BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E06 (997 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 44 4e-05 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 39 0.001 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 38 0.003 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 35 0.016 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 32 0.14 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 30 0.58 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 29 1.3 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 29 1.3 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 28 2.4 SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 27 3.1 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 26 9.5 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 43.6 bits (98), Expect = 4e-05 Identities = 32/110 (29%), Positives = 33/110 (30%), Gaps = 10/110 (9%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLF--PXXXXXXAXPXXPPPXXXSPXXXXA----PP 799 PP PS PP P P P P P P P P +P PP Sbjct: 1121 PPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPP 1180 Query: 800 PPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPP----PPXXTNXFPLGPXP 937 P P PP P P P PP PP T L P P Sbjct: 1181 VPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVP 1230 Score = 43.2 bits (97), Expect = 6e-05 Identities = 32/106 (30%), Positives = 32/106 (30%), Gaps = 6/106 (5%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLF---PXXXXXXAXPXXPPPXXXSPXXXX---APP 799 PP PS PP P P P P P P P P P APP Sbjct: 1140 PPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPP 1199 Query: 800 PPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXP 937 P P PP P P P PP P T P P P Sbjct: 1200 VPKPSVGVPPVPPPSTAPPVPTPS---AGLPPVPVPTAKAPPVPAP 1242 Score = 42.7 bits (96), Expect = 8e-05 Identities = 35/121 (28%), Positives = 37/121 (30%), Gaps = 6/121 (4%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLF--PXXXXXXAXPXXPPPXXXS---PXXXXAPPP 802 PP PS PP P P P P P P P P + P APP Sbjct: 1102 PPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPV 1161 Query: 803 PXPGXXXXKXP-PXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFXXP 979 P P P P P P P PPP + P P P V P P Sbjct: 1162 PKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPP----SEAPPVPKPSVGVPPVPPPSTAP 1217 Query: 980 P 982 P Sbjct: 1218 P 1218 Score = 41.9 bits (94), Expect = 1e-04 Identities = 33/120 (27%), Positives = 36/120 (30%), Gaps = 5/120 (4%) Frame = +2 Query: 638 PPXKPPSXXPP-PXPT----PXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPP 802 PP PS PP P P+ P P P P P P P APP Sbjct: 1083 PPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPV 1142 Query: 803 PXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFXXPP 982 P P P P P P PP P ++ P P P P PP Sbjct: 1143 PKPSVAAPPVPAPSGAPPVPKPS---VAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPP 1199 Score = 37.5 bits (83), Expect = 0.003 Identities = 32/111 (28%), Positives = 34/111 (30%), Gaps = 9/111 (8%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLF--PXXXXXXAXPXXPPPXXXS-------PXXXX 790 PP PS PP P P P P P P PPP P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSG 1081 Query: 791 APPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXV 943 APP P P P P P P PP P + P+ P P V Sbjct: 1082 APPVPAPSGIPPVPKPSVAAPPVPKPS---VAVPPVPAPSGAPPV-PKPSV 1128 Score = 36.3 bits (80), Expect = 0.007 Identities = 31/107 (28%), Positives = 35/107 (32%), Gaps = 5/107 (4%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSP--LFPXXXXXXAXPXXPPP---XXXSPXXXXAPPP 802 PP PS P P P P +P + P A P P P P APP Sbjct: 1064 PPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPV 1123 Query: 803 PXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXV 943 P P P P P P PP P + P+ P P V Sbjct: 1124 PKPSVAAPPVPVPSGAPPVPKPS---VAAPPVPAPSGAPPV-PKPSV 1166 Score = 34.3 bits (75), Expect = 0.027 Identities = 28/102 (27%), Positives = 31/102 (30%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGX 817 PP S PP P P P+ P P PP S + PPP P Sbjct: 1012 PPVPKLSSKAPPVPLPSA-DAPPIPV-PSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAP 1069 Query: 818 XXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXV 943 P P P P PP P + P P P V Sbjct: 1070 S--SEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSV 1109 Score = 33.9 bits (74), Expect = 0.036 Identities = 34/129 (26%), Positives = 38/129 (29%), Gaps = 3/129 (2%) Frame = +1 Query: 553 PLTSITKIXAPSXXXXPP-PDRTIXIPXXPPXX--TPLPXPPPFXXPXPXTXXXXPPFSP 723 P S+ P PP P ++ P P P+P P P P PP Sbjct: 1124 PKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPK 1183 Query: 724 XGXXXGXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPX 903 G PPP PP P P PP P T P PP P Sbjct: 1184 PA--AGVPPVPPP-------SEAPPVPKPSVGVPPVPP--PSTAPPVPTPSAGL-PPVPV 1231 Query: 904 KXKXFPPXP 930 PP P Sbjct: 1232 PTAKAPPVP 1240 Score = 32.7 bits (71), Expect = 0.083 Identities = 33/143 (23%), Positives = 36/143 (25%), Gaps = 1/143 (0%) Frame = +1 Query: 553 PLTSITKIXAPS-XXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXG 729 P + I I APS P P +P P+P P P P PP Sbjct: 1069 PSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVP-APSGAPPVPKPS 1127 Query: 730 XXXGXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXKX 909 P P PP P P P P PP P Sbjct: 1128 VAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVP--KPSVAAPPVPAPSSGIPPVPKPA 1185 Query: 910 KXFPPXPXXLXXXDXXKPXFXXP 978 PP P KP P Sbjct: 1186 AGVPPVPPPSEAPPVPKPSVGVP 1208 Score = 31.5 bits (68), Expect = 0.19 Identities = 32/126 (25%), Positives = 37/126 (29%) Frame = +2 Query: 560 RASQKSXPHLXXGXXPPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXX 739 R + P PP + P +PP PP P P SP P Sbjct: 956 RKASGPRPAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSK--PVSTSPAAP------ 1007 Query: 740 AXPXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXF 919 PP S APP P P P P P P PP P ++ Sbjct: 1008 -LARVPPVPKLS---SKAPPVPLPSADAPPIPVPSTAPPVPIP----TSTPPVPKSSSGA 1059 Query: 920 PLGPXP 937 P P P Sbjct: 1060 PSAPPP 1065 Score = 30.7 bits (66), Expect = 0.33 Identities = 20/85 (23%), Positives = 26/85 (30%), Gaps = 2/85 (2%) Frame = +1 Query: 553 PLTSITKIXAPSXXXXPPPDRTIXIPXXPPXXT--PLPXPPPFXXPXPXTXXXXPPFSPX 726 P + + PS P P ++ +P PP T P+P P P P PP Sbjct: 1184 PAAGVPPVPPPSEAP-PVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAP 1242 Query: 727 GXXXGXSXXPPPXXXFPXXGXGPPP 801 P P P P Sbjct: 1243 SSEAPSVSTPRSSVPSPHSNASPSP 1267 Score = 28.3 bits (60), Expect = 1.8 Identities = 32/145 (22%), Positives = 36/145 (24%), Gaps = 3/145 (2%) Frame = +1 Query: 553 PLTSITKIXAPSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGX 732 PL + + S P P + P P T P P P P P +P Sbjct: 1007 PLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPV 1066 Query: 733 XXGXS---XXPPPXXXFPXXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPX 903 S P P P PP P P P PP P Sbjct: 1067 PAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVP-PVPAPSGAPPVPK 1125 Query: 904 KXKXFPPXPXXLXXXDXXKPXFXXP 978 PP P KP P Sbjct: 1126 PSVAAPPVPVPSGAPPVPKPSVAAP 1150 Score = 26.6 bits (56), Expect = 5.4 Identities = 27/99 (27%), Positives = 31/99 (31%), Gaps = 4/99 (4%) Frame = +2 Query: 638 PPXKPPSXXPP-PXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXA---PPPP 805 P KP + PP P P+ P P P PPP P + PP P Sbjct: 1180 PVPKPAAGVPPVPPPSEAP---------PVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVP 1230 Query: 806 XPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFP 922 P K PP P P P P +N P Sbjct: 1231 VP---TAKAPP-VPAPSSEAPSVSTPRSSVPSPHSNASP 1265 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 39.1 bits (87), Expect = 0.001 Identities = 36/139 (25%), Positives = 40/139 (28%), Gaps = 13/139 (9%) Frame = +1 Query: 601 PPPDRTIX---IPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXX 771 PPP R+ IP P + P PPP P T PP S PP Sbjct: 340 PPPPRSNAAGSIPLPPQGRSAPPPPPP--RSAPSTGRQPPPLSSSRAVSNPPAPPPAIPG 397 Query: 772 -----FPXXGXG-----PPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXKXKXFP 921 P G PP P P PP P + P PP P P Sbjct: 398 RSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAP 457 Query: 922 PXPXXLXXXDXXKPXFXXP 978 P P + P P Sbjct: 458 PLPAGMPAAPPLPPAAPAP 476 Score = 35.1 bits (77), Expect = 0.016 Identities = 29/106 (27%), Positives = 32/106 (30%), Gaps = 9/106 (8%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXS--PXXXXAPPPPXP 811 PP PP P P +P P + PPP S APPP P Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIP 396 Query: 812 GXXXXKXPP-----XXPXPXXPXPGXXXXXXPP--PPXXTNXFPLG 928 G PP P P P PP PP P+G Sbjct: 397 GRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMG 442 Score = 34.3 bits (75), Expect = 0.027 Identities = 31/126 (24%), Positives = 32/126 (25%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXX 784 PP G PP PS P P P P + P PP S Sbjct: 354 PPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNAS--R 411 Query: 785 XXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNP 964 PP P P PP P P PP P P P P Sbjct: 412 TSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPP 471 Query: 965 XFXXPP 982 PP Sbjct: 472 AAPAPP 477 Score = 33.5 bits (73), Expect = 0.047 Identities = 17/60 (28%), Positives = 19/60 (31%) Frame = +1 Query: 583 PSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPP 762 PS PP +P P PLP P P P PP P + P P Sbjct: 425 PSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAP 484 Score = 32.7 bits (71), Expect = 0.083 Identities = 24/88 (27%), Positives = 25/88 (28%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXX 784 PP G PP P PP P P P P A P PP +P Sbjct: 404 PPLGNASRTSTPPVPTPPSLPPSAPPSLP--PSAPPSLPMGAP--AAPPLPPSAPIAPPL 459 Query: 785 XXAPPPPXPGXXXXKXPPXXPXPXXPXP 868 P P PP P P P Sbjct: 460 PAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 29.9 bits (64), Expect = 0.58 Identities = 24/80 (30%), Positives = 25/80 (31%) Frame = +2 Query: 656 SXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXXXXKXP 835 S PPP P P PL P + P PPP S PPP P Sbjct: 334 SSLPPPPPPPRSNAAGSIPLPPQGR---SAP--PPPPPRSAPSTGRQPPPLSSSRAVSNP 388 Query: 836 PXXPXPXXPXPGXXXXXXPP 895 P P PG PP Sbjct: 389 ---PAPPPAIPGRSAPALPP 405 Score = 29.5 bits (63), Expect = 0.77 Identities = 26/99 (26%), Positives = 26/99 (26%), Gaps = 11/99 (11%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXX-----PPPXXXSPXXXXAPPP 802 PP PP P P PL P A PPP PP Sbjct: 267 PPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPP 326 Query: 803 PXPGXXXXKXPPXXPXP------XXPXPGXXXXXXPPPP 901 G PP P P P P PPPP Sbjct: 327 IGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPP 365 Score = 27.9 bits (59), Expect = 2.4 Identities = 23/95 (24%), Positives = 27/95 (28%) Frame = +1 Query: 553 PLTSITKIXAPSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGX 732 P++ I + S PPP + P PPP P P G Sbjct: 277 PVSMNPAINSTSKPPLPPPSSRVSAAALAANKKRPPPPPP-----PSRRNRGKPPIGNGS 331 Query: 733 XXGXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXPP 837 PPP G P PP P PP Sbjct: 332 SNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPP 366 Score = 26.6 bits (56), Expect = 5.4 Identities = 22/86 (25%), Positives = 23/86 (26%) Frame = +2 Query: 668 PPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXXP 847 PP PTP P P P P P APP P PP P Sbjct: 415 PPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAP 474 Query: 848 XPXXPXPGXXXXXXPPPPXXTNXFPL 925 P PP P P+ Sbjct: 475 AP------------PPAPAPAPAAPV 488 Score = 26.6 bits (56), Expect = 5.4 Identities = 19/70 (27%), Positives = 21/70 (30%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXX 784 PP+ P PP PP P P P P A P P P +P Sbjct: 432 PPSAPPSLPMGAPAAPP--LPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAPVA 489 Query: 785 XXAPPPPXPG 814 A P G Sbjct: 490 SIAELPQQDG 499 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 37.5 bits (83), Expect = 0.003 Identities = 24/83 (28%), Positives = 25/83 (30%) Frame = +2 Query: 650 PPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXXXXK 829 PPS PP P P +P P P P P PPP P K Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPA-APVK 182 Query: 830 XPPXXPXPXXPXPGXXXXXXPPP 898 PP P P PPP Sbjct: 183 SPPSAPSLPSAVPPMPPKVPPPP 205 Score = 35.9 bits (79), Expect = 0.009 Identities = 30/109 (27%), Positives = 31/109 (28%) Frame = +2 Query: 656 SXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXXXXKXP 835 S PP P P P S L P P PPP S + PP P Sbjct: 121 SAAPPSAPAP---PTPQSELRPPTSAPPR-PSIPPPSPASAPPIPSKAPPIPSSLPPPAQ 176 Query: 836 PXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFXXPP 982 P P P PP P PL P V P PP Sbjct: 177 PAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAP-VANTSSRPSSFAPP 224 Score = 31.1 bits (67), Expect = 0.25 Identities = 39/167 (23%), Positives = 47/167 (28%), Gaps = 3/167 (1%) Frame = +2 Query: 440 LSTESXDNAXKEHVSKRPAXGHEP*KGRVAGVFXXXXXXXRASQKSXPHLXXGXXPPTGL 619 L T S + E PA G G AG ++S + P PPT Sbjct: 82 LPTSSNNTQQAEERPSMPALG-----GLFAGGMPKLRHIGKSSASAAP--PSAPAPPTPQ 134 Query: 620 *XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPP 799 + P PPP P P +P P A P P S + Sbjct: 135 SELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAV 194 Query: 800 PPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPP---PPXXTNXFPLGP 931 PP P PP P PP P T+ P P Sbjct: 195 PPMP--PKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKFP 239 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 35.1 bits (77), Expect = 0.016 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +2 Query: 746 PXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPP 901 P PPP P AP P P PP P P PG PPPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPP----PPPPPPGVAGAGPPPPP 779 Score = 34.3 bits (75), Expect = 0.027 Identities = 18/54 (33%), Positives = 21/54 (38%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPP 762 PPP + +P P P+P PP P P PP P G PPP Sbjct: 733 PPPPPAVIVPTPAP--APIPVPP----PAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 33.9 bits (74), Expect = 0.036 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = +2 Query: 647 KPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXP 811 K P PP P P P P+ P P PPP + PPPP P Sbjct: 730 KSPPPPPPAVIVPTPAPAPI-PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 32.7 bits (71), Expect = 0.083 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +1 Query: 649 TPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXFPXXGXGPPPP 804 +P P PP P P P P G PPP G PPPP Sbjct: 731 SPPPPPPAVIVPTPAPAPI--PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 32.7 bits (71), Expect = 0.083 Identities = 19/58 (32%), Positives = 21/58 (36%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXP 811 PP P P P P P P P +P+ P PPP PPPP P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPP-APIM-------GGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 32.7 bits (71), Expect = 0.083 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +1 Query: 628 PXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXFPXXGXG 792 P P P P P P P P PP P + PPP P G Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAG 788 Score = 31.9 bits (69), Expect = 0.14 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +2 Query: 791 APPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXP 937 +PPPP P P P P P P PPPP GP P Sbjct: 731 SPPPPPPA-VIVPTPAPAPIP-VPPPAPIMGGPPPPPPPPGVAGAGPPP 777 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 31.9 bits (69), Expect = 0.14 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = +2 Query: 755 PP--PXXXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLG 928 PP P +P AP PP P P P P P PPPP + P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSA------PPPPLPASSAPSV 1743 Query: 929 PXP 937 P P Sbjct: 1744 PNP 1746 Score = 31.9 bits (69), Expect = 0.14 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = +2 Query: 638 PPXKPPSXXPPPX--PTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXP 811 PP +P S PP PTP P P P P PP P APPPP P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPP-----------PPSAPPMPAGP--PSAPPPPLP 1736 Query: 812 GXXXXKXP 835 P Sbjct: 1737 ASSAPSVP 1744 Score = 27.5 bits (58), Expect = 3.1 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +1 Query: 583 PSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXP 711 P PP + +P PP P+P PP P P P Sbjct: 1700 PQMSAPTPPPPPMSVPP-PPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 26.6 bits (56), Expect = 5.4 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +2 Query: 746 PXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXXP---XPXXPXPG 871 P PPP P APP P PP P P P PG Sbjct: 1705 PTPPPPPMSVPPPPSAPP--MPAGPPSAPPPPLPASSAPSVPNPG 1747 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 29.9 bits (64), Expect = 0.58 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 833 PPXXPXPXXPXPGXXXXXXPPPP 901 PP P P P PG PPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPP 27 Score = 29.1 bits (62), Expect = 1.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 776 PXXXXAPPPPXPGXXXXKXPPXXPXP 853 P PPPP PG PP P P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 27.5 bits (58), Expect = 3.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*P 697 PP PP PP P P P P Sbjct: 11 PPPPPPGFEPPSQPPPPPPP 30 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 746 PXXPPPXXXSPXXXXAPPPPXPG 814 P PPP P PPPP PG Sbjct: 10 PPPPPPPGFEPPSQP-PPPPPPG 31 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 28.7 bits (61), Expect = 1.3 Identities = 21/91 (23%), Positives = 24/91 (26%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGX 817 P P+ P P+ P P +P P PPP A P Sbjct: 156 PTVSAPNSMVSPPPSFQP-PSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYS 214 Query: 818 XXXKXPPXXPXPXXPXPGXXXXXXPPPPXXT 910 P P P PPPP T Sbjct: 215 SGRAVSPEIPPTYTPKQADPLPAPPPPPPPT 245 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 28.7 bits (61), Expect = 1.3 Identities = 25/81 (30%), Positives = 26/81 (32%) Frame = -3 Query: 845 GXXGGXXGXXXQXXGGGGPXPXXGXXXXGGG*XEXPXXXPXGEKGGXXFXVXGXGXXKGG 666 G GG G G GGP P G GG GG G G +GG Sbjct: 184 GHNGGGFGGFG--GGSGGPPPGPGGFGGFGG-----FGGEGHHHGGHGGFGGGPGGFEGG 236 Query: 665 GXGRGVXXGGXXGXFIVLSGG 603 G G GG G GG Sbjct: 237 PGGFGGGPGGFGGGLGGFGGG 257 Score = 27.1 bits (57), Expect = 4.1 Identities = 22/73 (30%), Positives = 23/73 (31%) Frame = -3 Query: 845 GXXGGXXGXXXQXXGGGGPXPXXGXXXXGGG*XEXPXXXPXGEKGGXXFXVXGXGXXKGG 666 G GG G GG G G G P G +GG G G GG Sbjct: 191 GGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGG 250 Query: 665 GXGRGVXXGGXXG 627 G G GG G Sbjct: 251 LGGFGGGPGGFGG 263 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 27.9 bits (59), Expect = 2.4 Identities = 29/111 (26%), Positives = 31/111 (27%), Gaps = 3/111 (2%) Frame = +1 Query: 583 PSXXXXPPP---DRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXX 753 P PPP + +P P P PP PP P G Sbjct: 242 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP--PMHHEPGEHMP 299 Query: 754 PPPXXXFPXXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXK 906 PPP P PPPP PP P PPPP K Sbjct: 300 PPPMHHEPGEHM-PPPPMHHEPGEHMPP------PPMHHEPGEHMPPPPFK 343 Score = 26.6 bits (56), Expect = 5.4 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 3/92 (3%) Frame = +1 Query: 664 PPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXPPXX 843 PPP P PP G PPP P PPPP PP Sbjct: 234 PPPPMHHEPGEHMPPPPMH---HEPGEHMPPPPMHHEPGEHM-PPPPMHHEPGEHMPP-- 287 Query: 844 PXTXXPFXXXXXXFXPPPP---XKXKXFPPXP 930 P PPPP + PP P Sbjct: 288 ----PPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 27.5 bits (58), Expect = 3.1 Identities = 16/53 (30%), Positives = 20/53 (37%) Frame = +1 Query: 499 RPRTVERPRCWRFSIGSXPLTSITKIXAPSXXXXPPPDRTIXIPXXPPXXTPL 657 +PR RP + S LTS PS PPP R + P P+ Sbjct: 358 KPRLPPRPSHTLSELSSPALTSENLSSKPSPLFPPPPPRVKSLATNKPVSMPV 410 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 25.8 bits (54), Expect = 9.5 Identities = 19/73 (26%), Positives = 22/73 (30%), Gaps = 4/73 (5%) Frame = +2 Query: 641 PXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXP----PPXXXSPXXXXAPPPPX 808 P P + PP P P P +P P P PP +P P Sbjct: 492 PLPPTTFAPPGVPLP---PIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAVPAM 548 Query: 809 PGXXXXKXPPXXP 847 PG PP P Sbjct: 549 PGIPGATAPPGAP 561 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,917,000 Number of Sequences: 5004 Number of extensions: 54238 Number of successful extensions: 399 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 196 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 515273988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -