY 167 Query: 707 XXNPPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXP 886 N S P P PPP P + P P PP P Sbjct: 168 QSNANYTASSPLPTASANAPLPVPPPRRVSQNSSYASGSVPAATAASTASPVKKPPPPAP 227 Query: 887 XXP 895 P Sbjct: 228 PKP 230 >SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 690 Score = 28.7 bits (61), Expect = 1.3 Identities = 24/94 (25%), Positives = 25/94 (26%), Gaps = 2/94 (2%) Frame = +2 Query: 704 PXXNPPXPPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXPPP-XXXXXXSXPPPXPPXPP 880 P + PP P P PP P P P P S PP P P Sbjct: 132 PFPHSHHPPLHNPLPVSCQPVLRPPPVPQVPSHWYPVSLPSPNLPHQPISKPPVIPNLPK 191 Query: 881 XPXXPXXXP-PXXPPPXXXPXXXPXXXXPPXPXP 979 P P P P P P P P Sbjct: 192 LQVHPNRLPHPIHNHPYSSPTSYPPPLCPATYCP 225 Score = 26.6 bits (56), Expect = 5.4 Identities = 19/70 (27%), Positives = 19/70 (27%), Gaps = 2/70 (2%) Frame = +2 Query: 623 PPXPXXPPXXXXGPPPPPXPXXXPXXXPXXNPPXPPXSXXPPXXPXPPXXXP--PPPXXX 796 PP P P P P P P P P P P P P P Sbjct: 156 PPVPQVPSHWYPVSLPSPNLPHQPISKPPVIPNLPKLQVHPNRLPHPIHNHPYSSPTSYP 215 Query: 797 PPXPPXXXPP 826 PP P P Sbjct: 216 PPLCPATYCP 225 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 27.9 bits (59), Expect = 2.3 Identities = 15/64 (23%), Positives = 18/64 (28%) Frame = +1 Query: 595 LPXXGGXSXPPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXX 774 +P G + P PT PP PP P + P P PP Sbjct: 291 IPPTGNSTTPVTPTVPPTSTSSTSTPPPPASTSSTGTSSSPLPSTSTSCTTSTSIPPTGN 350 Query: 775 PPPP 786 P Sbjct: 351 STTP 354 Score = 25.8 bits (54), Expect = 9.4 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = +1 Query: 595 LPXXGGXSXPPPPTXPPXXXXGPPPPPXP 681 +P G + P PT PP PP P Sbjct: 345 IPPTGNSTTPVTPTVPPTSTSSTSTPPPP 373 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 27.5 bits (58), Expect = 3.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 665 PPPPXPXXXPXXXPXXNPPXPPXSXXPPXXP 757 PPPP P P P P P S PP P Sbjct: 1882 PPPPPPMALPKAGP---PSAAPTSALPPAGP 1909 Score = 27.1 bits (57), Expect = 4.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 663 PPPPXXXPXXPXPXPXPTPPXPPXPXP 743 PPPP P P PT PP P Sbjct: 1884 PPPPMALPKAGPPSAAPTSALPPAGPP 1910 >SPBC902.04 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 589 Score = 27.5 bits (58), Expect = 3.1 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 764 PXXXPPPPXXXPPXPPXXXPPPXXXXXXSXPPPXPPXPPXPXXPXXXPPXXPP 922 P PP P P P PP P P P PP PP Sbjct: 135 PNMFGPPLYHPAATAPSEFMPSIPGFGNLPNPAMPPIPFLPFNPAAQPPFPPP 187 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 27.1 bits (57), Expect = 4.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 622 PPPPTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPP 726 P PPT P PPP P PS PP P Sbjct: 729 PAPPTPAPTPAVKHHPPPPPVRSSISPS--MPPAP 761 Score = 26.6 bits (56), Expect = 5.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 853 PXPXPPXPPXPXXPXPPPPXXPPPPXPP 936 P P P P P P P PP PP Sbjct: 721 PAIKPQVTPAPPTPAPTPAVKHHPPPPP 748 Score = 25.8 bits (54), Expect = 9.4 Identities = 11/35 (31%), Positives = 13/35 (37%) Frame = +1 Query: 661 PPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPP 765 P P P P P+ PPPP + PP Sbjct: 725 PQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPP 759 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 26.6 bits (56), Expect = 5.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 762 GXGXXGGXXEXGGXGGLXXGXXXGXXXGXGGGG 664 G G GG GG GG G G G GG Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGG 478 >SPBC19C7.05 |||cell wall organization protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 150 Score = 25.8 bits (54), Expect = 9.4 Identities = 15/51 (29%), Positives = 16/51 (31%), Gaps = 2/51 (3%) Frame = +2 Query: 725 PPXSXXPPXXPXPPXXXPPPPXXXPPXPPXXXPP--PXXXXXXSXPPPXPP 871 PP + P P PP PP PP P PPP P Sbjct: 80 PPYTAEPEARYNSTIHNPMPPMSQAYRPPPTEPPTVPAYETSSEFPPPAYP 130 >SPAC688.11 |end4|sla2|Huntingtin-interacting protein homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1092 Score = 25.8 bits (54), Expect = 9.4 Identities = 13/52 (25%), Positives = 15/52 (28%) Frame = +1 Query: 631 PTXPPXXXXGPPPPPXPXXXXPXPSXXQPPPPPXLXXPPXXXXPPXXXPPPP 786 P P P P P P+ P PP + P P P P Sbjct: 268 PDLPKRPASIAPQPTGASTIAPQPTGTSPSPPVEMNFPDTSDITPAYSEPEP 319 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,016,155 Number of Sequences: 5004 Number of extensions: 72907 Number of successful extensions: 2324 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 604 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 511279616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -