BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E04 (981 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z97634-12|CAI95599.1| 195|Homo sapiens non-metastatic cells 4, ... 33 1.2 >Z97634-12|CAI95599.1| 195|Homo sapiens non-metastatic cells 4, protein expressed in protein. Length = 195 Score = 33.5 bits (73), Expect = 1.2 Identities = 25/89 (28%), Positives = 37/89 (41%) Frame = -3 Query: 292 GPRSPGPL*RSRHECSCPFFQFS*RSSTWAREQRWSCSKPAPERRRRIGSLRNSL*VYVN 113 GPR+PGP RH P R +W RE+ KP +RR +G + Sbjct: 16 GPRAPGPSLLVRHGSGLPPSALK-RGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGF 74 Query: 112 SKADVKTQAALY*SLDVHYQECQKS*EFP 26 + +K A L HYQ+ ++ +P Sbjct: 75 TLVGMKMLQAPESVLAEHYQDLRRKPFYP 103 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,191,335 Number of Sequences: 237096 Number of extensions: 1497998 Number of successful extensions: 2325 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2032 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2257 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 13102819592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -