BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E12 (940 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 27 1.1 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 5.8 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 26.6 bits (56), Expect = 1.1 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 163 TGKLLLSDK-PTIIITL*GKYTSKVWRPTRFLCS 261 TG++++ D +ITL G + K+W P F + Sbjct: 73 TGEIMIEDDGANDVITLSGDFAEKIWVPDTFFAN 106 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 5.8 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = +2 Query: 212 EESTRAKCGGQRDSFVQEGAGGILRIPSAGAEDQGHRYKGPREWLGR 352 +E R GG DS +EG G R + Q R K E L + Sbjct: 958 KEKARRGSGGDSDSEEEEGEGSRKRKKKGASGGQKKRQKAMDEGLSQ 1004 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 645,707 Number of Sequences: 2352 Number of extensions: 11151 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 102535848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -