BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E10 (965 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0833 - 25196091-25196372,25196464-25196565,25196640-251968... 31 1.8 04_04_1105 - 30942735-30942791,30943116-30943466,30943670-309437... 29 5.5 03_02_0916 + 12364557-12364906,12365485-12365592,12365731-12366343 29 7.3 10_08_0940 - 21708557-21708733,21709058-21709142,21709330-217095... 28 9.7 06_03_0218 + 18219956-18220555 28 9.7 03_06_0149 - 31987183-31987630,31987813-31987874 28 9.7 03_04_0061 - 16949038-16950006 28 9.7 >06_03_0833 - 25196091-25196372,25196464-25196565,25196640-25196838, 25196978-25197278,25197471-25197645,25197842-25198012, 25198207-25198239 Length = 420 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/53 (30%), Positives = 21/53 (39%) Frame = +1 Query: 523 CWRFSIGSAPLTSITKIDAQVRGGETRQDYKDTRRFPLEAPSCALLFRPCRLP 681 CWR + T D Q + +KD P + PSC L+F P P Sbjct: 283 CWRHFLNQDFAMFATAGDDQWNPEDHLPSFKDDSLIPYDVPSCHLIFIPLLQP 335 >04_04_1105 - 30942735-30942791,30943116-30943466,30943670-30943762, 30943869-30944072,30944155-30944399,30945019-30945877, 30946070-30946936,30947113-30947562 Length = 1041 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = +1 Query: 673 RLPDTCPPFSLREAWRFLIA-----HAVGISVRCRSFASK 777 RL D C P L+E WRFL+A A S RC++ +K Sbjct: 849 RLAD-CDPRVLKEQWRFLVAFWNTEEAQAASARCKASRAK 887 >03_02_0916 + 12364557-12364906,12365485-12365592,12365731-12366343 Length = 356 Score = 28.7 bits (61), Expect = 7.3 Identities = 22/56 (39%), Positives = 25/56 (44%), Gaps = 4/56 (7%) Frame = +1 Query: 355 PLPRSLTRCARSF--GCGERYQLTQRR*YGYPQNQGITQ--ERTCEQKASKRPGTV 510 P PRS RC GCG R Q TQR P N IT E TC ++ P + Sbjct: 150 PYPRSYYRCTHKLDQGCGARRQ-TQRC-EADPSNYDITYYGEHTCRDPSTIIPTAI 203 >10_08_0940 - 21708557-21708733,21709058-21709142,21709330-21709551, 21710640-21710815,21711883-21711946,21712433-21712507, 21715114-21715199,21715297-21716715 Length = 767 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +1 Query: 304 NESAN---ARGEAVCVLGALPLPRSLTRCAR 387 +ESAN AR EAV +G +P+ L RC+R Sbjct: 434 DESANVDAARSEAVMRVGGIPMLLDLARCSR 464 >06_03_0218 + 18219956-18220555 Length = 199 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = -1 Query: 710 SRREKGGQVSG--KRQGRNRRAHEGASRGKRLVS 615 +RRE+ + +G KR+GR R G RGKR S Sbjct: 106 ARRERRLEAAGAEKREGRRRGGSSGGLRGKRRAS 139 >03_06_0149 - 31987183-31987630,31987813-31987874 Length = 169 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 731 AMRKRHASRREKGGQVSGKRQGRNRRAHEGASRG 630 A+ + H R + + +R+GR R AHEG G Sbjct: 76 AVARGHGLERLQEAGIEAERRGRRRNAHEGIKIG 109 >03_04_0061 - 16949038-16950006 Length = 322 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 605 RTIKIPGVSPWKLPRALSCSDPAAYRIPVRLSPFGKRGA 721 RT+K PG+ ++PRA+ + P Y VR + +R A Sbjct: 255 RTMKGPGLGGARVPRAVFRASPRRYYAAVRTARKARRSA 293 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,288,377 Number of Sequences: 37544 Number of extensions: 518120 Number of successful extensions: 1540 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1536 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2799822860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -