BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E07 (881 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30753| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_58506| Best HMM Match : Vps52 (HMM E-Value=0.099) 29 6.6 >SB_30753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 286 ETASALKKNVYENYMXFIETATEIS 360 E ++ K VYE Y+ F ETAT+IS Sbjct: 212 EKSTETSKKVYEAYLYFPETATKIS 236 >SB_58506| Best HMM Match : Vps52 (HMM E-Value=0.099) Length = 775 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +2 Query: 470 RESLDNHDVEAERAXEXRKNKLHLITEKVESCMNLLDVPDRTL--LHEGDL 616 RE ++ + + +R E + ++VE +N LD+P+R + L EGDL Sbjct: 45 REHMEQME-DKDRHMETESTNRQKLLKQVEFLVNTLDIPERHIIALQEGDL 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,262,612 Number of Sequences: 59808 Number of extensions: 229820 Number of successful extensions: 461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 461 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2514529411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -