BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E10 (965 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L10990-8|AAB59173.2| 223|Caenorhabditis elegans Hypothetical pr... 32 0.70 AF098992-14|AAD34669.1| 346|Caenorhabditis elegans Hypothetical... 29 5.0 >L10990-8|AAB59173.2| 223|Caenorhabditis elegans Hypothetical protein C30A5.3 protein. Length = 223 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 610 YKDTRRFPLEAPSCALLFRPCRLPDTCPPFSLREAWRFLIA 732 Y+ R+F +E ALL + +P+TC + E W FL A Sbjct: 71 YEHLRQFCIELNGLALLLQRECIPETCQQMTATEQWIFLCA 111 >AF098992-14|AAD34669.1| 346|Caenorhabditis elegans Hypothetical protein F53C3.13a protein. Length = 346 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -2 Query: 136 VQTHQCILSCLDPINPXLKGDPRPRVPTI 50 V T I+S +DP N LK +P+ VPT+ Sbjct: 302 VSTQHVIVSEVDPANQRLKTNPKDTVPTM 330 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,302,738 Number of Sequences: 27780 Number of extensions: 380523 Number of successful extensions: 973 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 973 length of database: 12,740,198 effective HSP length: 82 effective length of database: 10,462,238 effective search space used: 2500474882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -