BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E06 (997 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 98 1e-20 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 72 6e-13 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 72 8e-13 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 8e-13 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 8e-12 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 8e-12 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 3e-10 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 4e-10 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 62 9e-10 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 60 4e-09 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 49 7e-06 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 48 2e-05 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 48 2e-05 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 47 3e-05 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 47 3e-05 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 45 8e-05 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 45 1e-04 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 45 1e-04 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 45 1e-04 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 45 1e-04 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 45 1e-04 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 45 1e-04 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 45 1e-04 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 45 1e-04 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 45 1e-04 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 45 1e-04 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 45 1e-04 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 45 1e-04 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 45 1e-04 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 45 1e-04 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 45 1e-04 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 45 1e-04 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 45 1e-04 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 45 1e-04 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 45 1e-04 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 45 1e-04 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 45 1e-04 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 45 1e-04 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 45 1e-04 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 45 1e-04 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 45 1e-04 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 45 1e-04 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 45 1e-04 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 45 1e-04 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 45 1e-04 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 45 1e-04 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 45 1e-04 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 45 1e-04 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 45 1e-04 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 45 1e-04 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 45 1e-04 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 45 1e-04 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 45 1e-04 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 45 1e-04 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 45 1e-04 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 45 1e-04 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 45 1e-04 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 45 1e-04 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 45 1e-04 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 45 1e-04 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 45 1e-04 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 45 1e-04 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 45 1e-04 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 45 1e-04 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 45 1e-04 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 45 1e-04 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 45 1e-04 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 1e-04 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 45 1e-04 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 45 1e-04 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 45 1e-04 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 45 1e-04 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 45 1e-04 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 45 1e-04 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 45 1e-04 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 45 1e-04 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 45 1e-04 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 45 1e-04 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 45 1e-04 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 45 1e-04 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 45 1e-04 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 45 1e-04 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 45 1e-04 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 45 1e-04 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 1e-04 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 45 1e-04 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 45 1e-04 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 45 1e-04 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 45 1e-04 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 45 1e-04 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 45 1e-04 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 45 1e-04 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 45 1e-04 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 45 1e-04 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 45 1e-04 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 45 1e-04 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 45 1e-04 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 45 1e-04 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 45 1e-04 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 45 1e-04 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 45 1e-04 SB_16696| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 45 1e-04 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 45 1e-04 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 45 1e-04 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 45 1e-04 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14983| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14379| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14356| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_14291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_13233| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12576| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12547| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12526| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_12145| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 97.9 bits (233), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 300 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 431 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 97.9 bits (233), Expect = 1e-20 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 300 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 431 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 72.1 bits (169), Expect = 6e-13 Identities = 34/48 (70%), Positives = 38/48 (79%) Frame = +1 Query: 439 VIHRIXG*RXKRTCEQKASXRPRTVERPRCWRFSIGSXPLTSITKIXA 582 +I+ G +RTCEQKAS RP TV+RPRCWRFSIGS PLTSITKI A Sbjct: 82 LIYLNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDA 129 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 71.7 bits (168), Expect = 8e-13 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 469 KRTCEQKASXRPRTVERPRCWRFSIGSXPLTSITKIXA 582 +RTCEQKAS RP TV+RPRCWRFSIGS PLTSITKI A Sbjct: 121 ERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSITKIDA 158 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 71.7 bits (168), Expect = 8e-13 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -2 Query: 567 DARQGGGAYGKTPATRPFYGSWPXAGLLLTCSF 469 D QGGGAYGKTPATRPFYGSWP AGLLLTCSF Sbjct: 19 DVGQGGGAYGKTPATRPFYGSWPFAGLLLTCSF 51 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 470 FXRYPXILWITVLPPLSELIPLAAAERP 387 F RYP ILWITVLPPLSELIPLAAAERP Sbjct: 51 FLRYPLILWITVLPPLSELIPLAAAERP 78 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 69.3 bits (162), Expect = 4e-12 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 561 RQGGGAYGKTPATRPFYGSWPXAGLLLTCSF 469 ++GGGAYGKTPATRPFYGSWP AGLLLTCSF Sbjct: 757 KRGGGAYGKTPATRPFYGSWPFAGLLLTCSF 787 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 470 FXRYPXILWITVLPPLSELIPLAAAERP 387 F RYP ILWITVLPPLSELIPLAAAERP Sbjct: 787 FLRYPLILWITVLPPLSELIPLAAAERP 814 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 68.9 bits (161), Expect = 6e-12 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 558 QGGGAYGKTPATRPFYGSWPXAGLLLTCSF 469 +GGGAYGKTPATRPFYGSWP AGLLLTCSF Sbjct: 405 EGGGAYGKTPATRPFYGSWPFAGLLLTCSF 434 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 470 FXRYPXILWITVLPPLSELIPLAAAERP 387 F RYP ILWITVLPPLSELIPLAAAERP Sbjct: 434 FLRYPLILWITVLPPLSELIPLAAAERP 461 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 68.5 bits (160), Expect = 8e-12 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 562 SSGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 +SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 57 NSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 92 Score = 32.7 bits (71), Expect = 0.48 Identities = 22/52 (42%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = -2 Query: 567 DARQGGGAYGKTPATRPFYG----SWPXAGLLLTCSFXALSXDSVDNRITAF 424 D GG + K + F WP A + F ALS DSVDNRITAF Sbjct: 55 DLNSGGRSLWKNASNAAFLRFLAFCWPFAHMF----FPALSPDSVDNRITAF 102 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 68.5 bits (160), Expect = 8e-12 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 558 QGGGAYGKTPATRPFYGSWPXAGLLLTCSF 469 +GGGAYGKTPATRPFYGSWP AGLLLTCSF Sbjct: 554 KGGGAYGKTPATRPFYGSWPFAGLLLTCSF 583 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 470 FXRYPXILWITVLPPLSELIPLAAAERP 387 F RYP ILWITVLPPLSELIPLAAAERP Sbjct: 583 FLRYPLILWITVLPPLSELIPLAAAERP 610 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 555 GGGAYGKTPATRPFYGSWPXAGLLLTCSF 469 GGGAYGKTPATRPFYGSWP AGLLLTCSF Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSF 29 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 470 FXRYPXILWITVLPPLSELIPLAAAERP 387 F RYP ILWITVLPPLSELIPLAAAERP Sbjct: 29 FLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 555 GGGAYGKTPATRPFYGSWPXAGLLLTCSF 469 GGGAYGKTPATRPFYGSWP AGLLLTCSF Sbjct: 24 GGGAYGKTPATRPFYGSWPFAGLLLTCSF 52 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 470 FXRYPXILWITVLPPLSELIPLAAAERP 387 F RYP ILWITVLPPLSELIPLAAAERP Sbjct: 52 FLRYPLILWITVLPPLSELIPLAAAERP 79 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 68.1 bits (159), Expect = 1e-11 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -2 Query: 555 GGGAYGKTPATRPFYGSWPXAGLLLTCSF 469 GGGAYGKTPATRPFYGSWP AGLLLTCSF Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSF 29 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -3 Query: 470 FXRYPXILWITVLPPLSELIPLAAAERP 387 F RYP ILWITVLPPLSELIPLAAAERP Sbjct: 29 FLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 66.9 bits (156), Expect = 2e-11 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 +GG SLWKNASNAAFLRF+A CWPFAHMFF + P Sbjct: 92 AGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSP 126 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 114 WPFAHMF----FPALSPDSVDNRITAF 136 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 66.5 bits (155), Expect = 3e-11 Identities = 41/132 (31%), Positives = 44/132 (33%), Gaps = 6/132 (4%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXX-----PPPXX 769 PP Y PP PP P P P P P +P +P P PPP Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Query: 770 XSPXXXXAPPP-PXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVX 946 P PPP P P PP P P P P PPPP N P P Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Query: 947 XIXXNPXFXXPP 982 NP + PP Sbjct: 215 PNAPNPPYPPPP 226 Score = 58.4 bits (135), Expect = 8e-09 Identities = 41/129 (31%), Positives = 46/129 (35%) Frame = +2 Query: 596 GXXPPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXS 775 G PPT + PP PP P P P P P P +P +P P PPP Sbjct: 81 GGHPPTN---FSPNPPYPPPPYPPYPPPPPYPPP--PNPPYPPPPN---APYPPPPNPPY 132 Query: 776 PXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIX 955 P AP PP P P P P P P P PP +P P P Sbjct: 133 PPPPNAPYPPSPN------APYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP----P 182 Query: 956 XNPXFXXPP 982 NP + PP Sbjct: 183 PNPPYPPPP 191 Score = 56.0 bits (129), Expect = 4e-08 Identities = 38/114 (33%), Positives = 41/114 (35%) Frame = +2 Query: 641 PXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXX 820 P P + PPP P P PL+P P PPP P PPPP P Sbjct: 141 PPSPNAPYPPPPNPPYP-----PPLYP------PPPNPPPPNAPYPPPPY-PPPPNPPYP 188 Query: 821 XXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFXXPP 982 PP P P P P PPPP N P P P NP + PP Sbjct: 189 PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNP-PYPPPPNA----PNPPYPPPP 237 Score = 55.6 bits (128), Expect = 6e-08 Identities = 38/135 (28%), Positives = 44/135 (32%), Gaps = 3/135 (2%) Frame = +1 Query: 583 PSXXXXPPPDRTIXIPXXPPXXTPLPXPP--PFXXPXPXTXXXXPPFSPXGXXXGXSXXP 756 P PPP P PP P P PP P+ P P PP +P P Sbjct: 97 PPYPPYPPPP-----PYPPPPNPPYPPPPNAPY-PPPPNPPYPPPPNAPYPPSPNAPYPP 150 Query: 757 PPXXXFPXXGXGPPPPXXWXXXP-QXPPXXPXTXXPFXXXXXXFXPPPPXKXKXFPPXPX 933 PP +P PPP P PP P P+ PPPP PP P Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Query: 934 XLXXXDXXKPXFXXP 978 + P + P Sbjct: 211 YPPPPNAPNPPYPPP 225 Score = 54.8 bits (126), Expect = 1e-07 Identities = 31/88 (35%), Positives = 32/88 (36%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGX 817 PP PP PPP P P P P P P PPP +P P PP P Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPN- 216 Query: 818 XXXKXPPXXPXPXXPXPGXXXXXXPPPP 901 PP P P P P PPPP Sbjct: 217 --APNPPYPPPPNAPNP-----PYPPPP 237 Score = 52.8 bits (121), Expect = 4e-07 Identities = 34/117 (29%), Positives = 39/117 (33%), Gaps = 1/117 (0%) Frame = +1 Query: 583 PSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPP 762 P+ PPP+ P PP P P P P PP+ P PPP Sbjct: 112 PNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP-LYPPPPNPPPP 170 Query: 763 XXXFPXXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXKXK-XFPPXP 930 +P PPPP P PP P P PPPP +PP P Sbjct: 171 NAPYPPPPY-PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 52.4 bits (120), Expect = 6e-07 Identities = 37/110 (33%), Positives = 39/110 (35%), Gaps = 10/110 (9%) Frame = +2 Query: 638 PPXKPPSXXP-PPXPT----PXP*PXXXSPLFPXXXXXXAX--PXXPPPXXXSPXXXXAP 796 PP PP P PP P P P P PL+P P PPP P P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Query: 797 PPPXPGXXXXKXP-PXXPXP-XXPXPGXXXXXXPPPPXXTN-XFPLGPXP 937 PP P P P P P P P PPPP N +P P P Sbjct: 190 PPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 52.0 bits (119), Expect = 7e-07 Identities = 33/118 (27%), Positives = 40/118 (33%), Gaps = 8/118 (6%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPF-------XXPXPXTXXXXPPFSPXGXXXGXSXXPP 759 PP + + P PP P P PPP+ P P PP P P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Query: 760 PXXXFPXXGXGPPPPXXWXXXPQ-XPPXXPXTXXPFXXXXXXFXPPPPXKXKXFPPXP 930 P +P P PP + P PP P P+ PPPP +PP P Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP--NPPYPPPP 199 Score = 52.0 bits (119), Expect = 7e-07 Identities = 34/116 (29%), Positives = 40/116 (34%) Frame = +1 Query: 583 PSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPP 762 P+ P P+ P PP PL PPP P P PP+ P PPP Sbjct: 136 PNAPYPPSPNAPYPPPPNPPYPPPLYPPPP-NPPPPNAPYPPPPYPP---PPNPPYPPPP 191 Query: 763 XXXFPXXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXKXKXFPPXP 930 +P P PP P PP P P + PPP +PP P Sbjct: 192 NPPYPPPPNAPNPP------PPNPPYPPPPNAP----NPPYPPPPNAPNPPYPPPP 237 Score = 37.5 bits (83), Expect = 0.017 Identities = 25/80 (31%), Positives = 27/80 (33%), Gaps = 6/80 (7%) Frame = +1 Query: 583 PSXXXXPPPDRTIXIPXXPPXXTP--LPXPPPFXXPXPXTXXXX-PPFSPXGXXXGXSXX 753 P PPP+ P PP P P PPP P P PP+ P Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Query: 754 PPPXXXFP---XXGXGPPPP 804 PPP F G GP P Sbjct: 235 PPPNPQFAIALCLGHGPRSP 254 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 63.3 bits (147), Expect = 3e-10 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 559 SGGXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 SGG SLWKNASNAAFLRF+A WPFAHMFF + P Sbjct: 16 SGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSP 50 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS D VDNRITAF Sbjct: 38 WPFAHMF----FRALSPDCVDNRITAF 60 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 62.9 bits (146), Expect = 4e-10 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 553 GXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 G SLWKNASNAAFLRF+A CWPFAHMF+ + P Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSP 34 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + + ALS DSVDNRITAF Sbjct: 22 WPFAHMF----YPALSPDSVDNRITAF 44 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 61.7 bits (143), Expect = 9e-10 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 3/76 (3%) Frame = -1 Query: 553 GXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP---*FCG*PYYRL*VS*YRSPQPNDRA 383 G SLWKNASNAAFLRF+A CWPF HMF + P C + R ++ RS + ++R Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIA--RSSRMHERR 59 Query: 382 QRVSERGSGRAPNTQT 335 + VSE R+ QT Sbjct: 60 ESVSEEAEERSIRKQT 75 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 59.7 bits (138), Expect = 4e-09 Identities = 31/86 (36%), Positives = 31/86 (36%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGX 817 PP PP PPP P P P P SP P PPP P PPPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSP---------PPPPQPPPPPPPPPPPPPPPPPPPPP 415 Query: 818 XXXKXPPXXPXPXXPXPGXXXXXXPP 895 PP P P P P PP Sbjct: 416 PPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 49.6 bits (113), Expect = 4e-06 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = +2 Query: 746 PXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPL 925 P PPP P PPPP P PP P P P P PPPP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 926 GPXP 937 P P Sbjct: 426 PPPP 429 Score = 48.4 bits (110), Expect = 9e-06 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = +2 Query: 755 PPPXXXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPX 934 PPP P +PPPP P PP P P P P PPPP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 935 P 937 P Sbjct: 425 P 425 Score = 48.4 bits (110), Expect = 9e-06 Identities = 24/73 (32%), Positives = 25/73 (34%) Frame = +2 Query: 746 PXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPL 925 P PPP SP PPPP P PP P P P P PPP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 926 GPXPXVXXIXXNP 964 P P + P Sbjct: 428 PPPPPALRLACAP 440 Score = 46.8 bits (106), Expect = 3e-05 Identities = 30/95 (31%), Positives = 31/95 (32%) Frame = +1 Query: 553 PLTSITKIXAPSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGX 732 P +T I A PPP P PP P P PPP P P PP P Sbjct: 350 PRAIVTDISAGINMSPPPPPPP---PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Query: 733 XXGXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXPP 837 PPP P PPPP PP Sbjct: 407 PPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 46.0 bits (104), Expect = 5e-05 Identities = 30/96 (31%), Positives = 34/96 (35%) Frame = +1 Query: 559 TSITKIXAPSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXX 738 T +TK+ + D + I PP P P PPP P P PP SP Sbjct: 339 TYMTKVVSVVNPRAIVTDISAGINMSPPPPPPPPPPPPSPPPPP----PPPPPSPPPPPQ 394 Query: 739 GXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXPPXXP 846 PPP P PPPP P PP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 46.0 bits (104), Expect = 5e-05 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +2 Query: 746 PXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPL 925 P PPP P PPPP P P P P P P PPPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 926 GPXP 937 P P Sbjct: 425 PPPP 428 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +2 Query: 794 PPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFX 973 PPPP P PP P P P P PPPP P P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 974 XPP 982 PP Sbjct: 427 PPP 429 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = +2 Query: 791 APPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXF 970 +PPPP P PP P P P P PPPP P P P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Query: 971 XXPP 982 PP Sbjct: 424 PPPP 427 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +2 Query: 794 PPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFX 973 PPPP P PP P P P P PPPP P P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 974 XPP 982 PP Sbjct: 428 PPP 430 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 773 SPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXP 937 SP PPPP P PP P P P PPPP P P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.9 bits (84), Expect = 0.013 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +1 Query: 739 GXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXKXKXF 918 G + PPP P PPPP PP P P PPPP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Query: 919 PPXP 930 PP P Sbjct: 420 PPPP 423 Score = 37.5 bits (83), Expect = 0.017 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +2 Query: 794 PPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFX 973 PPPP P PP P P P PPPP P P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 974 XPP 982 PP Sbjct: 430 PPP 432 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +2 Query: 794 PPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFX 973 PPPP P PP P P P PPPP P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 974 XPP 982 PP Sbjct: 426 PPP 428 Score = 36.7 bits (81), Expect = 0.029 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +1 Query: 745 SXXPPPXXXFPXXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXKXKXFPP 924 S PPP P PPPP P PP P P PPPP PP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPP-PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Query: 925 XP 930 P Sbjct: 423 PP 424 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 54.8 bits (126), Expect = 1e-07 Identities = 23/33 (69%), Positives = 25/33 (75%) Frame = -1 Query: 553 GXSLWKNASNAAFLRFVAXCWPFAHMFFSCVIP 455 G KNASNAAFLRF+A CWPFAHMFF + P Sbjct: 18 GAEPMKNASNAAFLRFLAFCWPFAHMFFPALSP 50 Score = 32.3 bits (70), Expect = 0.63 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -2 Query: 504 WPXAGLLLTCSFXALSXDSVDNRITAF 424 WP A + F ALS DSVDNRITAF Sbjct: 38 WPFAHMF----FPALSPDSVDNRITAF 60 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 52.0 bits (119), Expect = 7e-07 Identities = 40/98 (40%), Positives = 45/98 (45%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLTQRR*YGYPQNXGITXEKNM*AKGQXKATNRR 515 +C G +PLPRSLTR ARSF CGER LT G M + T Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLTN----------GAEISWKMPGR---YLTGSE 106 Query: 516 KAALLAFFHRLXPPDEHHKNXRPISXXVXXPRQDYKXT 629 +AA FFHRL P K+ IS RQDYK T Sbjct: 107 RAAAKPFFHRLRPLTSITKSDAQISG--GETRQDYKDT 142 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 51.2 bits (117), Expect = 1e-06 Identities = 31/88 (35%), Positives = 33/88 (37%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGX 817 P PP PP P P P +PL P A PPP +P PPPP PG Sbjct: 910 PSASPPGGSVPPPPPP---PGGNAPLPPPPPGGSAPSQPPPPGGNAP-----PPPPPPG- 960 Query: 818 XXXKXPPXXPXPXXPXPGXXXXXXPPPP 901 P P P PG PPPP Sbjct: 961 GSAPPPGGGAPPLPPPPGGSAPPPPPPP 988 Score = 48.4 bits (110), Expect = 9e-06 Identities = 29/80 (36%), Positives = 31/80 (38%), Gaps = 5/80 (6%) Frame = +2 Query: 638 PPXKPPSXXPPPX---PTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXS-PXXXXAPP-P 802 P P PPP P P P P +P P A P PPP + P APP P Sbjct: 915 PGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLP 974 Query: 803 PXPGXXXXKXPPXXPXPXXP 862 P PG PP P P P Sbjct: 975 PPPGGSAPPPPPPPPPPPPP 994 Score = 36.3 bits (80), Expect = 0.039 Identities = 23/68 (33%), Positives = 24/68 (35%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXFPX 780 PPP + PP P PPP P PP P G S PPP P Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPP---PPGGSAPPPPPPPPP- 990 Query: 781 XGXGPPPP 804 PPPP Sbjct: 991 ----PPPP 994 Score = 35.5 bits (78), Expect = 0.068 Identities = 23/69 (33%), Positives = 24/69 (34%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXX 784 PP G Q PP PPP P P +P P A P PPP Sbjct: 936 PPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPP------- 988 Query: 785 XXAPPPPXP 811 PPPP P Sbjct: 989 ---PPPPPP 994 Score = 34.7 bits (76), Expect = 0.12 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +2 Query: 761 PXXXSPXXXXAPPPPXPG--XXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLG 928 P P PPPP PG PP P P P PPPP + P G Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPG 967 Score = 34.3 bits (75), Expect = 0.16 Identities = 31/102 (30%), Positives = 35/102 (34%), Gaps = 15/102 (14%) Frame = +1 Query: 544 GSXPLTSITKIXAPSXXXXP---PPDRTIXIPXXPPXXT-PLPXPPP-----FXXPXPXT 696 GS P + + P P PP ++ P PP PLP PPP P P Sbjct: 891 GSFPRRNESPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGG 950 Query: 697 XXXXPPFSPXGXXX----GXSXXPPPXXXF--PXXGXGPPPP 804 PP P G G PPP P PPPP Sbjct: 951 NAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 33.9 bits (74), Expect = 0.21 Identities = 24/79 (30%), Positives = 25/79 (31%) Frame = +2 Query: 746 PXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPL 925 P PPP +P PPP PG PP P P PPP PL Sbjct: 921 PPPPPPGGNAPL-----PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAP--PL 973 Query: 926 GPXPXVXXIXXNPXFXXPP 982 P P P PP Sbjct: 974 PPPPGGSAPPPPPPPPPPP 992 Score = 30.7 bits (66), Expect = 1.9 Identities = 29/97 (29%), Positives = 29/97 (29%) Frame = +1 Query: 640 PXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXFPXXGXGPPPPXXWXX 819 P TP P P P PP P G PPP P PPPP Sbjct: 900 PSQTPGGSESPSASP-PGGSVPPPPPPPGGN--APLPPPPPGGSAPSQ---PPPPGG--- 950 Query: 820 XPQXPPXXPXTXXPFXXXXXXFXPPPPXKXKXFPPXP 930 PP P P PPPP PP P Sbjct: 951 NAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPP 987 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 48.8 bits (111), Expect = 7e-06 Identities = 34/115 (29%), Positives = 36/115 (31%), Gaps = 3/115 (2%) Frame = +2 Query: 596 GXXPPTGL*XYQXXPPXKPPSXXPPPX---PTPXP*PXXXSPLFPXXXXXXAXPXXPPPX 766 G PP PP + + PPP P P P S P A P Sbjct: 294 GAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGM 353 Query: 767 XXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGP 931 P APPPP P PP P P P PPPP P GP Sbjct: 354 APPPVGGAAPPPPPPPPVGGPPPPPPPIEGRP-PSSLGNPPPPPPPGRGAPPPGP 407 Score = 46.0 bits (104), Expect = 5e-05 Identities = 31/104 (29%), Positives = 33/104 (31%), Gaps = 4/104 (3%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXS----PXXXXAPPPP 805 PP + + PP P P P S P P PPP S P APPPP Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Query: 806 XPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXP 937 G P P P P PPP LG P Sbjct: 350 SMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPP 393 Score = 44.4 bits (100), Expect = 1e-04 Identities = 27/84 (32%), Positives = 28/84 (33%), Gaps = 2/84 (2%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXFPX 780 PPP R+ P PP P PP P PP P G PPP P Sbjct: 329 PPPSRSSQRP--PPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Query: 781 XGXG--PPPPXXWXXXPQXPPXXP 846 G PPPP P P P Sbjct: 387 SSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 38.7 bits (86), Expect = 0.007 Identities = 29/103 (28%), Positives = 31/103 (30%), Gaps = 4/103 (3%) Frame = +1 Query: 628 PXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXF----PXXGXGP 795 P PP P PP P P P P G + PPP P G Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAP-PPPPARMGTAPPPPPPSRSSQRPPPPSRGA 345 Query: 796 PPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXKXKXFPP 924 PPP P PP P PPPP + PP Sbjct: 346 PPPPSMGMAP--PPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Score = 38.7 bits (86), Expect = 0.007 Identities = 27/84 (32%), Positives = 29/84 (34%) Frame = +1 Query: 553 PLTSITKIXAPSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGX 732 P S + PS PPP + P P P PPP P P PP G Sbjct: 331 PSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPP------PPPPIEGR 384 Query: 733 XXGXSXXPPPXXXFPXXGXGPPPP 804 PPP P G G PPP Sbjct: 385 PPSSLGNPPPP---PPPGRGAPPP 405 Score = 36.7 bits (81), Expect = 0.029 Identities = 28/111 (25%), Positives = 28/111 (25%), Gaps = 1/111 (0%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXF-P 777 PPP P P P P P P P P PPP P Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP 347 Query: 778 XXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXKXKXFPPXP 930 G PP P PP P P PP PP P Sbjct: 348 PPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 35.9 bits (79), Expect = 0.051 Identities = 28/101 (27%), Positives = 30/101 (29%), Gaps = 3/101 (2%) Frame = +2 Query: 560 RASQKSXPHLXXGXXPPTGL*XYQXXPPXKPPSXXPPPXPT---PXP*PXXXSPLFPXXX 730 R S P G PP P PPS PP P+ P +P P Sbjct: 311 RGSAPPPPPARMGTAPPPPPPSRSSQRPP-PPSRGAPPPPSMGMAPPPVGGAAPPPPPPP 369 Query: 731 XXXAXPXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXXPXP 853 P PPP P PPP P PP P Sbjct: 370 PVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 48.4 bits (110), Expect = 9e-06 Identities = 41/122 (33%), Positives = 43/122 (35%), Gaps = 9/122 (7%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPX-PTPX-P*PXXXSPLFPXXXXXXAXPXXPPPXXXSP 778 PP G + PP P PPP P P P P P P P PPP P Sbjct: 482 PPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPH--PRVPPPGAPHP 539 Query: 779 XXXX--APPP--PXPGXXXXKXPPXX-PXPXXPXPGXXXXXXPPP--PXXTNXFPLGPXP 937 AP P P PG + PP P P P PG PPP P P P P Sbjct: 540 RVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHP 599 Query: 938 XV 943 V Sbjct: 600 KV 601 Score = 47.6 bits (108), Expect = 2e-05 Identities = 39/117 (33%), Positives = 40/117 (34%), Gaps = 4/117 (3%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPX-PTPX-P*PXXXSPLFPXXXXXXAXPXXPPPXXXSP 778 PP G + PP P PPP P P P P P P P PPP P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH--PRVPPPGAPHP 489 Query: 779 XXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPP--PXXTNXFPLGPXPXV 943 PPP P PP P P P PG PPP P P P P V Sbjct: 490 R---VPPPGAPHQRVP--PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 541 Score = 47.6 bits (108), Expect = 2e-05 Identities = 34/100 (34%), Positives = 36/100 (36%), Gaps = 2/100 (2%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPX-PTPX-P*PXXXSPLFPXXXXXXAXPXXPPPXXXSP 778 PP G + PP P PPP P P P P P P + P PPP P Sbjct: 512 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGA--SHPRVPPPGAPHP 569 Query: 779 XXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPP 898 PPP P PP P P P PG PPP Sbjct: 570 R---VPPPGAPHPRVP--PPGTPHPRVPPPGAPHPKVPPP 604 Score = 47.2 bits (107), Expect = 2e-05 Identities = 37/120 (30%), Positives = 40/120 (33%), Gaps = 7/120 (5%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXX 784 PP G + PP P PPP P +P P PPP P Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRV 521 Query: 785 XX--APPP--PXPGXXXXKXPPXX-PXPXXPXPGXXXXXXPPP--PXXTNXFPLGPXPXV 943 AP P P PG + PP P P P PG PPP P P P P V Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRV 581 Score = 44.0 bits (99), Expect = 2e-04 Identities = 38/117 (32%), Positives = 39/117 (33%), Gaps = 4/117 (3%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPX-PTPX-P*PXXXSPLFPXXXXXXAXPXXPPPXXXSP 778 PP G + PP PP P P P P P FP P PPP P Sbjct: 402 PPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPH--PRVPPPGAPHP 459 Query: 779 XXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPP--PXXTNXFPLGPXPXV 943 PPP P PP P P P PG PPP P P P P V Sbjct: 460 R---VPPPGAPHPRVP--PPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRV 511 Score = 41.1 bits (92), Expect = 0.001 Identities = 32/112 (28%), Positives = 36/112 (32%), Gaps = 5/112 (4%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXX 784 PP G + PP P PPP + P +P P PPP P Sbjct: 532 PPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRV 591 Query: 785 XX--APPP--PXPGXXXXKXPPXXPX-PXXPXPGXXXXXXPPPPXXTNXFPL 925 AP P P PG + P P P PG PPP PL Sbjct: 592 PPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAPIQRVPL 643 Score = 40.3 bits (90), Expect = 0.002 Identities = 33/105 (31%), Positives = 34/105 (32%), Gaps = 7/105 (6%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPX-PTPX-P*PXXXSPLFPXXXXXXAXPXXPPPXXXSP 778 PP G + PP P PPP P P P P P P P PPP P Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPH--PRVPPPGAPHP 579 Query: 779 XXXXAPPP----PXPGXXXXKXPPXX-PXPXXPXPGXXXXXXPPP 898 P P PG K PP P P G PPP Sbjct: 580 RVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPP 624 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/98 (28%), Positives = 31/98 (31%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXX 784 P G + PP P PPP + +P P PPP P Sbjct: 392 PSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPR- 450 Query: 785 XXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPP 898 PPP P PP P P P PG PPP Sbjct: 451 --VPPPGAPHPRVP--PPGAPHPRVPPPGAPHPRVPPP 484 Score = 37.9 bits (84), Expect = 0.013 Identities = 23/91 (25%), Positives = 26/91 (28%) Frame = +2 Query: 626 YQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPP 805 Y P +PP+ PPP P P P P P + PP Sbjct: 304 YMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPP 363 Query: 806 XPGXXXXKXPPXXPXPXXPXPGXXXXXXPPP 898 G PP P P PG P P Sbjct: 364 PDGPYTRALPPGEPYARMPPPGATHPRVPSP 394 Score = 35.1 bits (77), Expect = 0.089 Identities = 31/114 (27%), Positives = 33/114 (28%), Gaps = 6/114 (5%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXX---PPFSPXGXXXGXSXXP-PPXX 768 PPP P PP P P PP P P P P G P P Sbjct: 522 PPPGAPH--PRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHP 579 Query: 769 XFPXXGXGPP--PPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXKXKXFPP 924 P G P PP PP P P+ PPP + PP Sbjct: 580 RVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPP 633 Score = 33.9 bits (74), Expect = 0.21 Identities = 27/100 (27%), Positives = 31/100 (31%), Gaps = 2/100 (2%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPX-PTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPX 781 PP G+ PP PP P P P +P +P P P P Sbjct: 317 PPPGMGPPPRIPP--PPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPPDGPYTRALPP 374 Query: 782 XXXAPPPPXPGXXXXKXP-PXXPXPXXPXPGXXXXXXPPP 898 P PG + P P P P PG PPP Sbjct: 375 GEPYARMPPPGATHPRVPSPGASHPRVPPPGAPHPRVPPP 414 Score = 33.9 bits (74), Expect = 0.21 Identities = 32/110 (29%), Positives = 32/110 (29%), Gaps = 2/110 (1%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXG--XSXXPPPXXXF 774 PPP P PP P P PP P P P P G PPP Sbjct: 432 PPPGAPH--PRFPPPGAPHPRVPPPGAPHPRVPPPGAP-HPRVPPPGAPHPRVPPPGAPH 488 Query: 775 PXXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXKXKXFPP 924 P PPP P PP P P PPP PP Sbjct: 489 PRV---PPPGAPHQRVP--PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 533 Score = 32.3 bits (70), Expect = 0.63 Identities = 30/103 (29%), Positives = 32/103 (31%), Gaps = 12/103 (11%) Frame = +2 Query: 626 YQXXPPXKPPSXXPPPX---PTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAP 796 YQ P PP P P PT P P P P PPP +P P Sbjct: 293 YQTAPGYPPPQYMPHPRMRPPTRIPPPGMGPP-----------PRIPPPPIRAPVDVYPP 341 Query: 797 --------PPPXPGXXXXK-XPPXXPXPXXPXPGXXXXXXPPP 898 PP PG + PP P PG PPP Sbjct: 342 RAPQGASQTPPYPGSHYSRVPPPDGPYTRALPPGEPYARMPPP 384 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXFPX 780 PPP P PP TP P PP P P P+ PP P Sbjct: 572 PPPGAPH--PRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPG--PP 627 Query: 781 XGXGPPP 801 PPP Sbjct: 628 YQRVPPP 634 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 47.6 bits (108), Expect = 2e-05 Identities = 34/118 (28%), Positives = 38/118 (32%), Gaps = 3/118 (2%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXP--PPXXXSPXXXXAPP-PPX 808 PP P PP P P +PL P P P PP +P A P PP Sbjct: 188 PPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPM 247 Query: 809 PGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFXXPP 982 P PP P P P P PP + P P P + NP P Sbjct: 248 P---ETPLPPATPNPFIPPASPNPSIPPAPPNPS--IPAPPNPSIPLAPPNPYIPPAP 300 Score = 44.4 bits (100), Expect = 1e-04 Identities = 35/135 (25%), Positives = 41/135 (30%), Gaps = 1/135 (0%) Frame = +2 Query: 581 PHLXXGXXPPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXP- 757 PH+ PP P P + PP P P P +P P + P P Sbjct: 227 PHIPPA--PPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPN 284 Query: 758 PPXXXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXP 937 P +P PP P P PP P P P PP P P P P Sbjct: 285 PSIPLAPPNPYIPPAP-PNLFIPSAPPNPHIPPAP-PNPYIPTAPPNPSIP---PAPPNP 339 Query: 938 XVXXIXXNPXFXXPP 982 + NP P Sbjct: 340 SIPPAPPNPSIPPAP 354 Score = 43.2 bits (97), Expect = 3e-04 Identities = 36/128 (28%), Positives = 39/128 (30%), Gaps = 2/128 (1%) Frame = +1 Query: 553 PLTSITKIXAPSXXXXPPPDRTIXIPXXP--PXXTPLPXPPPFXXPXPXTXXXXPPFSPX 726 P+T T + PP TI P P P P+P PP P P T PP SP Sbjct: 163 PVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPP-TPPMPET--PLPPGSPH 219 Query: 727 GXXXGXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPPXK 906 PP P P P PP P P P PP Sbjct: 220 IPPAPLHPHIPPAPPNPSKAIATPNPP--MPETPLPPATPNPFIPPASPNPSIPPAPPNP 277 Query: 907 XKXFPPXP 930 PP P Sbjct: 278 SIPAPPNP 285 Score = 37.5 bits (83), Expect = 0.017 Identities = 23/81 (28%), Positives = 25/81 (30%), Gaps = 2/81 (2%) Frame = +2 Query: 746 PXXPPPXXXSPXXXXAPPPPX--PGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXF 919 P PP +P PP P P PP P P P P PP P + Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLP-PGSPHIPPAPLHPHIP 230 Query: 920 PLGPXPXVXXIXXNPXFXXPP 982 P P P NP P Sbjct: 231 PAPPNPSKAIATPNPPMPETP 251 Score = 35.5 bits (78), Expect = 0.068 Identities = 26/92 (28%), Positives = 29/92 (31%), Gaps = 7/92 (7%) Frame = +2 Query: 641 PXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXP-----PPXXXSPXXXXAPPPP 805 P PP+ P P P +P P P P PP +P APP P Sbjct: 271 PPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNP 330 Query: 806 --XPGXXXXKXPPXXPXPXXPXPGXXXXXXPP 895 P PP P P P P PP Sbjct: 331 SIPPAPPNPSIPPAPPNPSIP-PAPPNLFIPP 361 Score = 32.7 bits (71), Expect = 0.48 Identities = 28/114 (24%), Positives = 29/114 (25%), Gaps = 8/114 (7%) Frame = +2 Query: 665 PPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXX 844 PP T P P P P PP P P PP P P Sbjct: 162 PPVTETTTTKPETKPPK-PPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHI 220 Query: 845 P--------XPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFXXPP 982 P P P P PP T P P P + NP P Sbjct: 221 PPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAP 274 Score = 31.9 bits (69), Expect = 0.83 Identities = 33/125 (26%), Positives = 35/125 (28%), Gaps = 11/125 (8%) Frame = +2 Query: 641 PXKPPSXXPPPXP--TPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAP--PPPX 808 P P + PP P P P P P A P P P P P PP Sbjct: 206 PPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPAS 265 Query: 809 PGXXXXKXPPXX-----PXPXXPXPGXXXXXXPPPPXXTNXF--PLGPXPXVXXIXXNPX 967 P PP P P P P PP N F P P + NP Sbjct: 266 PNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPP---NLFIPSAPPNPHIPPAPPNPY 322 Query: 968 FXXPP 982 P Sbjct: 323 IPTAP 327 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 47.6 bits (108), Expect = 2e-05 Identities = 32/101 (31%), Positives = 33/101 (32%) Frame = +2 Query: 668 PPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXXP 847 PP P P P S P P PPP S PPPP P PP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPP------PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Query: 848 XPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXF 970 P PG PPPP L P P + P F Sbjct: 731 ---SPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKPLF 768 Score = 41.5 bits (93), Expect = 0.001 Identities = 30/95 (31%), Positives = 33/95 (34%), Gaps = 1/95 (1%) Frame = +1 Query: 553 PLTSITKIXAPSXXXXPPPDRTIXIPXXPPXXT-PLPXPPPFXXPXPXTXXXXPPFSPXG 729 P + I S PPP P PP + LP PPP P P PP P Sbjct: 679 PPPPLPVIEGSSLSVPPPPP-----PPPPPLLSGTLPMPPPPPPPPPGCAGLPPP--PPS 731 Query: 730 XXXGXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXP 834 G + PPP P G PPP P P Sbjct: 732 PQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 40.3 bits (90), Expect = 0.002 Identities = 30/88 (34%), Positives = 30/88 (34%), Gaps = 1/88 (1%) Frame = +2 Query: 665 PPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPP-XXXSPXXXXAPPPPXPGXXXXKXPPX 841 PPP P P P PL P PPP P PPPP P P Sbjct: 694 PPPPPPPPP------PLLSGTLPMPPPPPPPPPGCAGLP-----PPPPSPQPGCAGLP-- 740 Query: 842 XPXPXXPXPGXXXXXXPPPPXXTNXFPL 925 P P P PG PPPP PL Sbjct: 741 -PPPPPPPPGCAGLPPPPPPIDVPMKPL 767 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/87 (27%), Positives = 26/87 (29%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXFPX 780 PPP + + P P PPP T PP P PPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGC 736 Query: 781 XGXGPPPPXXWXXXPQXPPXXPXTXXP 861 G PPPP PP P P Sbjct: 737 AGLPPPPPPPPPGCAGLPPPPPPIDVP 763 >SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 47.2 bits (107), Expect = 2e-05 Identities = 22/46 (47%), Positives = 29/46 (63%), Gaps = 6/46 (13%) Frame = +1 Query: 229 KQVNNNNCIHFMFQVQGEVW------EVFSALMNRPTRGERRFAYW 348 + ++ N C+ F GE++ V +ALMNRPTRGERRFAYW Sbjct: 102 EDIDGNYCLQFYLHKSGEIYWLVGKPVVPAALMNRPTRGERRFAYW 147 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 183 ICDTGYIPLPRSLTRYARSFDCGERKWLT 211 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 46.8 bits (106), Expect = 3e-05 Identities = 30/94 (31%), Positives = 33/94 (35%), Gaps = 6/94 (6%) Frame = +2 Query: 638 PPXKPPSXXPPPX----PTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPP 805 PP + + PPP P P P PL P P PPP P + PPP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPP-PPPISKPPTSTRSAPPP 359 Query: 806 XPGXXXXK--XPPXXPXPXXPXPGXXXXXXPPPP 901 PG PP P P G PPPP Sbjct: 360 PPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 46.4 bits (105), Expect = 4e-05 Identities = 33/115 (28%), Positives = 38/115 (33%), Gaps = 5/115 (4%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXFPX 780 PP + +P PP PPP P P +P G S PPP P Sbjct: 232 PPTGSSRPLPAPPPGENR--PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 289 Query: 781 XG----XGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXF-XPPPPXKXKXFPPXP 930 GPP P P PP T P PPPP + + PP P Sbjct: 290 SNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPP 344 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/107 (29%), Positives = 34/107 (31%), Gaps = 7/107 (6%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGX 817 PP K S PPP PT P + P PPP + PPPP P Sbjct: 271 PPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNA-----TPPPPPPSR 325 Query: 818 XXXKXPPXX-------PXPXXPXPGXXXXXXPPPPXXTNXFPLGPXP 937 PP P P P PPPP PLG P Sbjct: 326 DQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPP 372 Score = 40.7 bits (91), Expect = 0.002 Identities = 33/118 (27%), Positives = 40/118 (33%), Gaps = 4/118 (3%) Frame = +1 Query: 583 PSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPP 762 P PPPDR + P + P PPP P P + P F G + PPP Sbjct: 142 PPFGAPPPPDRGGQLAKKPSQGS-FPPPPPMGKPPPPS-GNKPTF---GNSRTSTNGPPP 196 Query: 763 XXXFPXXGXGPPPPXXWXXXPQXPPXXPXT----XXPFXXXXXXFXPPPPXKXKXFPP 924 G PPPP P PP + P PPP + + PP Sbjct: 197 -PPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 253 Score = 39.9 bits (89), Expect = 0.003 Identities = 29/101 (28%), Positives = 30/101 (29%), Gaps = 13/101 (12%) Frame = +2 Query: 638 PPXKPPSXXPPPX---PT----------PXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSP 778 PP P PPP PT P P P P + P PPP Sbjct: 166 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPS 225 Query: 779 XXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPP 901 APPP PP P P G PPPP Sbjct: 226 QRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPP 266 Score = 39.1 bits (87), Expect = 0.005 Identities = 33/116 (28%), Positives = 35/116 (30%), Gaps = 6/116 (5%) Frame = +1 Query: 583 PSXXXXPPPDR-TIXIPXXPPXXTPLPXPPP---FXXPXPXTXXXXPPFSPXGXXXGXSX 750 P PP + T P PP P PPP P P P P + Sbjct: 282 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP 341 Query: 751 XPPPXXXFPXXGXG-PPPPXXWXXXPQX-PPXXPXTXXPFXXXXXXFXPPPPXKXK 912 PPP P PPPP P PP P P PPPP K Sbjct: 342 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDK 397 Score = 38.7 bits (86), Expect = 0.007 Identities = 35/132 (26%), Positives = 40/132 (30%), Gaps = 6/132 (4%) Frame = +2 Query: 605 PPTGL*XYQXXPPX---KPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPP---PX 766 PPTG PP +PP P P P +P P + P PP P Sbjct: 232 PPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAP--PPPKRGSSNPPPPPTRGPP 289 Query: 767 XXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVX 946 S P PP PP P P P PPPP P P P + Sbjct: 290 SNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP--PPPPIS 347 Query: 947 XIXXNPXFXXPP 982 + PP Sbjct: 348 KPPTSTRSAPPP 359 Score = 36.3 bits (80), Expect = 0.039 Identities = 30/99 (30%), Positives = 31/99 (31%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXX 784 PP + PP S PPP P P P S P P PP Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPP-PGRGPSQRSLAPPPTGSSRPLPAPPP-------G 246 Query: 785 XXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPP 901 PPPP G PP P P P PPPP Sbjct: 247 ENRPPPPMRGPTSGGEPP--PPKNAPPPPKRGSSNPPPP 283 Score = 35.5 bits (78), Expect = 0.068 Identities = 31/122 (25%), Positives = 34/122 (27%), Gaps = 3/122 (2%) Frame = +2 Query: 581 PHLXXGXXPPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPP 760 PH G PP + P PP P + P P S P PP Sbjct: 198 PHSRHGSAPPP---PERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLP---APPPGENRPP 251 Query: 761 PXXXSPXXXXAPPPP---XPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGP 931 P P PPPP P P P P PP P + P P Sbjct: 252 PPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPP 311 Query: 932 XP 937 P Sbjct: 312 PP 313 Score = 33.9 bits (74), Expect = 0.21 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +2 Query: 755 PPPXXXSPXXXX-APPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPP 901 PPP SP APPPP G K P P P G PPPP Sbjct: 133 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMG-----KPPPP 177 Score = 33.9 bits (74), Expect = 0.21 Identities = 23/81 (28%), Positives = 25/81 (30%), Gaps = 4/81 (4%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPX---P*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPX 808 PP PPS P P P P+ + P PP P PPPP Sbjct: 318 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPG 377 Query: 809 PGXXXXK-XPPXXPXPXXPXP 868 K PP P P P Sbjct: 378 RRPPSGKINPPPPPPPAMDKP 398 Score = 32.3 bits (70), Expect = 0.63 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 8/73 (10%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTP------LPXPPPFXXPXPXTXXXXPPFS--PXGXXXGXSXXP 756 PPP R P PP P P PPP P P PP P P Sbjct: 332 PPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 391 Query: 757 PPXXXFPXXGXGP 795 PP P GP Sbjct: 392 PPAMDKPSFTNGP 404 Score = 31.9 bits (69), Expect = 0.83 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 3/95 (3%) Frame = +2 Query: 647 KPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXXXX 826 K PS P P P P S P PPP S APPPP Sbjct: 158 KKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHS-RHGSAPPPPERSSGPP 216 Query: 827 KXPP---XXPXPXXPXPGXXXXXXPPPPXXTNXFP 922 PP P P P PP N P Sbjct: 217 PPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPP 251 Score = 31.9 bits (69), Expect = 0.83 Identities = 28/114 (24%), Positives = 30/114 (26%) Frame = +2 Query: 641 PXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXX 820 P PPS P P P P +P P P PPP PPPP Sbjct: 298 PPLPPSRDQAPAPPP---PLNATPP-PPPPSRDQVPLPPPPLRGQ---IAPPPPPISKPP 350 Query: 821 XXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFXXPP 982 P P PPP + P P P F P Sbjct: 351 TSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGP 404 Score = 29.5 bits (63), Expect = 4.4 Identities = 28/112 (25%), Positives = 31/112 (27%), Gaps = 16/112 (14%) Frame = +2 Query: 650 PPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAP----------- 796 PP PP P P P + P PP P P Sbjct: 134 PPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNG 193 Query: 797 PPPXPGXXXXKXPP-----XXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXP 937 PPP P PP P P P G PPP ++ PL P Sbjct: 194 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSR-PLPAPP 244 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 46.8 bits (106), Expect = 3e-05 Identities = 30/94 (31%), Positives = 33/94 (35%), Gaps = 6/94 (6%) Frame = +2 Query: 638 PPXKPPSXXPPPX----PTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPP 805 PP + + PPP P P P PL P P PPP P + PPP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPP-PPPISKPPTSTRSAPPP 271 Query: 806 XPGXXXXK--XPPXXPXPXXPXPGXXXXXXPPPP 901 PG PP P P G PPPP Sbjct: 272 PPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 46.4 bits (105), Expect = 4e-05 Identities = 33/115 (28%), Positives = 38/115 (33%), Gaps = 5/115 (4%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPPXXXFPX 780 PP + +P PP PPP P P +P G S PPP P Sbjct: 144 PPTGSSRPLPAPPPGENR--PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 201 Query: 781 XG----XGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXF-XPPPPXKXKXFPPXP 930 GPP P P PP T P PPPP + + PP P Sbjct: 202 SNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPP 256 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/107 (29%), Positives = 34/107 (31%), Gaps = 7/107 (6%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGX 817 PP K S PPP PT P + P PPP + PPPP P Sbjct: 183 PPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNA-----TPPPPPPSR 237 Query: 818 XXXKXPPXX-------PXPXXPXPGXXXXXXPPPPXXTNXFPLGPXP 937 PP P P P PPPP PLG P Sbjct: 238 DQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPP 284 Score = 40.7 bits (91), Expect = 0.002 Identities = 33/118 (27%), Positives = 40/118 (33%), Gaps = 4/118 (3%) Frame = +1 Query: 583 PSXXXXPPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSPXGXXXGXSXXPPP 762 P PPPDR + P + P PPP P P + P F G + PPP Sbjct: 54 PPFGAPPPPDRGGQLAKKPSQGS-FPPPPPMGKPPPPS-GNKPTF---GNSRTSTNGPPP 108 Query: 763 XXXFPXXGXGPPPPXXWXXXPQXPPXXPXT----XXPFXXXXXXFXPPPPXKXKXFPP 924 G PPPP P PP + P PPP + + PP Sbjct: 109 -PPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPP 165 Score = 39.9 bits (89), Expect = 0.003 Identities = 29/101 (28%), Positives = 30/101 (29%), Gaps = 13/101 (12%) Frame = +2 Query: 638 PPXKPPSXXPPPX---PT----------PXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSP 778 PP P PPP PT P P P P + P PPP Sbjct: 78 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPS 137 Query: 779 XXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPP 901 APPP PP P P G PPPP Sbjct: 138 QRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPP 178 Score = 39.1 bits (87), Expect = 0.005 Identities = 33/116 (28%), Positives = 35/116 (30%), Gaps = 6/116 (5%) Frame = +1 Query: 583 PSXXXXPPPDR-TIXIPXXPPXXTPLPXPPP---FXXPXPXTXXXXPPFSPXGXXXGXSX 750 P PP + T P PP P PPP P P P P + Sbjct: 194 PPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP 253 Query: 751 XPPPXXXFPXXGXG-PPPPXXWXXXPQX-PPXXPXTXXPFXXXXXXFXPPPPXKXK 912 PPP P PPPP P PP P P PPPP K Sbjct: 254 PPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDK 309 Score = 38.7 bits (86), Expect = 0.007 Identities = 35/132 (26%), Positives = 40/132 (30%), Gaps = 6/132 (4%) Frame = +2 Query: 605 PPTGL*XYQXXPPX---KPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPP---PX 766 PPTG PP +PP P P P +P P + P PP P Sbjct: 144 PPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAP--PPPKRGSSNPPPPPTRGPP 201 Query: 767 XXSPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVX 946 S P PP PP P P P PPPP P P P + Sbjct: 202 SNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAP--PPPPIS 259 Query: 947 XIXXNPXFXXPP 982 + PP Sbjct: 260 KPPTSTRSAPPP 271 Score = 36.3 bits (80), Expect = 0.039 Identities = 30/99 (30%), Positives = 31/99 (31%) Frame = +2 Query: 605 PPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXX 784 PP + PP S PPP P P P S P P PP Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPP-PGRGPSQRSLAPPPTGSSRPLPAPPP-------G 158 Query: 785 XXAPPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPP 901 PPPP G PP P P P PPPP Sbjct: 159 ENRPPPPMRGPTSGGEPP--PPKNAPPPPKRGSSNPPPP 195 Score = 35.5 bits (78), Expect = 0.068 Identities = 31/122 (25%), Positives = 34/122 (27%), Gaps = 3/122 (2%) Frame = +2 Query: 581 PHLXXGXXPPTGL*XYQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPP 760 PH G PP + P PP P + P P S P PP Sbjct: 110 PHSRHGSAPPP---PERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLP---APPPGENRPP 163 Query: 761 PXXXSPXXXXAPPPP---XPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGP 931 P P PPPP P P P P PP P + P P Sbjct: 164 PPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPP 223 Query: 932 XP 937 P Sbjct: 224 PP 225 Score = 33.9 bits (74), Expect = 0.21 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +2 Query: 755 PPPXXXSPXXXX-APPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPP 901 PPP SP APPPP G K P P P G PPPP Sbjct: 45 PPPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMG-----KPPPP 89 Score = 33.9 bits (74), Expect = 0.21 Identities = 23/81 (28%), Positives = 25/81 (30%), Gaps = 4/81 (4%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPX---P*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPX 808 PP PPS P P P P+ + P PP P PPPP Sbjct: 230 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPG 289 Query: 809 PGXXXXK-XPPXXPXPXXPXP 868 K PP P P P Sbjct: 290 RRPPSGKINPPPPPPPAMDKP 310 Score = 32.3 bits (70), Expect = 0.63 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 8/73 (10%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTP------LPXPPPFXXPXPXTXXXXPPFS--PXGXXXGXSXXP 756 PPP R P PP P P PPP P P PP P P Sbjct: 244 PPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPP 303 Query: 757 PPXXXFPXXGXGP 795 PP P GP Sbjct: 304 PPAMDKPSFTNGP 316 Score = 31.9 bits (69), Expect = 0.83 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 3/95 (3%) Frame = +2 Query: 647 KPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXXXX 826 K PS P P P P S P PPP S APPPP Sbjct: 70 KKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHS-RHGSAPPPPERSSGPP 128 Query: 827 KXPP---XXPXPXXPXPGXXXXXXPPPPXXTNXFP 922 PP P P P PP N P Sbjct: 129 PPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPP 163 Score = 31.9 bits (69), Expect = 0.83 Identities = 28/114 (24%), Positives = 30/114 (26%) Frame = +2 Query: 641 PXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXX 820 P PPS P P P P +P P P PPP PPPP Sbjct: 210 PPLPPSRDQAPAPPP---PLNATPP-PPPPSRDQVPLPPPPLRGQ---IAPPPPPISKPP 262 Query: 821 XXKXPPXXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFXXPP 982 P P PPP + P P P F P Sbjct: 263 TSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKPSFTNGP 316 Score = 29.5 bits (63), Expect = 4.4 Identities = 28/112 (25%), Positives = 31/112 (27%), Gaps = 16/112 (14%) Frame = +2 Query: 650 PPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAP----------- 796 PP PP P P P + P PP P P Sbjct: 46 PPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNG 105 Query: 797 PPPXPGXXXXKXPP-----XXPXPXXPXPGXXXXXXPPPPXXTNXFPLGPXP 937 PPP P PP P P P G PPP ++ PL P Sbjct: 106 PPPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSR-PLPAPP 156 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLTQR 428 +C G +PLPRSLTR ARSF CGER LT R Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLTNR 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 45.6 bits (103), Expect = 6e-05 Identities = 38/126 (30%), Positives = 41/126 (32%), Gaps = 12/126 (9%) Frame = +1 Query: 580 APSXXXXPPPDRTIXIP-XXPPXXTPLPXPPPF------XXPXPXTXXXXPP-FSPXGXX 735 AP PPP +TI PP + PPP+ P T PP P G Sbjct: 321 APPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGAG 380 Query: 736 XGXSXXPPPXXXFPXXGXGPPP--PXXWXXXPQXPP--XXPXTXXPFXXXXXXFXPPPPX 903 G PPP GPPP P P PP P P F PPPP Sbjct: 381 NGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPP 440 Query: 904 KXKXFP 921 P Sbjct: 441 PPSDAP 446 Score = 35.9 bits (79), Expect = 0.051 Identities = 32/115 (27%), Positives = 36/115 (31%), Gaps = 12/115 (10%) Frame = +2 Query: 629 QXXPPXK--PPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAP-- 796 Q PP K P + PPP P+ P + + P PP P P Sbjct: 326 QAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGAGNGPGG 385 Query: 797 PPP---XPGXXXXKXPPXXP-----XPXXPXPGXXXXXXPPPPXXTNXFPLGPXP 937 PPP PG PP P P P PPPP F P P Sbjct: 386 PPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPP 440 Score = 33.1 bits (72), Expect = 0.36 Identities = 29/99 (29%), Positives = 29/99 (29%), Gaps = 2/99 (2%) Frame = +2 Query: 641 PXKPPSXXPPPXPT-PXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGX 817 P PPS PPP T P P P A P S P PG Sbjct: 320 PAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGA 379 Query: 818 XXXKXPPXXPXPXXPXPGXXXXXXPPP-PXXTNXFPLGP 931 P P P PG PPP P N P P Sbjct: 380 GNG---PGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIP 415 Score = 30.7 bits (66), Expect = 1.9 Identities = 27/106 (25%), Positives = 29/106 (27%), Gaps = 1/106 (0%) Frame = +2 Query: 668 PPXPT-PXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXXXXKXPPXX 844 PP PT P S PPP P PPP PP Sbjct: 278 PPVPTLPVDKAKMDSEYLSLMAELGVGEAPPPPAASEPAAFAPAPPPSQA----PPPPKT 333 Query: 845 PXPXXPXPGXXXXXXPPPPXXTNXFPLGPXPXVXXIXXNPXFXXPP 982 P P PPP T+ GP P + P PP Sbjct: 334 IPSTLPPPPVPSATSAPPPWATSN--SGPKPLMSTPVQRPPGMRPP 377 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPP 805 PP P P P P P +P P PPP P PPPP Sbjct: 388 PPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPG--YIPPPPPGFPQFQPPPPPP 441 Score = 29.5 bits (63), Expect = 4.4 Identities = 21/75 (28%), Positives = 23/75 (30%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGX 817 PP PP P P P P P PP +P PPP PG Sbjct: 376 PPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPP-WQTTPGYI---PPPPPGF 431 Query: 818 XXXKXPPXXPXPXXP 862 + PP P P Sbjct: 432 PQFQPPPPPPPSDAP 446 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 45.2 bits (102), Expect = 8e-05 Identities = 26/59 (44%), Positives = 34/59 (57%), Gaps = 2/59 (3%) Frame = +1 Query: 178 CEXCDAIALFVTIISCNKQVN--NNNCIHFMFQVQGEVWEVFSALMNRPTRGERRFAYW 348 C+ + F +I++ + N N C +M V V V +ALMNRPTRGERRFAYW Sbjct: 42 CKWLLGVFEFCSILAPEIETNFSTNRCRRYMATVGKPV--VPAALMNRPTRGERRFAYW 98 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWLT 200 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 120 AALMNRPTRGERRFAYW 136 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWLT 324 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 244 AALMNRPTRGERRFAYW 260 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWLT 174 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWLT 131 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 51 AALMNRPTRGERRFAYW 67 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGERKWLT 279 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 199 AALMNRPTRGERRFAYW 215 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWLT 421 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 341 AALMNRPTRGERRFAYW 357 Score = 32.7 bits (71), Expect = 0.48 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 625 IPXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSP 723 IP PP P P PPP P T PP P Sbjct: 795 IPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 665 PPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAP--PPPXPG 814 PPP P P P P A P PPP P P PP PG Sbjct: 778 PPPPPPTKPATPRVPPNIP-SRPPGARPTPPPPPPGKPTKPTKPSLPPVPPG 828 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGERKWLT 276 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 196 AALMNRPTRGERRFAYW 212 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWLT 176 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 96 AALMNRPTRGERRFAYW 112 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWLT 639 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 559 AALMNRPTRGERRFAYW 575 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWLT 395 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 315 AALMNRPTRGERRFAYW 331 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWLT 238 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 158 AALMNRPTRGERRFAYW 174 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWLT 196 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 35.5 bits (78), Expect = 0.068 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 601 PPPDRTIXIPXXPPXXTPLPXPPPFXXPXPXT 696 PPP P PP P P PPPF P P T Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPT 495 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 791 APPPPXPGXXXXKXPPXXPXPXXPXPGXXXXXXPPPPXXT 910 APPPP P PP P P P P PPPP T Sbjct: 463 APPPPPP-------PPPPPPPPPPPPPPPPPPFPPPPPPT 495 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSPL 715 PP PP PPP P P P P +PL Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 32.3 bits (70), Expect = 0.63 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 629 QXXPPXKPPSXXPPPXPTPXP*PXXXSP 712 Q PP PP PPP P P P P P Sbjct: 462 QAPPPPPPPPPPPPPPPPPPPPPPPPFP 489 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 755 PPPXXXSPXXXXAPPPPXPGXXXXKXPPXXPXP 853 PPP P PPPP P PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSP 712 PP PP PPP P P P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSP 712 PP PP PPP P P P P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSP 712 PP PP PPP P P P P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 638 PPXKPPSXXPPPXPTPXP*PXXXSP 712 PP PP PPP P P P P P Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 580 APSXXXXPPPDRTIXIPXXPPXXTPLPXPPP 672 AP PPP P PP P P PPP Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 628 PXXPPXXTPLPXPPPFXXPXPXTXXXXPPFSP 723 P PP P P PPP P P PP +P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 773 SPXXXXAPPPPXPGXXXXKXPPXXPXPXXPXP 868 +P PPPP P PP P P P P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 746 PXXPPPXXXSPXXXXAPPPPXPGXXXXKXPP 838 P PPP P PPPP P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 641 PXKPPSXXPPPXPTPXP*PXXXSPLFP 721 P PP PPP P P P P P FP Sbjct: 464 PPPPPPPPPPPPPPPPP-PPPPPPPFP 489 Score = 29.1 bits (62), Expect = 5.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 784 GXGPPPPXXWXXXPQXPPXXPXTXXPFXXXXXXFXPPPP 900 G PPPP P PP P P F PPPP Sbjct: 461 GQAPPPP------PPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.1 bits (62), Expect = 5.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 628 PXXPPXXTPLPXPPPFXXPXPXTXXXXPP 714 P PP P P PPP P P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 28.7 bits (61), Expect = 7.8 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 727 GXXXGXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXPPXXP 846 G G PPP P PPPP P PP P Sbjct: 455 GDTEGVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 28.7 bits (61), Expect = 7.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 739 GXSXXPPPXXXFPXXGXGPPPPXXWXXXPQXPPXXP 846 G + PPP P PPPP P PP P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWLT 207 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 127 AALMNRPTRGERRFAYW 143 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +1 Query: 253 IHFMFQVQGEVWEVFSALMNRPTRGERRFAYW 348 +++ F G+ V +ALMNRPTRGERRFAYW Sbjct: 36 LYYAFSYVGKP-VVPAALMNRPTRGERRFAYW 66 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWLT 165 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 85 AALMNRPTRGERRFAYW 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGERKWLT 91 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 11 AALMNRPTRGERRFAYW 27 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGERKWLT 628 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 548 AALMNRPTRGERRFAYW 564 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/26 (69%), Positives = 18/26 (69%) Frame = +1 Query: 505 RTVERPRCWRFSIGSXPLTSITKIXA 582 R V PR RFSIGS PLTSITK A Sbjct: 141 REVRGPRQSRFSIGSAPLTSITKSDA 166 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWLT 124 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +1 Query: 223 CNKQVNNNNCIHFMFQVQGEVWEVFSALMNRPTRGERRFAYW 348 C ++ N+ + +F+ G+ V +ALMNRPTRGERRFAYW Sbjct: 21 CRNSIDIND-MKQLFECVGKP-VVPAALMNRPTRGERRFAYW 60 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWLT 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 65 AALMNRPTRGERRFAYW 81 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWLT 167 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWLT 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWLT 127 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWLT 265 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 185 AALMNRPTRGERRFAYW 201 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWLT 656 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 576 AALMNRPTRGERRFAYW 592 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWLT 378 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 298 AALMNRPTRGERRFAYW 314 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWLT 882 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 802 AALMNRPTRGERRFAYW 818 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWLT 267 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 187 AALMNRPTRGERRFAYW 203 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWLT 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 86 AALMNRPTRGERRFAYW 102 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWLT 567 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 487 AALMNRPTRGERRFAYW 503 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWLT 112 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 32 AALMNRPTRGERRFAYW 48 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1012 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 932 AALMNRPTRGERRFAYW 948 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWLT 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWLT 517 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 437 AALMNRPTRGERRFAYW 453 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWLT 313 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 233 AALMNRPTRGERRFAYW 249 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWLT 132 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWLT 222 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWLT 307 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 227 AALMNRPTRGERRFAYW 243 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWLT 183 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 125 ICDTGYIPLPRSLTRYARSFDCGERKWLT 153 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNR TRGERRFA W Sbjct: 73 AALMNRATRGERRFADW 89 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1023 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 943 AALMNRPTRGERRFAYW 959 Score = 29.5 bits (63), Expect = 4.4 Identities = 24/87 (27%), Positives = 25/87 (28%) Frame = +2 Query: 641 PXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPPXPGXX 820 P P P P P P P P P P P P PP P PG Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDGPMGL----------PGPQGPDGPKGPPGP-PGLP 1700 Query: 821 XXKXPPXXPXPXXPXPGXXXXXXPPPP 901 + P P PG PP P Sbjct: 1701 GPQGIPGYPGAPAGPPGRDGPMGPPGP 1727 Score = 29.5 bits (63), Expect = 4.4 Identities = 26/89 (29%), Positives = 27/89 (30%) Frame = +2 Query: 626 YQXXPPXKPPSXXPPPXPTPXP*PXXXSPLFPXXXXXXAXPXXPPPXXXSPXXXXAPPPP 805 Y PP PP+ PP P P P P P P P P AP P Sbjct: 1659 YPAPPPPPPPAPGPPGPDGPMGLPGPQGPDGP--KGPPGPPGLPGPQGI-PGYPGAPAGP 1715 Query: 806 XPGXXXXKXPPXXPXPXXPXPGXXXXXXP 892 PG PP P PG P Sbjct: 1716 -PGRDGPMGPPGPSGGQGP-PGDMGSMGP 1742 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWLT 170 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 90 AALMNRPTRGERRFAYW 106 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWLT 503 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 423 AALMNRPTRGERRFAYW 439 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWLT 185 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 105 AALMNRPTRGERRFAYW 121 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWLT 551 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 471 AALMNRPTRGERRFAYW 487 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWLT 549 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 469 AALMNRPTRGERRFAYW 485 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWLT 171 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 91 AALMNRPTRGERRFAYW 107 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWLT 173 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 93 AALMNRPTRGERRFAYW 109 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGERKWLT 319 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 239 AALMNRPTRGERRFAYW 255 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 1206 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1234 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 1154 AALMNRPTRGERRFAYW 1170 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 107 ICDTGYIPLPRSLTRYARSFDCGERKWLT 135 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 55 AALMNRPTRGERRFAYW 71 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGERKWLT 128 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 48 AALMNRPTRGERRFAYW 64 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/44 (54%), Positives = 30/44 (68%), Gaps = 5/44 (11%) Frame = +1 Query: 232 QVNNNNCIHFMFQVQ---GEVWE--VFSALMNRPTRGERRFAYW 348 +++NNN I + V G V + V +ALMNRPTRGERRFAYW Sbjct: 42 ELDNNNTIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFAYW 85 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 98 ICDTGYIPLPRSLTRYARSFDCGERKWLT 126 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 46 AALMNRPTRGERRFAYW 62 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 1476 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1504 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 1424 AALMNRPTRGERRFAYW 1440 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 629 ICDTGYIPLPRSLTRYARSFDCGERKWLT 657 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 577 AALMNRPTRGERRFAYW 593 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 89 ICDTGYIPLPRSLTRYARSFDCGERKWLT 117 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 37 AALMNRPTRGERRFAYW 53 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 326 ICDTGYIPLPRSLTRYARSFDCGERKWLT 354 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 274 AALMNRPTRGERRFAYW 290 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGERKWLT 202 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 2/87 (2%) Frame = +1 Query: 94 G*LDPDMIRYIDEFGQTTTXMQ*KKCFICEXCDAIALFVTIISCNKQVNNNNCIHFMFQV 273 G ++ ++ +Y+ ++ +T + + I A + + N + N ++ + Q Sbjct: 54 GAIEMELSKYLRDYSRTIAGKE--QLLIGAMAKAFEIIPRQLCDNAGFDATNILNKLRQK 111 Query: 274 QGEVWE--VFSALMNRPTRGERRFAYW 348 +V + V +ALMNRPTRGERRFAYW Sbjct: 112 HFQVGKPVVPAALMNRPTRGERRFAYW 138 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 538 ICDTGYIPLPRSLTRYARSFDCGERKWLT 566 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 486 AALMNRPTRGERRFAYW 502 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 160 ICDTGYIPLPRSLTRYARSFDCGERKWLT 188 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 108 AALMNRPTRGERRFAYW 124 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 182 ICDTGYIPLPRSLTRYARSFDCGERKWLT 210 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 130 AALMNRPTRGERRFAYW 146 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 154 ICDTGYIPLPRSLTRYARSFDCGERKWLT 182 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 102 AALMNRPTRGERRFAYW 118 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 119 ICDTGYIPLPRSLTRYARSFDCGERKWLT 147 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 67 AALMNRPTRGERRFAYW 83 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 115 ICDTGYIPLPRSLTRYARSFDCGERKWLT 143 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 63 AALMNRPTRGERRFAYW 79 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 545 ICDTGYIPLPRSLTRYARSFDCGERKWLT 573 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 493 AALMNRPTRGERRFAYW 509 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 440 ICDTGYIPLPRSLTRYARSFDCGERKWLT 468 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 388 AALMNRPTRGERRFAYW 404 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 227 ICDTGYIPLPRSLTRYARSFDCGERKWLT 255 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 175 AALMNRPTRGERRFAYW 191 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) Length = 119 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 95 ICDTGYIPLPRSLTRYARSFDCGERKWLT 123 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 43 AALMNRPTRGERRFAYW 59 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 637 ICDTGYIPLPRSLTRYARSFDCGERKWLT 665 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 585 AALMNRPTRGERRFAYW 601 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 336 VCVLGALPLPRSLTRCARSFGCGERYQLT 422 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 298 SALMNRPTRGERRFAYW 348 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,432,114 Number of Sequences: 59808 Number of extensions: 532499 Number of successful extensions: 7547 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4133 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2967383049 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -