BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_E01 (928 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 50 3e-06 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 48 8e-06 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 41 4e-05 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 45 1e-04 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 45 1e-04 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 44 2e-04 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 44 2e-04 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 43 4e-04 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 43 4e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 42 7e-04 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 40 0.002 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 40 0.002 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 40 0.002 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 40 0.002 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 40 0.004 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 40 0.004 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 38 0.012 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 33 0.014 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 38 0.015 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 38 0.015 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.015 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.018 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 37 0.020 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.027 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 37 0.027 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 36 0.046 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 36 0.061 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 36 0.061 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.061 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 35 0.081 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 35 0.081 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 35 0.081 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 35 0.11 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.11 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.12 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 34 0.14 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 34 0.14 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 34 0.14 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 34 0.14 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 34 0.15 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 34 0.19 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 34 0.19 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 33 0.25 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.25 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 33 0.25 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 33 0.33 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 33 0.33 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 33 0.33 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 33 0.33 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 33 0.43 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 33 0.43 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 33 0.43 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 32 0.57 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 32 0.57 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.76 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.76 SB_11512| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) 32 0.76 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.76 SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) 32 0.76 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 32 0.76 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 32 0.76 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 29 0.92 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 31 1.0 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 31 1.0 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 31 1.0 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.2 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 31 1.3 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 31 1.3 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 31 1.3 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 31 1.7 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 31 1.7 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 31 1.7 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 31 1.7 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.8 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 30 2.3 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 30 3.1 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 30 3.1 SB_13204| Best HMM Match : GRP (HMM E-Value=0.0017) 30 3.1 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 30 3.1 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 30 3.1 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 30 3.1 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 30 3.1 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 3.6 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 29 4.0 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 29 4.0 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 29 4.0 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 29 4.0 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 29 4.0 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 29 4.0 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 29 5.3 SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 29 5.3 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 29 5.3 SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_52268| Best HMM Match : SecA_PP_bind (HMM E-Value=0.33) 29 5.3 SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 25 5.9 SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) 25 6.4 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 29 7.1 SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) 29 7.1 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 7.1 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 29 7.1 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 28 9.3 SB_37296| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 28 9.3 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 28 9.3 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 28 9.3 SB_16709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 28 9.3 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 50.0 bits (114), Expect = 3e-06 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GGGG GG G GGA G Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG-ATGGGGGATGGGGGATGGGG 307 Query: 745 XGGGVXGGXXGGGGGGXG 692 GV GG GGGGG G Sbjct: 308 GATGVGGGATGGGGGATG 325 Score = 48.8 bits (111), Expect = 6e-06 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GGGG GGV G GG G Sbjct: 284 GGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGG--ATGGGVGATGGGGGATGG- 340 Query: 745 XGGGVXGGXXG--GGGGGXG 692 GGGV GG G GGGGG G Sbjct: 341 -GGGVTGGGGGATGGGGGPG 359 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GGGG GG G GGA G Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGG-GGATGGGV 328 Query: 745 XGGGVXGGXXGGGGGGXG 692 G GG GGGGG G Sbjct: 329 GATGGGGGATGGGGGVTG 346 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GGG GG G GG G Sbjct: 291 GGGGATGGGGGATGGGGGATGVGGGATGG-GGGATGGGVGATGGGGGATGGGGGVTGG-- 347 Query: 745 XGGGVXGGXXGGGGGGXG 692 GGG GG G G GG G Sbjct: 348 -GGGATGGGGGPGSGGCG 364 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -1 Query: 841 RFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 R G GGGG GG G GGA G G GG GGGGG G Sbjct: 236 RSNGRLGGGGA--TGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 283 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG GG G GGA G G GG GGGGG G Sbjct: 245 GATGGGGG-ATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 290 Score = 37.1 bits (82), Expect = 0.020 Identities = 28/84 (33%), Positives = 28/84 (33%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GGGG GG G G G Sbjct: 242 GGGGATGGGGGATGGGG--------------GATGGGGGATGGGGGATGGGGGATGGGGG 287 Query: 745 XGGGVXGGXXGGGGGGXGXXPAXG 674 GG G GGGG G A G Sbjct: 288 ATGGGGGATGGGGGATGGGGGATG 311 Score = 35.5 bits (78), Expect = 0.061 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 921 GXXXRGGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGGA 763 G GG GG GGG G GGGG GGG GGGA Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 295 Score = 33.1 bits (72), Expect = 0.33 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG G G GGGG GGV G GGA G Sbjct: 298 GGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTG-GGGGATGG-- 354 Query: 745 XGGGVXGGXXGGGG 704 GGG G G G Sbjct: 355 -GGGPGSGGCGEDG 367 Score = 32.7 bits (71), Expect = 0.43 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -2 Query: 909 RGGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGGA 763 R G GG GGG G GGGG GGG GGGA Sbjct: 240 RLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 288 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 50.0 bits (114), Expect = 3e-06 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXX 873 P P PP P PPPPP P P PP P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP----------- 414 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 415 PPPPAPPPPPPPPPPPPP 432 Score = 49.6 bits (113), Expect = 4e-06 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PPP P PP P PP PPPP P PP PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 903 PPXXP 917 PP P Sbjct: 428 PPPPP 432 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/73 (34%), Positives = 26/73 (35%) Frame = +1 Query: 709 PPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXXPXPXX 888 PP P PPPPP P P PP P P+ P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPP-------------PQPPPPPPPPPPPPPPPPP 411 Query: 889 PXPPPPPXXPPXP 927 P PPPPP PP P Sbjct: 412 PPPPPPPAPPPPP 424 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P PP P PPPPP P P PP P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 43.6 bits (98), Expect = 2e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P PP P PPPPP P P PP P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P PP P PPPPP P P PP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P PP P PPPPP P P PP P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P PP P PPPPP P P PP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P PP P PPPPP P P PP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P PP P PPPPP P P PP P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P PP P PPPPP P P PP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 41.1 bits (92), Expect = 0.001 Identities = 26/78 (33%), Positives = 27/78 (34%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSX 855 P P +P P PP P PPPPP P P PP P P Sbjct: 372 PPPPPSPPPPPPPP-PPSPPPPPQPPPPPPPPPP----------------PPPPPPPPPP 414 Query: 856 XXXXXXPXPXXPXPPPPP 909 P P P PPPPP Sbjct: 415 PPPPAPPPPPPPPPPPPP 432 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PPP P PP P P PPPP P PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP---------------PPPPPPPP 409 Query: 903 PPXXPXXP 926 PP P P Sbjct: 410 PPPPPPPP 417 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNL 842 PP PPP P PP P PP PPPP P L Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPAL 434 Score = 33.9 bits (74), Expect = 0.19 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = +1 Query: 553 PPXPPPGXPRXHXKRGXXXGKXXXXXXXXXXXXXXXXXXAXPXPVXTPXHPXPPXNXPXP 732 PP PPP P P P P P PP P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP--PPP 428 Query: 733 PPPPXPRXPXRPP 771 PPPP R PP Sbjct: 429 PPPPALRLACAPP 441 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PPP P PP P PP PP Sbjct: 408 PPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 49.6 bits (113), Expect = 4e-06 Identities = 28/85 (32%), Positives = 30/85 (35%), Gaps = 1/85 (1%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPP-PXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGS 852 P P+ P PP N P PPPP P P P PP P P + Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPN 216 Query: 853 XXXXXXXPXPXXPXPPPPPXXPPXP 927 P P P PP PP PP P Sbjct: 217 APNPPYPPPPNAPNPPYPP--PPNP 239 Score = 46.0 bits (104), Expect = 4e-05 Identities = 26/87 (29%), Positives = 27/87 (31%), Gaps = 3/87 (3%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSX 855 P +P P PP P PPPP P PP P P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Query: 856 XXXXXXPXPXXPXPP---PPPXXPPXP 927 P P P PP PPP PP P Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Score = 44.0 bits (99), Expect = 2e-04 Identities = 33/127 (25%), Positives = 33/127 (25%), Gaps = 2/127 (1%) Frame = +1 Query: 553 PPXPPPGXPRXHXKRGXXXGKXXXXXXXXXXXXXXXXXXAXPXPVXTPXHPXPPXNXPXP 732 PP PPP P P P P P PP P P Sbjct: 106 PPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP-PPPNPPYPPPLYPPP 164 Query: 733 PPPPXPRXP-XRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXXPXPXXPXPP-PP 906 P PP P P PP P P P P P PP PP Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPP 224 Query: 907 PXXPPXP 927 P P P Sbjct: 225 PPNAPNP 231 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PPP P P P PP N PPPP P PP PP Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYP-PPPNAPNPPPPNPPYPPPPN 216 Query: 903 PPXXPXXP 926 P P P Sbjct: 217 APNPPYPP 224 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +3 Query: 735 PPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPXPPXX 914 PPP P P P PP N PPPP P PP P PP Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPN 208 Query: 915 PXXP 926 P P Sbjct: 209 PPYP 212 Score = 41.9 bits (94), Expect = 7e-04 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PPP P PP P PP N PPPP P PP P Sbjct: 105 PPPYPPPPNPPY--PPPPNAPYPPPPNPPYPPPPNAP-----YPPSPNAPYPPPPNPPYP 157 Query: 903 PPXXPXXP 926 PP P P Sbjct: 158 PPLYPPPP 165 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PP P PP P PP N PPPP P P PP Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYP-PPPNAPYPPSPNAPYPPPPN 153 Query: 903 PPXXP 917 PP P Sbjct: 154 PPYPP 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 3/68 (4%) Frame = +3 Query: 723 PPXTPPPXXXPXGAP--PXPXXXTPPRXNXXIPPPPXXPX-NLXXXXXXXXXXXXPPXTX 893 PP PPP +P P P PP PPPP P N PP Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Query: 894 PPXPPXXP 917 PP PP P Sbjct: 190 PPNPPYPP 197 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PP P AP P P N PPPP Sbjct: 204 PPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 48.4 bits (110), Expect = 8e-06 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GGGG G G GG Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGD 846 Query: 745 XGGGVXGGXXGGGGGGXGXXPAXG 674 GGG GG GGGGGG G G Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 46.4 bits (105), Expect = 3e-05 Identities = 30/84 (35%), Positives = 31/84 (36%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G G GG + GG G G A Sbjct: 791 GGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG--DGGGFGDGGGYADGDGG 848 Query: 745 XGGGVXGGXXGGGGGGXGXXPAXG 674 GGG GG GGGGGG G G Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 46.4 bits (105), Expect = 3e-05 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG G GG G G GG F G G GG G Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGD--GGGYGDGGGFGDGGGYADGDGGGGGGGGGG 856 Query: 745 XGGGVXGGXXGGGGGGXG 692 GGG GG GGGGGG G Sbjct: 857 GGGGGGGGGGGGGGGGGG 874 Score = 46.0 bits (104), Expect = 4e-05 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GGGG GG G G G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDG-GGFG 837 Query: 745 XGGGVXGGXXGGGGGGXGXXPAXG 674 GGG G GGGGGG G G Sbjct: 838 DGGGYADGDGGGGGGGGGGGGGGG 861 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/84 (34%), Positives = 29/84 (34%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GG G GG G G Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGG 849 Query: 745 XGGGVXGGXXGGGGGGXGXXPAXG 674 GGG GG GGGGGG G G Sbjct: 850 GGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 44.8 bits (101), Expect = 1e-04 Identities = 28/75 (37%), Positives = 29/75 (38%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGG 737 G G GG GG G G GG + GG G GG G GG Sbjct: 806 GYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGG----GGGGGGGGGGGGG 861 Query: 736 GVXGGXXGGGGGGXG 692 G GG GGGGGG G Sbjct: 862 GGGGGGGGGGGGGGG 876 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG GG G GG G GGG G GGGGGG G Sbjct: 777 GDGGGGGD---GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGG 820 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG GG G GG G G G G GGGGGG G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GGGG GG G GG G GGG GG GG G G G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 787 VXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 V G GG G GGG GG GGGGGG G Sbjct: 766 VVVGGGGGGDGGDGGGGGDGGGGGGGGGGGGG 797 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGG GG G GG G GGG GG G G GG G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 29.1 bits (62), Expect = 5.3 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -2 Query: 921 GXXXRGGXGGG--XXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGG 769 G GG GGG GGG G+ GGGG GGG GG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -2 Query: 903 GXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGGAXR 757 G GGG GG G GGGG GGG GGG + Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIK 879 Score = 28.3 bits (60), Expect = 9.3 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 906 GGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGG 766 GG G G GGG G GGGG G G GGG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 48.0 bits (109), Expect = 1e-05 Identities = 29/87 (33%), Positives = 31/87 (35%), Gaps = 1/87 (1%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPX-NXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSX 846 A P P P PP N P PPPPP P +PP P P Sbjct: 912 ASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGN---APPPPPPPGGSAPPPGG 968 Query: 847 GSXXXXXXXPXPXXPXPPPPPXXPPXP 927 G+ P P PPPPP PP P Sbjct: 969 GA-PPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/88 (29%), Positives = 28/88 (31%), Gaps = 4/88 (4%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSX 855 P +P P + P PPPPP P PP P P GS Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSA 963 Query: 856 XXXXXXPXPXXPXP----PPPPXXPPXP 927 P P P PPPP PP P Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 32.7 bits (71), Expect = 0.43 Identities = 26/84 (30%), Positives = 27/84 (32%) Frame = +1 Query: 535 GGXXXLPPXPPPGXPRXHXKRGXXXGKXXXXXXXXXXXXXXXXXXAXPXPVXTPXHPXPP 714 GG LPP PPPG G + A P P P PP Sbjct: 927 GGNAPLPP-PPPG--------GSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Query: 715 XNXPXPPPPPXPRXPXRPPXPXXK 786 PPPPP P PP P K Sbjct: 978 GGSAPPPPPP----PPPPPPPMRK 997 Score = 28.7 bits (61), Expect = 7.1 Identities = 21/71 (29%), Positives = 23/71 (32%), Gaps = 3/71 (4%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPX---XXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTX 893 P TP P +PP PP N +PPPP P PP Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPP--PGGSAPSQPPPPGGNAPP--- 954 Query: 894 PPXPPXXPXXP 926 PP PP P Sbjct: 955 PPPPPGGSAPP 965 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P PP + P PPPPP P P PP P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPP 899 PP PPP P PP P PP PPPP P L P T PP Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRPPP-----PPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 Score = 37.1 bits (82), Expect(2) = 4e-05 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 676 PXPVXTPXHPXP-PXNXPXPPPPPXPRXPXRPPXP 777 P + P P P P P PPPPP P RPP P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 36.3 bits (80), Expect = 0.035 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPP-PXPRXPXRPPXP 777 P P P P PP P P PP P P P PP P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 35.9 bits (79), Expect = 0.046 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +1 Query: 700 HPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXXPX 879 HP P PPPPP PR P PP P P + P Sbjct: 194 HPTSPSQITQPPPPP-PRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAA-KLPEPPPI 251 Query: 880 PXXPXPPPPP 909 P P PPP Sbjct: 252 PNMPPTLPPP 261 Score = 35.1 bits (77), Expect = 0.081 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P P PPP P P P PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPP-PPXP---RXPXRPPXP 777 P P P P PP P PPP PP P + P PP P Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P P P PPPPP P P P Sbjct: 213 PSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLP 246 Score = 30.3 bits (65), Expect(2) = 0.005 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PPP P P P PP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPP 222 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPP P PP P Sbjct: 204 PPPPPPRPPPSPPPPPPP 221 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPP PP P Sbjct: 207 PPPRPPPSPPPPPPPPSP 224 Score = 28.3 bits (60), Expect(2) = 4e-05 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 224 PSPPRP-PPPPPPSPPRP 240 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P P PPP P P P P Sbjct: 230 PPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 27.9 bits (59), Expect(2) = 0.005 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 222 PSPSPPRPPPPP--PPSP 237 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 45.2 bits (102), Expect = 8e-05 Identities = 28/78 (35%), Positives = 29/78 (37%), Gaps = 2/78 (2%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRF--XGXXGGGGXFXLXRGGVXXXGXGGAPXG 752 G G GG GG GG G GGGG GG+ G G G Sbjct: 1769 GGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAG 1828 Query: 751 XXXGGGVXGGXXGGGGGG 698 G G GG GGGGGG Sbjct: 1829 GGMGAGGEGGGAGGGGGG 1846 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/84 (32%), Positives = 28/84 (33%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G G G + GG G GG G Sbjct: 1762 GGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Query: 745 XGGGVXGGXXGGGGGGXGXXPAXG 674 G G GG G GG G G G Sbjct: 1822 EGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 40.3 bits (90), Expect = 0.002 Identities = 32/85 (37%), Positives = 32/85 (37%), Gaps = 1/85 (1%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GGGG GG G G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGG---------GGMGGGGM--AAGGGEFGGGEGMGGGGMA 1804 Query: 745 XGGGVXGGXXGG-GGGGXGXXPAXG 674 GGG GG GG GGGG G A G Sbjct: 1805 GGGGGMGGGGGGMGGGGEGMGAAGG 1829 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 44.8 bits (101), Expect = 1e-04 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG F GG G GG G GGG GG GGGGGG G Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGG---GFGGGGGGGGGFGGGGGGGFG 128 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXGXR 668 G GG F GG G GG G GGG GG GGGG G G G R Sbjct: 82 GRGGGFG---GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSR 130 Score = 39.5 bits (88), Expect = 0.004 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = -1 Query: 841 RFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPA 680 R G GGGG GG G GG G GGG GG GGGG G PA Sbjct: 83 RGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG--GGGGFGSRARPA 134 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG GG G GGG GG GG GGG G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFG 120 Score = 32.3 bits (70), Expect = 0.57 Identities = 20/47 (42%), Positives = 21/47 (44%) Frame = -2 Query: 906 GGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGG 766 GG GGG GGG GF GGGG GGG +GGG Sbjct: 81 GGRGGGFGGGGGFGGGGG---GGFGG--GGGGGFGGGGGGGGGFGGG 122 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = -2 Query: 909 RGGX--GGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGG 787 RGG GGG GGG GF GGGG GGG Sbjct: 83 RGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 29.1 bits (62), Expect = 5.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 796 RGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 R V G G G GGG G GGGGG G G Sbjct: 77 RASVGGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGG 117 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 44.8 bits (101), Expect = 1e-04 Identities = 30/86 (34%), Positives = 30/86 (34%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G G G GG R G GGGG GG G G G Sbjct: 138 GGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYG 197 Query: 745 XGGGVXGGXXGGGGGGXGXXPAXGXR 668 GGG GG GGGGG G G R Sbjct: 198 GGGGGYGGSGYGGGGGYGGGGYGGGR 223 Score = 42.3 bits (95), Expect = 5e-04 Identities = 28/85 (32%), Positives = 30/85 (35%), Gaps = 1/85 (1%) Frame = -1 Query: 925 GXXGXXGGXGGX-VXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGX 749 G G GG GG GG + G GGG + G G GG G Sbjct: 131 GYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGG 190 Query: 748 XXGGGVXGGXXGGGGGGXGXXPAXG 674 GGG GG G GG G G G Sbjct: 191 YGGGGYGGGGGGYGGSGYGGGGGYG 215 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/81 (33%), Positives = 28/81 (34%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGG 737 G G GG GG G GGGG GG G G G GG Sbjct: 146 GGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Query: 736 GVXGGXXGGGGGGXGXXPAXG 674 GG G GGGG G + G Sbjct: 206 SGYGGGGGYGGGGYGGGRSGG 226 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG G GG G GGGG GG G G G Sbjct: 153 GYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGY---GGGGYGGGGGGYGGSGYG 209 Query: 745 XGGGVXGGXXGGGGGGXG 692 GGG GG GGG G G Sbjct: 210 GGGGYGGGGYGGGRSGGG 227 Score = 39.5 bits (88), Expect = 0.004 Identities = 27/72 (37%), Positives = 28/72 (38%), Gaps = 3/72 (4%) Frame = -1 Query: 898 GGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGX 719 GG GG R G GGG + GG G GG G GGG GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYG---GGGYGGGG 180 Query: 718 XGGG---GGGXG 692 GGG GGG G Sbjct: 181 YGGGGHGGGGYG 192 Score = 32.7 bits (71), Expect = 0.43 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 2/52 (3%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXX--GGGGGGXGXXPAXG 674 GGGG RGG G GG G GGG GG GGGGG G G Sbjct: 123 GGGGR----RGGGYGGGRGGG-GGYRSGGGYRGGGGYRGGGGGYRGRGRGGG 169 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 921 GXXXRGGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGG 766 G RGG GG GGG G GGGG GG GGG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGG 175 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = -1 Query: 742 GGGVXGGXXGGG-GGGXGXXPAXGXR 668 GGG GG GGG GGG G G R Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYR 149 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGG 698 G GGGG GG G GG G GGG GG GGGGGG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG GG GG G GGG GG GGGGGG G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG GG G G G GGG GG GGGGGG G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG GG G G GGG GG GGGGGG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GGGG GG G GG G GG GG GG GGG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GGGG GG G GG GGG GG GGG GG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 906 GGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGGAXR 757 GG GGG GGG G GGGG GGG GGG R Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGR 115 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG GG G GG G GGG GG GGG GG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGGG GG G GG G GGG GG GGGGGG G G Sbjct: 659 GGDGGGGG-----GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGGG GG G GG G GGG GG GG G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG GG G GG G GGG GG G GG G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GG G GGG GG GGGGGG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 690 Score = 33.5 bits (73), Expect = 0.25 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 921 GXXXRGGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGGA 763 G GG GGG GGG G GGGG GGG G GA Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGA 709 Score = 29.5 bits (63), Expect = 4.0 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -2 Query: 906 GGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGGAXRXA 751 GG GGG GGG G GGGG GGG GGA A Sbjct: 659 GGDGGG-GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGA 709 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 42.7 bits (96), Expect = 4e-04 Identities = 28/84 (33%), Positives = 28/84 (33%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GGGG GG G G G Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGG--GGATGGGGGATGGHGGATGGGGGATGDGGG 95 Query: 745 XGGGVXGGXXGGGGGGXGXXPAXG 674 GG G GGGG G A G Sbjct: 96 ATGGGGGATGGGGGATGGHGGATG 119 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/75 (36%), Positives = 27/75 (36%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGG 737 G GG GG GG G GG G GG G GGA G Sbjct: 95 GATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATG-GHGGATGGGGGAT 153 Query: 736 GVXGGXXGGGGGGXG 692 G GG GGGGG G Sbjct: 154 GGGGGATGGGGGATG 168 Score = 41.9 bits (94), Expect = 7e-04 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G G GG GG G GGG GG G GGA G Sbjct: 85 GGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATG-GHGGATGGHG 143 Query: 745 XGGGVXGGXXGGGGGGXG 692 G GG GGGGG G Sbjct: 144 GATGGGGGATGGGGGATG 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG G G GGGG GG G GGA G Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGG-ATGGGGGATGGHGGATGGGV 122 Query: 745 XGGGVXGGXXGGGGGGXG 692 G GG GG GG G Sbjct: 123 GATGGHGGATGGHGGATG 140 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GGGG GG G G Sbjct: 71 GGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGG 130 Query: 745 XGGGVXGGXXGGGGGGXGXXPAXG 674 GG G G GG G A G Sbjct: 131 ATGGHGGATGGHGGATGGGGGATG 154 Score = 37.1 bits (82), Expect = 0.020 Identities = 27/86 (31%), Positives = 27/86 (31%), Gaps = 2/86 (2%) Frame = -1 Query: 925 GXXGXXGGX--GGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXG 752 G G GG GG GG G GGGG GG G G G Sbjct: 48 GATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGG 107 Query: 751 XXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG G GG G G A G Sbjct: 108 GGATGGHGGATGGGVGATGGHGGATG 133 Score = 33.1 bits (72), Expect = 0.33 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG GG G GG G GG G GGA G Sbjct: 106 GGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGG-GGATGG-- 162 Query: 745 XGGGVXGG 722 GGG GG Sbjct: 163 -GGGATGG 169 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G G G GG G G G GGG G GG GG G G Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGG 86 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/47 (42%), Positives = 22/47 (46%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGG + +GG GG G GGG GG GGG GG G Sbjct: 187 GYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGG 233 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGGG GG G G GGG GG GGG GG G G Sbjct: 176 GDSGGGGS---QGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHG 225 Score = 33.9 bits (74), Expect = 0.19 Identities = 23/69 (33%), Positives = 24/69 (34%) Frame = -1 Query: 904 GXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXG 725 G GG GG G GGG + RGG G GG G GGG Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGG---GGYGGGHGGGGYGGGGRH 235 Query: 724 GXXGGGGGG 698 GG GG Sbjct: 236 DYGGGSKGG 244 Score = 33.5 bits (73), Expect = 0.25 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = -2 Query: 909 RGGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGGA 763 +GG GGG GGG G+ GGGG + GGG +GGG+ Sbjct: 199 KGGYGGGSGGGGYGGGR---GGGGYGGGHGGGG---YGGGGRHDYGGGS 241 Score = 31.9 bits (69), Expect = 0.76 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXGXR 668 G G G GGG GG GG GGG G G R Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGR 215 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 760 PXGXXXGGGVXGGXXGGGGGGXG 692 P G GGG GG GGGG G Sbjct: 174 PRGDSGGGGSQGGGYRSGGGGYG 196 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/78 (28%), Positives = 24/78 (30%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXX 873 P P PP P P PP P P PP + P + Sbjct: 903 PTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPI 962 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PP PP PP P Sbjct: 963 PATQVPPPPLPPLPPPPP 980 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/80 (30%), Positives = 27/80 (33%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXG 849 A P P+ P P PP P PPPP P P P + P Sbjct: 907 APPPPL--PLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPA 964 Query: 850 SXXXXXXXPXPXXPXPPPPP 909 + P P P PPPPP Sbjct: 965 T----QVPPPPLPPLPPPPP 980 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 A P P+ P PP P PPPPP + P P Sbjct: 957 ALPPPIPATQVPPPPL-PPLPPPPPPVQTTTAPTLP 991 Score = 29.5 bits (63), Expect = 4.0 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP TP APP P P PPPP P T P Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPP--PIQTTRPTVPTTPTTQASTTRPTP 951 Query: 903 PPXXPXXP 926 PP P Sbjct: 952 PPPTSALP 959 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 A P P P P PP P PPPPP P PP P Sbjct: 74 APPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 A P P P P PP P PPPP P P PP P Sbjct: 64 APPPPAAAPAAPPPPAAPPAAPPPPPP-LPAPPPPP 98 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PPP P AP P PP PPPP P PP P Sbjct: 50 PP--PPPPSPPAAAPAAPP---PPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQ 104 Query: 903 PPXXP 917 PP P Sbjct: 105 PPPAP 109 Score = 32.3 bits (70), Expect(2) = 0.006 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PP P PPPP P PP P Sbjct: 58 PAAAPAAPPPPAAAPAAPPPPAA-PPAAPPPP 88 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +1 Query: 724 PXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXXPXPXXPXPPP 903 P PPP P P PP P P + P P P P P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPP-----PPPAQPAPQP 105 Query: 904 PPXXP 918 PP P Sbjct: 106 PPAPP 110 Score = 25.8 bits (54), Expect(2) = 0.006 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 880 PXXPXPPPPPXXPPXP 927 P P PPPP PP P Sbjct: 82 PAAPPPPPPLPAPPPP 97 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/86 (26%), Positives = 24/86 (27%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXG 849 A P P P PP PPPPP PP P + P Sbjct: 295 AAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMA 354 Query: 850 SXXXXXXXPXPXXPXPPPPPXXPPXP 927 P P P P P PP P Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 34.7 bits (76), Expect = 0.11 Identities = 24/91 (26%), Positives = 24/91 (26%), Gaps = 7/91 (7%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPP-------PPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXP 834 P P P PP PP PPP P P P P Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP 347 Query: 835 KTSXGSXXXXXXXPXPXXPXPPPPPXXPPXP 927 S G P P PPP PP P Sbjct: 348 PPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PP + PPPPP P PP P Sbjct: 374 PPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 33.9 bits (74), Expect = 0.19 Identities = 22/84 (26%), Positives = 25/84 (29%), Gaps = 2/84 (2%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGS- 852 P P + PP + PPPPP PP P S G+ Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 853 -XXXXXXXPXPXXPXPPPPPXXPP 921 P P PPPP PP Sbjct: 347 PPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PPP P PP P PP PPPP Sbjct: 364 PPPPPPPVGGPP-PPPPPIEGRPPSSLGNPPPPP 396 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P PV P PP PPPP P RPP Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 41.5 bits (93), Expect = 0.001 Identities = 24/73 (32%), Positives = 25/73 (34%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXXPXP 882 P PP N P PPPP P PP P K P T + P Sbjct: 347 PPPPTNNPPSPPPPTNNTPP-PPPPTNKPPPPPPPTNGPPPPPPPT---NGPPPPPPPTN 402 Query: 883 XXPXPPPPPXXPP 921 P PPPP PP Sbjct: 403 GPPPPPPPTNGPP 415 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P PP N P PPPPP P PP Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P PP N P PPPPP P PP Sbjct: 378 PPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 2/67 (2%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXN--LXXXXXXXXXXXXPPXTXP 896 PP PPP P PP PP PPPP P N PP T Sbjct: 346 PP--PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG 403 Query: 897 PXPPXXP 917 P PP P Sbjct: 404 PPPPPPP 410 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PPP PP PP PPPP P N PP PP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTN-------GPPPPPPPTNGPPP 406 Query: 903 PPXXPXXP 926 PP P Sbjct: 407 PPPPTNGP 414 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P PP N P PPPPP P PP Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/85 (25%), Positives = 24/85 (28%) Frame = +1 Query: 505 QKKTRAGXXXGGXXXLPPXPPPGXPRXHXKRGXXXGKXXXXXXXXXXXXXXXXXXAXPXP 684 ++ T G GG PP P P P P Sbjct: 331 KRMTVVGTSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Query: 685 VXTPXHPXPPXNXPXPPPPPXPRXP 759 P P PP N P PPPPP P Sbjct: 391 TNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 35.1 bits (77), Expect = 0.081 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PP PPPPP P PP P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 21.8 bits (44), Expect(3) = 9.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 429 NGGXPPPPP 403 NG PPPPP Sbjct: 382 NGPPPPPPP 390 Score = 21.8 bits (44), Expect(3) = 9.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 Query: 429 NGGXPPPPP 403 NG PPPPP Sbjct: 392 NGPPPPPPP 400 Score = 21.4 bits (43), Expect(3) = 9.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 423 GXPPPPPXKXG 391 G PPPPP G Sbjct: 383 GPPPPPPPTNG 393 Score = 21.4 bits (43), Expect(3) = 9.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 291 PXFXPPPPPXP 259 P PPPPP P Sbjct: 390 PTNGPPPPPPP 400 Score = 21.4 bits (43), Expect(3) = 9.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 423 GXPPPPPXKXG 391 G PPPPP G Sbjct: 393 GPPPPPPPTNG 403 Score = 21.4 bits (43), Expect(3) = 9.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 291 PXFXPPPPPXP 259 P PPPPP P Sbjct: 400 PTNGPPPPPPP 410 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG G V G G GGG GG G GA G Sbjct: 41 GGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAA--GAAGAGAGGN 98 Query: 745 XGGGVXGGXXGGGGGG 698 GGG GG G GG G Sbjct: 99 VGGGGSGGVGGNGGSG 114 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG G G GGGG GG G G Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCGGGN--DGGNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Query: 745 XGGGVXGGXXGGGGGGXG 692 GG V GG GG GG G Sbjct: 95 AGGNVGGGGSGGVGGNGG 112 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGG + GG G GG G GGG G GGG G G A G Sbjct: 43 GGNGGGAGNGVGAGGC---GCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAG 92 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGGG G G G G G G G GGGGGG G A G Sbjct: 37 GGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAG 89 Score = 34.7 bits (76), Expect = 0.11 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 2/83 (2%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGG 737 G G GG GG G GGG GG G GG G Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAA 88 Query: 736 GVXGGXXGG--GGGGXGXXPAXG 674 G G GG GGGG G G Sbjct: 89 GAAGAGAGGNVGGGGSGGVGGNG 111 Score = 31.9 bits (69), Expect = 0.76 Identities = 24/78 (30%), Positives = 24/78 (30%) Frame = -1 Query: 907 GGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVX 728 GG G V GG G G G G G GGA G GG Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGA---GNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGN 84 Query: 727 GGXXGGGGGGXGXXPAXG 674 GG G G G G G Sbjct: 85 GGAAGAAGAGAGGNVGGG 102 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +1 Query: 676 PXPVXT--PXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P+ T P P PP P PPPPP P+ PP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 36.7 bits (81), Expect = 0.027 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 PP PPP P PP P TPP PPPP P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPP------PPPPSTP 714 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXP 759 P P P P PP P PPPP P P Sbjct: 687 PPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 32.3 bits (70), Expect = 0.57 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG G GG GG GG G Sbjct: 557 GSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGN 616 Query: 745 XGGGVXGGXXGGGGGG 698 GG GG GG GG Sbjct: 617 TGGNNNGGNTGGNNGG 632 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 683 PPPPPPPPPPPPPPPPPP 700 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 684 PPPPPPPPPPPPPPPPPP 701 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 686 PPPPPPPPPPPPPPPPQP 703 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 767 PPPXXXNPPPXQXKXPPPPXXXXKP 841 PPP PPP Q PPPP P Sbjct: 691 PPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P PP P P P P P PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PPP PP P TPP P P Sbjct: 692 PPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 767 PPPXXXNPPPXQXKXPPPPXXXXKP 841 PPP PPP PPPP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPP 707 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP P P Sbjct: 689 PPPPPPPPPPPPPQPSTP 706 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPP P PP P Sbjct: 692 PPPPPPPPPPQPSTPPPP 709 Score = 28.3 bits (60), Expect = 9.3 Identities = 18/70 (25%), Positives = 18/70 (25%) Frame = -1 Query: 907 GGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVX 728 G GG G G GG GG G G GG Sbjct: 576 GNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTG 635 Query: 727 GGXXGGGGGG 698 G GG GG Sbjct: 636 GNNNGGNSGG 645 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -1 Query: 907 GGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVX 728 GG GG G R G GGG G G GG G G G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTG 186 Query: 727 GGXXGGGGGGXG 692 GG GGGG G G Sbjct: 187 GGSRGGGGDGRG 198 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/56 (41%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGG-GGGGXGXXPAXGXR 668 G G G + RGG G GG G GG GG GG GGGG G G R Sbjct: 137 GGEGNGAGGGIGRGG--GRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSR 190 Score = 37.1 bits (82), Expect = 0.020 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G G GG G R G G GG GG G GG G Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGG--NGGGRGGGEGGGGRGRG 184 Query: 745 XGGGVXGGXXGGGGGGXG 692 GGG GG G G G G Sbjct: 185 TGGGSRGGGGDGRGRGRG 202 Score = 33.5 bits (73), Expect = 0.25 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 4/62 (6%) Frame = -1 Query: 841 RFXGXXGGGGXFXLXRGGVXXXGXGGA---PXGXXXGGGVXG-GXXGGGGGGXGXXPAXG 674 R G GG RGG G GG G GGG G G GG GGG G G Sbjct: 120 RRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGG 179 Query: 673 XR 668 R Sbjct: 180 GR 181 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 A P P P P PP P PPPPP P P PP P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFP--PPPPPTP 496 Score = 35.9 bits (79), Expect = 0.046 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNL 842 PP PPP P PP P PP PPPP P +L Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFP----PPPPPTPLHL 499 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPP 481 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 465 PPPPPPPPPPPPPPPPPP 482 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 466 PPPPPPPPPPPPPPPPPP 483 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 467 PPPPPPPPPPPPPPPPPP 484 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 468 PPPPPPPPPPPPPPPPPP 485 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 469 PPPPPPPPPPPPPPPPPP 486 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 470 PPPPPPPPPPPPPPPPPP 487 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 472 PPPPPPPPPPPPPPPPFP 489 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 475 PPPPPPPPPPPPPFPPPP 492 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 476 PPPPPPPPPPPPFPPPPP 493 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 764 APPPXXXNPPPXQXKXPPPP 823 APPP PPP PPPP Sbjct: 463 APPPPPPPPPPPPPPPPPPP 482 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 3/79 (3%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFX--LXRGGVXXXGX-GGAPX 755 G G V GG F G G GG GGV G P Sbjct: 167 GGNGATSTSSSHVGGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPG 226 Query: 754 GXXXGGGVXGGXXGGGGGG 698 G GGGV G GGGGGG Sbjct: 227 GFGGGGGVWGNGGGGGGGG 245 Score = 33.5 bits (73), Expect = 0.25 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGG 701 GG G + G G GG G GGG GG GGG G Sbjct: 213 GGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGGGSG 253 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGG 698 GG G GG G GGGV GG GGGGGG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGG 105 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGG 698 GG G GG G GGG GG GGG Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 754 GXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGG GG GGGGG G G Sbjct: 76 GDTDGGGGCGGGGGGGGGVGGGGGGGG 102 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGG 698 GGGG RGG GG G GGG GG GG GGG Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 33.1 bits (72), Expect = 0.33 Identities = 25/71 (35%), Positives = 25/71 (35%) Frame = -1 Query: 904 GXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXG 725 G GG GG R G GGG GG G GG G GGG G Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSR--GGYGGGRG-----GGGYGGGRGGGGYGGGRGGGYGG 139 Query: 724 GXXGGGGGGXG 692 G GGG G Sbjct: 140 GRRDYGGGSKG 150 Score = 32.3 bits (70), Expect = 0.57 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = -1 Query: 841 RFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 R G GGG + GG G GG GGG GG GGGG G G G Sbjct: 92 RAGGYRSGGGGY----GGSSRGGYGGG-----RGGGGYGGGRGGGGYGGGRGGGYG 138 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/53 (37%), Positives = 23/53 (43%) Frame = -2 Query: 921 GXXXRGGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGGA 763 G RGG GGG GGG G+ GGG GGG +GGG+ Sbjct: 104 GGSSRGGYGGGRGGGGYGGGR---GGGGYGGGRGGG-----YGGGRRDYGGGS 148 Score = 30.7 bits (66), Expect = 1.7 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGG-GGGXGXXPAXGXR 668 G G GG R G G GG G GG GG GGG GGG G G R Sbjct: 84 GERGAGGS----RAGGYRSGGGG--YGGSSRGGYGGGRGGGGYGGGRGGGGYGGGR 133 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 GG G GG G GGG GG GGGGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 GG G GG G GGG GG GGGGGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 GG G GG G GGG GG GGGGGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GG G GGG GG GGGGGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GG G GGG GG GGGGGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GG G GGG GG GGGGGG G G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXG 713 GGGG GG G GG G GGG GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 28.3 bits (60), Expect = 9.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGG 707 G GGGG GG G GG G GGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 39.5 bits (88), Expect = 0.004 Identities = 26/92 (28%), Positives = 28/92 (30%), Gaps = 6/92 (6%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNX----PXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPK 837 A P P P PP + P PPPP P PP P Sbjct: 116 APETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAAT 175 Query: 838 TSXGSXXXXXXXPXPXX--PXPPPPPXXPPXP 927 + P P P PPPPP PP P Sbjct: 176 VPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPXP 905 P PPP G PP P P PPP + PP + P P Sbjct: 138 PPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPP 197 Query: 906 PXXPXXP 926 P P P Sbjct: 198 PPPPPPP 204 Score = 35.9 bits (79), Expect = 0.046 Identities = 27/98 (27%), Positives = 29/98 (29%), Gaps = 14/98 (14%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPP--------PXPRXPXRP----PXPXXKXXXXXXXXXXX 819 P P P P P P PPPP P P P P P P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Query: 820 XXXXPKTSXGSXXXXXXXPXPXXP--XPPPPPXXPPXP 927 P + + P P PPPPP PP P Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 33.5 bits (73), Expect = 0.25 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRP 768 P PP P PPPPP P P P Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPP 209 Score = 32.3 bits (70), Expect = 0.57 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP P P AP P T P PPPP P P PP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPAT---GGPPPPPPIAPATGGPPP 166 Query: 903 PP 908 PP Sbjct: 167 PP 168 Score = 32.3 bits (70), Expect = 0.57 Identities = 25/95 (26%), Positives = 26/95 (27%) Frame = +1 Query: 493 PXPXQKKTRAGXXXGGXXXLPPXPPPGXPRXHXKRGXXXGKXXXXXXXXXXXXXXXXXXA 672 P P TRA PPP P G + Sbjct: 128 PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAAS 187 Query: 673 XPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P PP P PPPPP PP P Sbjct: 188 PPPPSGGPPPPPPP---PPPPPPPPILELAAPPPP 219 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PP P PP P PP PPPP Sbjct: 188 PP--PPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 692 PXPTPXXXXXXXXXXXXXXXAXRXAPPPXXXNPPPXQXKXPPPP 823 P P P A PPP PPP PPPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/59 (27%), Positives = 17/59 (28%) Frame = +3 Query: 732 TPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPXPP 908 TP P AP P P P PP P + P PP PP Sbjct: 97 TPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP 155 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 37.9 bits (84), Expect = 0.012 Identities = 24/84 (28%), Positives = 26/84 (30%), Gaps = 2/84 (2%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSX 855 P + TP P P + P P PP P P P P P S Sbjct: 182 PSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPS--KA 239 Query: 856 XXXXXXPXPXXPXPP--PPPXXPP 921 P P P PP P P PP Sbjct: 240 IATPNPPMPETPLPPATPNPFIPP 263 Score = 37.1 bits (82), Expect = 0.020 Identities = 26/91 (28%), Positives = 28/91 (30%), Gaps = 5/91 (5%) Frame = +1 Query: 670 AXPXPVXTPXHPXP--PXNXPXP--PPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXP- 834 A P P P P P P P P P PP P P PP P Sbjct: 255 ATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHI 314 Query: 835 KTSXGSXXXXXXXPXPXXPXPPPPPXXPPXP 927 + + P P P PP P PP P Sbjct: 315 PPAPPNPYIPTAPPNPSIPPAPPNPSIPPAP 345 Score = 34.3 bits (75), Expect = 0.14 Identities = 24/88 (27%), Positives = 26/88 (29%), Gaps = 2/88 (2%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPX--NXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTS 843 A P P P P PP N PP P P P PP P + Sbjct: 241 ATPNP-PMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPA 299 Query: 844 XGSXXXXXXXPXPXXPXPPPPPXXPPXP 927 + P P P PP P P P Sbjct: 300 PPNLFIPSAPPNPHIPPAPPNPYIPTAP 327 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P N PP PP P P PP P Sbjct: 315 PPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNP 348 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PP P PP PP P P PP P Sbjct: 177 PKPPAPSTIPTPP-TPPAPPSPPIPTAPPTPPMP 209 Score = 32.7 bits (71), Expect = 0.43 Identities = 20/82 (24%), Positives = 20/82 (24%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXX 861 P P P P P PP PP P P P P P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPP 231 Query: 862 XXXXPXPXXPXPPPPPXXPPXP 927 P P PP P P Sbjct: 232 APPNPSKAIATPNPPMPETPLP 253 Score = 31.9 bits (69), Expect = 0.76 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P N PP PP P P PP Sbjct: 324 PTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/89 (23%), Positives = 24/89 (26%), Gaps = 5/89 (5%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXG-- 849 P P +P P P + PP PP P P P + Sbjct: 212 PLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIP 271 Query: 850 ---SXXXXXXXPXPXXPXPPPPPXXPPXP 927 P P P PP P PP P Sbjct: 272 PAPPNPSIPAPPNPSIPLAPPNPYIPPAP 300 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 670 AXPXPVX--TPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 A P P P +P P P P PP P P PP P Sbjct: 317 APPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAP 354 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PP + P PPPPP P P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP--PPPPPTP 1186 Score = 35.1 bits (77), Expect = 0.081 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXP 750 P P P P PP P PPPPP P Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXP 759 P P P P P P PPPPP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 33.1 bits (72), Expect = 0.33 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXP 759 P P P P P P PPPPP P P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 1166 PPPSSPSPPPPPPPPPPP 1183 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PPP P +P P PP PPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPP------PPPP 1184 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 767 PPPXXXNPPPXQXKXPPPPXXXXKP 841 PPP PPP PPPP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 880 PXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 1171 PSPPPPPPPPPPPPTP 1186 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 767 PPPXXXNPPPXQXKXPPPPXXXXKP 841 PPP PPP PPPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 P PPP P + P P PP PPPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP------PPPPPTP 1186 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPP 1174 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 33.1 bits (72), Expect = 0.33 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PP P PPPPP P P P P Sbjct: 557 PPPGVDIPPPLPPSEDPKPPPPP-PEPPEECPPP 589 Score = 30.7 bits (66), Expect(2) = 0.014 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 682 PVXTPXH--PXPPXNXPXPPPPPXPRXPXRPPXP 777 P TP P PP PPP P P PP P Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPP 579 Score = 29.1 bits (62), Expect(2) = 0.58 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXP-PPPPXPRXPXRPPXP 777 P P P P + P P PP P+ P PP P Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 Score = 26.6 bits (56), Expect(2) = 0.26 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPP 921 P P PPPPP PP Sbjct: 568 PPSEDPKPPPPPPEPP 583 Score = 25.8 bits (54), Expect(2) = 0.014 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P P PP PP P Sbjct: 573 PKPPPPPPEPPEECPPPP 590 Score = 25.4 bits (53), Expect(2) = 0.26 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 4/38 (10%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPP----PXPRXPXRPPXP 777 P P P P P PPPP P P P P P Sbjct: 540 PIPAVAPA--VTPSEEPPPPPPGVDIPPPLPPSEDPKP 575 Score = 21.8 bits (44), Expect(2) = 0.58 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 874 PXPXXPXPPPPP 909 P P PPPPP Sbjct: 580 PEPPEECPPPPP 591 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 37.5 bits (83), Expect = 0.015 Identities = 26/76 (34%), Positives = 29/76 (38%), Gaps = 1/76 (1%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGG 737 G GG GG + GG G GGG GG+ GG G G Sbjct: 152 GMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGG-----MGGGMEGGMGGGMMEGMQGMG 206 Query: 736 GVXGGXXGGG-GGGXG 692 + GG GGG GGG G Sbjct: 207 SMGGGMMGGGMGGGMG 222 Score = 34.7 bits (76), Expect = 0.11 Identities = 24/84 (28%), Positives = 26/84 (30%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG G GG GG+ G GG G Sbjct: 105 GGMGPMAPEGGPSEGGLMQKQFIEGGEGGMGGGMSMGGGMG---GGMSMGGMGGGMGGMM 161 Query: 745 XGGGVXGGXXGGGGGGXGXXPAXG 674 GG + GG GGG G G Sbjct: 162 GGGSMGGGMMSMAGGGMGGGMGGG 185 Score = 33.5 bits (73), Expect = 0.25 Identities = 25/78 (32%), Positives = 29/78 (37%), Gaps = 2/78 (2%) Frame = -1 Query: 925 GXXGXXGGX--GGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXG 752 G G GG GG + GG G GGG + GG+ G Sbjct: 130 GEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGM----------G 179 Query: 751 XXXGGGVXGGXXGGGGGG 698 GGG+ GG GG GGG Sbjct: 180 GGMGGGMGGGMEGGMGGG 197 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 37.5 bits (83), Expect = 0.015 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 889 VXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGG 710 V GG R G GG G GGV G GGG G GG Sbjct: 214 VSGGGGGGFYTDGQGSRNKGGSGGEGGKAFLHGGVGGRQFSSNSYGGFGGGGGACGCNGG 273 Query: 709 GGGGXGXXPAXGXR 668 G GG G G R Sbjct: 274 GAGGGGGYSGGGLR 287 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 37.5 bits (83), Expect = 0.015 Identities = 28/72 (38%), Positives = 28/72 (38%) Frame = -1 Query: 907 GGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVX 728 GG GG GG G GGG RGG G GG G GGG Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGY---GNRSGGGY----RGG---GGYGGGGGGYRGGGGYG 779 Query: 727 GGXXGGGGGGXG 692 GG GGGG G G Sbjct: 780 GGHRGGGGYGGG 791 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/53 (37%), Positives = 22/53 (41%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GG + +GG GG G GGG GG GGGG G G G Sbjct: 736 GYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGG-GGGYRGGGGYGGGHRGGGG 787 Score = 31.9 bits (69), Expect = 0.76 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -2 Query: 909 RGGXGGGXXGGGXXXXXXX*XXXGFXXXXG--GGGXLXWXGGGFXXWGG 769 RGG GGG GGG G G GGG GGG+ GG Sbjct: 729 RGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGG 777 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 35.1 bits (77), Expect = 0.081 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXP 750 P P P P PP P PPPPP P Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 34.3 bits (75), Expect(2) = 0.015 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXK 786 P P P PP P PPPPP P PP P K Sbjct: 216 PEPDYLEPTPPPPA-APAPPPPPAAAPPPPPPPPPVK 251 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 P PP PP P PP PPPP P Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPP 247 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 732 TPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 TPPP P APP P PP PPPP P Sbjct: 224 TPPPPAAP--APPPPPAAAPP------PPPPPPP 249 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP P P Sbjct: 226 PPPAAPAPPPPPAAAPPP 243 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P PP PPPP P P + P Sbjct: 228 PAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 27.5 bits (58), Expect(2) = 0.076 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 691 TPXHPXPPXNXPXPPPPPXPRXPXRPP 771 TP +P P PPPP P PP Sbjct: 211 TPVNPPEPDYLEPTPPPPAAPAPPPPP 237 Score = 26.6 bits (56), Expect(2) = 0.076 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPP 921 P P PPPPP PP Sbjct: 234 PPPPAAAPPPPPPPPP 249 Score = 22.2 bits (45), Expect(2) = 0.015 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 889 PXPPPPPXXPP 921 P PPPPP P Sbjct: 243 PPPPPPPVKKP 253 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 33.5 bits (73), Expect(2) = 0.018 Identities = 16/36 (44%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPP--PPXPRXPXRPPXP 777 P P+ T PP + P PPP PP P P PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTP-PPTEPPTP 1050 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 676 PXPVXTPXHPX--PPXNXPXPPPPPXPRXPXRPP 771 P P P P PP P PP P P P PP Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPP 1051 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 685 VXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 V P PP P PP P P P PP Sbjct: 1015 VPDPLPTDPPTEPPTDPPTPPPTEPPTPP 1043 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 P T PP P PP TPP PPP P Sbjct: 1023 PPTEPPTDPP--TPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 22.6 bits (46), Expect(2) = 0.018 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPP 921 P P P P PPP PP Sbjct: 1042 PPPTEP-PTPPPTDPP 1056 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 37.1 bits (82), Expect = 0.020 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 820 GGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G G GG G GG G GGG GG GGGGG G Sbjct: 167 GDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDG 209 Score = 28.7 bits (61), Expect = 7.1 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 2/49 (4%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXG--GGGGGXG 692 G GGG GG G GG G GGG GG G GGG G G Sbjct: 151 GDGDGGGS---DDGGDDDDGDGGGSNGS--GGGDDGGDGGDDGGGSGGG 194 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 37.1 bits (82), Expect = 0.020 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 787 VXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 V G GG G GGG GG GGGGGG G Sbjct: 21 VLRDGGGGHGGGHGYGGGPNGGGGGGGGGGGG 52 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 796 RGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGG 701 R G G G G GGG GG GGGGG Sbjct: 23 RDGGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -1 Query: 808 FXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGG 698 + L GG G G G GGG GG GGGGGG Sbjct: 20 YVLRDGGGGHGGGHGYGGGPNGGGGGGGG--GGGGGG 54 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 754 GXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G G G GG GGGGGG G G Sbjct: 28 GHGGGHGYGGGPNGGGGGGGGGGGGGG 54 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 37.1 bits (82), Expect = 0.020 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGA-PXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG G GGV P G GGG GG GGGGGG A G Sbjct: 464 GGEGGKAFLNGGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGGACG 514 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 921 GXXXRGGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXL 805 G GG GGG GGG G GGGG L Sbjct: 492 GGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGGGDL 530 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 37.1 bits (82), Expect = 0.020 Identities = 22/84 (26%), Positives = 25/84 (29%), Gaps = 4/84 (4%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXP----PPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXG 849 P+ P P PP + P P PPPP P PP PK + Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPA 1114 Query: 850 SXXXXXXXPXPXXPXPPPPPXXPP 921 P PPPP P Sbjct: 1115 PRPRSWVESQPELHRPPPPIKPKP 1138 Score = 35.9 bits (79), Expect = 0.046 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 3/78 (3%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXXPXP 882 P PP P PPP P P R P P P TS P P Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPS----EPAPPPRQPPPPSTSQPVPPPRQPDPIP 1095 Query: 883 XXPXPP--PPPXXP-PXP 927 P P PPP P P P Sbjct: 1096 TNPAHPTEPPPRQPKPTP 1113 Score = 33.1 bits (72), Expect = 0.33 Identities = 18/76 (23%), Positives = 22/76 (28%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXX 861 P+ P P PP + PPP P P P P + + Sbjct: 1040 PLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPA 1099 Query: 862 XXXXPXPXXPXPPPPP 909 P P P P P P Sbjct: 1100 HPTEPPPRQPKPTPAP 1115 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/87 (25%), Positives = 23/87 (26%), Gaps = 5/87 (5%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP-----XPXXKXXXXXXXXXXXXXXXPKT 840 P P P P + P P P PR P PP P K P Sbjct: 1020 PGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 Query: 841 SXGSXXXXXXXPXPXXPXPPPPPXXPP 921 S P P P P PP Sbjct: 1080 STSQPVPPPRQPDPIPTNPAHPTEPPP 1106 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = +1 Query: 676 PXPVXT-PXHPX-PPXNXPXPPPPPXPR 753 P P+ T P HP PP P P P P PR Sbjct: 1091 PDPIPTNPAHPTEPPPRQPKPTPAPRPR 1118 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 36.7 bits (81), Expect = 0.027 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPXP 905 P PP P PP P PP PPPP P L P PP P Sbjct: 93 PACPPACCAPP--PPPPPPPPPP------PPPPPPPITLHHEQHVVSHVMHPAPPPPPPP 144 Query: 906 PXXPXXP 926 P P P Sbjct: 145 PPAPCMP 151 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXP 750 A P P P PP P PPPPP P Sbjct: 94 ACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 32.3 bits (70), Expect = 0.57 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = +1 Query: 691 TPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXX 870 T P P PPPPP P P PP P P T Sbjct: 89 TSCAPACPPACCAPPPPPPPPPPPPPPPP----------------PPPITLHHEQHVVSH 132 Query: 871 XPXPXXPXPPPPPXXPPXP 927 P P PPPPP P P Sbjct: 133 VMHPAPPPPPPPPPAPCMP 151 Score = 31.9 bits (69), Expect = 0.76 Identities = 21/71 (29%), Positives = 21/71 (29%) Frame = +1 Query: 709 PPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXXPXPXX 888 P P PPPPP P P PP P P P Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAP---------------PPP 141 Query: 889 PXPPPPPXXPP 921 P PPP P PP Sbjct: 142 PPPPPAPCMPP 152 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P PP P PPPPP P P PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPP--PPPPP 120 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 36.7 bits (81), Expect = 0.027 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 735 PPPXXXPXGAPPXPXXXTPPRX-NXXIPPPPXXP 833 PPP P GAPP P PP + PPPP P Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXP---XRPPXP 777 P P PP P PPPPP P P PP P Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 33.5 bits (73), Expect = 0.25 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PPP P PP P PP PPPP Sbjct: 304 PPPPPPPGGAPP--PPPPPPPPPPGDGGAPPPPP 335 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PP P PPPP P PP P Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 32.3 bits (70), Expect(2) = 0.057 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +1 Query: 694 PXHPXPPXNX--PXPPPPPXPRXPXRPPXP 777 P P PP + P PPPPP P PP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPP 319 Score = 32.3 bits (70), Expect = 0.57 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 832 PKTSXGSXXXXXXXPXPXXPXPPPPPXXPPXP 927 P + GS P P PPPPP PP P Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 A P P PP P PPPPP PP P Sbjct: 301 APAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP P P PP P PP PPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 29.5 bits (63), Expect(2) = 0.36 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P P PPP P P PP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPP 323 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 P PPP G+ P P PP PPPP P Sbjct: 290 PVPPPPPAD--GSAPAPPPPPPPGGAPPPPPPPPPP 323 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 767 PPPXXXNPPPXQXKXPPPPXXXXKP 841 PPP PPP PPPP P Sbjct: 307 PPPPGGAPPPPPPPPPPPPGDGGAP 331 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PP PPPPP P PP P Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPP----PPPPPPP 325 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXT 788 PP PPP GAPP P T Sbjct: 317 PPPPPPPPPGDGGAPPPPPPPT 338 Score = 22.2 bits (45), Expect(2) = 0.36 Identities = 10/21 (47%), Positives = 10/21 (47%), Gaps = 5/21 (23%) Frame = +1 Query: 874 PXPXXPXPPP-----PPXXPP 921 P P P PPP PP PP Sbjct: 316 PPPPPPPPPPGDGGAPPPPPP 336 Score = 22.2 bits (45), Expect(2) = 0.057 Identities = 10/21 (47%), Positives = 10/21 (47%), Gaps = 5/21 (23%) Frame = +1 Query: 874 PXPXXPXPP-----PPPXXPP 921 P P P PP PPP PP Sbjct: 317 PPPPPPPPPGDGGAPPPPPPP 337 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 35.9 bits (79), Expect = 0.046 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP T PP P P PP PPP P + PP T PP Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Query: 903 PPXXPXXP 926 P P Sbjct: 223 IFPQPTTP 230 Score = 29.9 bits (64), Expect = 3.1 Identities = 21/84 (25%), Positives = 23/84 (27%), Gaps = 2/84 (2%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXP--RXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSX 855 P T P PP + P PPP P P P P +T S Sbjct: 189 PPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTPAPTKCQVINTKETGEVSN 248 Query: 856 XXXXXXPXPXXPXPPPPPXXPPXP 927 P P P PP P Sbjct: 249 KMILLQDEVLCPTSPSPVTCPPCP 272 Score = 28.3 bits (60), Expect = 9.3 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTX-PPX 902 P TP P P +P PPR PPP P + PP T PP Sbjct: 147 PTTPAPMTLPPISP-----IDPPRTQ----PPPIFPIDPPRTQPPPIPPIDPPRTQPPPI 197 Query: 903 PPXXP 917 PP P Sbjct: 198 PPIDP 202 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P T P PP + P PPP P P PP Sbjct: 176 PPRTQPPPIPPIDPPRTQPPPIP--PIDPP 203 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 35.9 bits (79), Expect = 0.046 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 3/53 (5%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGG---GGXGXXPAXG 674 GGGG RGG GG G GGG GG GGG GG G + G Sbjct: 142 GGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYG 194 Score = 35.5 bits (78), Expect = 0.061 Identities = 25/81 (30%), Positives = 25/81 (30%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGG 737 G GG GG G G GGGG GG G G GG Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGG 197 Query: 736 GVXGGXXGGGGGGXGXXPAXG 674 GG GGG G G G Sbjct: 198 DYGGGPGYGGGQGYGSYSGGG 218 Score = 29.9 bits (64), Expect = 3.1 Identities = 24/74 (32%), Positives = 25/74 (33%), Gaps = 1/74 (1%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRG-GVXXXGXGGAPXGXXXG 740 G GG G GG G GGG + G G G G G G Sbjct: 149 GYRGGYRGGYRGGRDRGGGYGGGGE--GGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYG 206 Query: 739 GGVXGGXXGGGGGG 698 GG G GGGGG Sbjct: 207 GGQGYGSYSGGGGG 220 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PPP GAPP P PP PPPP Sbjct: 662 PPPPPPPGGQAGGAPPPP---PPPLPGGAAPPPP 692 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 A P P P P PPPPP P PP P Sbjct: 658 AGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P PP PPPP P PP P Sbjct: 676 PPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 23.4 bits (48), Expect(2) = 7.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 438 GXXNGGXPPPPP 403 G GG PPPPP Sbjct: 669 GGQAGGAPPPPP 680 Score = 23.4 bits (48), Expect(2) = 7.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 Query: 426 GGXPPPPPXKXG 391 GG PPPPP G Sbjct: 697 GGAPPPPPPGFG 708 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 35.5 bits (78), Expect = 0.061 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXX-GXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 GGGG RGG G GG G GGG GG GGG G Sbjct: 195 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKG 239 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GG + GG GG G GGG GG GGGG G G Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGY-GGGRGGGGYGGGRGGGGGYGGG 229 Score = 31.9 bits (69), Expect = 0.76 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -1 Query: 796 RGGVXXXGXGGAPXGXXXGGGVXGGXXGG-GGGGXGXXPAXG 674 RGG G G G GG GG GG GGGG G G Sbjct: 182 RGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGG 223 Score = 31.5 bits (68), Expect = 1.0 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGG-GGGXGXXPAXG 674 GGGG +GG G GG G GG GG GGG GGG G G Sbjct: 183 GGGGS----QGGGYRSGGGG--YGGSSRGGYGGGRGGGGYGGGRGGGGGYG 227 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 775 GXGGAPXGXXX--GGGVXGGXXGGGGGGXGXXPAXGXR 668 G GG+ G GGG G GG GGG G G R Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGR 220 Score = 28.3 bits (60), Expect = 9.3 Identities = 20/53 (37%), Positives = 23/53 (43%) Frame = -2 Query: 921 GXXXRGGXGGGXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGGA 763 G RGG GGG GGG + GGGG GGG +GGG+ Sbjct: 200 GGSSRGGYGGGRGGGG------------YGGGRGGGGGY---GGGRRDYGGGS 237 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 PP PPP G PP P PP PPPP P Sbjct: 455 PPNLPPPPGGMRGMPPPPMGMYPPPRG--FPPPPFGP 489 Score = 30.3 bits (65), Expect = 2.3 Identities = 25/85 (29%), Positives = 26/85 (30%), Gaps = 1/85 (1%) Frame = +1 Query: 676 PXPVXT-PXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGS 852 P P T P P PP P PP P PP P P+ G Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQ-LPPNLPPPPGGMRGMPPPPMGMYPP--PR---GF 482 Query: 853 XXXXXXXPXPXXPXPPPPPXXPPXP 927 P P PPPP PP P Sbjct: 483 PPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 29.1 bits (62), Expect = 5.3 Identities = 20/69 (28%), Positives = 23/69 (33%), Gaps = 2/69 (2%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPX--PXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPP 899 P P P PP P PP+ +PPP P + PP PP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPP---PGGMRGMPPPPMGMYPPPRGFPP 484 Query: 900 XPPXXPXXP 926 PP P P Sbjct: 485 -PPFGPPPP 492 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 35.1 bits (77), Expect = 0.081 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PPPPP P P PP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXP 759 P P P PP P PPPPP P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 862 PRPRRPPPPPPPPPPPPP 879 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 867 PPPPPPPPPPPPPPPPPP 884 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 868 PPPPPPPPPPPPPPPPPP 885 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPP 744 P P P P PP P PPPPP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPP 884 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXP 750 P P P PP P PPPPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 28.7 bits (61), Expect = 7.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 860 PRPRPRRPPPPPPPPPPP 877 Score = 28.7 bits (61), Expect = 7.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 864 PRRPPPPPPPPPPPPPPP 881 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 767 PPPXXXNPPPXQXKXPPPP 823 PPP PPP PPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 35.1 bits (77), Expect = 0.081 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRP 768 A P P+ P P PP P PPPPP + P P Sbjct: 71 ATPPPLCAPPPPPPPP--PPPPPPPGAKKPDDP 101 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 73 PPPLCAPPPPPPPPPPPP 90 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 767 PPPXXXNPPPXQXKXPPPPXXXXK 838 PPP PPP PPPP K Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAK 96 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 74 PPLCAPPPPPPPPPPPPP 91 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 75 PLCAPPPPPPPPPPPPPP 92 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 35.1 bits (77), Expect = 0.081 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGGGGXG 692 GG G GGG GG GGGGGG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGGGG 698 GG G GGG GG GGGGGG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 754 GXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGG GG GGGGGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 35.1 bits (77), Expect = 0.081 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRP 768 A P P+ P P PP P PPPPP + P P Sbjct: 272 ATPPPLCAPPPPPPPP--PPPPPPPGAKKPDDP 302 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 274 PPPLCAPPPPPPPPPPPP 291 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 767 PPPXXXNPPPXQXKXPPPPXXXXK 838 PPP PPP PPPP K Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAK 297 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 275 PPLCAPPPPPPPPPPPPP 292 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 276 PLCAPPPPPPPPPPPPPP 293 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 35.1 bits (77), Expect = 0.081 Identities = 20/48 (41%), Positives = 22/48 (45%) Frame = -1 Query: 841 RFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGG 698 R G GGGG + GG G G + G GGG GGGGGG Sbjct: 97 RERGGRGGGGGYG---GGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 31.9 bits (69), Expect = 0.76 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGG--XXGGGGGGXG 692 GG G G G GGG GG GGGGGG G Sbjct: 94 GGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGG 129 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGG 698 GGGG RGG G G G GG GG GGGGGG Sbjct: 92 GGGGR--RERGGRGGGGGYGGGGGYGGGGRSYGG--GGGGGG 129 Score = 28.3 bits (60), Expect = 9.3 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 3/38 (7%) Frame = -1 Query: 796 RGGVXXXGXGGAPXGXXXGGGVXGGXXGGG---GGGXG 692 RGG GG G GGG GG GGG GGG G Sbjct: 91 RGGGGRRERGGRGGGGGYGGG--GGYGGGGRSYGGGGG 126 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 35.1 bits (77), Expect = 0.081 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP TPPP P PP P PP + PP P Sbjct: 97 PPATPPPPTMPP-TPPPPQTPAPPGPDTPAPPAP 129 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPP--PXPRXPXRPPXP 777 P P PP P PPPP P P P P P Sbjct: 98 PATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 767 PPPXXXNPPPXQXKXPPPPXXXXKP 841 PPP PPP PPPP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPP 119 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXP 777 P PP P P PP P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPP 119 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P TP PP P PPPP P P P Sbjct: 95 PPPPATP----PPPTMPPTPPPPQTPAPPGPDTP 124 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXGXR 668 G G GG L G G GGG G GGGGGG A G R Sbjct: 443 GTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSR 497 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 PP PPP G PP P P PPPP P Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PPP P P PP +PPPP P P P Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPP 755 Query: 903 PP 908 PP Sbjct: 756 PP 757 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +1 Query: 682 PVXTPXHPXPPX--NXPXPPPPPXPRXPXRPPXP 777 P+ P P PP P PPP P P PP P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPP 743 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/71 (26%), Positives = 22/71 (30%), Gaps = 4/71 (5%) Frame = +3 Query: 726 PXTPPPXXXPXGA----PPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTX 893 P PPP G+ PP P PP + +P PP P P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGC 736 Query: 894 PPXPPXXPXXP 926 PP P P Sbjct: 737 AGLPPPPPPPP 747 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P+ + P PP PPPPP P PP P Sbjct: 701 PPPLLSGTLPMPP-----PPPPPPPGCAGLPPPP 729 Score = 29.1 bits (62), Expect = 5.3 Identities = 24/92 (26%), Positives = 26/92 (28%), Gaps = 8/92 (8%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXP-----RXPXRPPXPXXKXXXXXXXXXXXXXXXPKT 840 P P P + P PPPPP P P PP P P+ Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPP---PPPPGCAGLPPPPPSPQP 734 Query: 841 SXGSXXXXXXXPXP---XXPXPPPPPXXPPXP 927 P P P PPPP P P Sbjct: 735 GCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 676 PXPVXTPXHPXPPX--NXPXPPPPPXPRXPXR 765 P V P P PP N P PPPPP P + Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPPQK 108 Score = 30.3 bits (65), Expect(2) = 0.11 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 685 VXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 V T P P PPPPP P PP P Sbjct: 71 VETTDGPAAVIPPPPPPPPPASNVPAPPPPP 101 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPR 797 PP PPP APP P PP+ Sbjct: 83 PPPPPPPPASNVPAPPPPPPVMPPQ 107 Score = 23.0 bits (47), Expect(2) = 0.11 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 895 PPPPPXXPP 921 PPPPP PP Sbjct: 98 PPPPPVMPP 106 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 P PPP P APP P PP PPPP P Sbjct: 178 PPAPPPPGAP-AAPPAPPFGGPP----SAPPPPPAP 208 Score = 30.3 bits (65), Expect(2) = 0.21 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPX-PPPPPXPRXPXRPPXP 777 P P P P P PP PP P P PP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAP 193 Score = 30.3 bits (65), Expect(2) = 0.12 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 676 PXPVXTPXHPX-PPXNXPXPPPPPXPRXPXRPP 771 P P P P P P PPPP P P PP Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPP 194 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P PP PP PP P PP P Sbjct: 178 PPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP P P P AP P PP P PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPP 194 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXP 759 A P P P PP P PPP P P Sbjct: 180 APPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 23.0 bits (47), Expect(2) = 0.12 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPP 921 P P PPPP PP Sbjct: 194 PFGGPPSAPPPPPAPP 209 Score = 22.2 bits (45), Expect(2) = 0.21 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PP P PP P Sbjct: 191 PAPPFGGPPSAPPPPPAP 208 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRP 768 P P PP P PPPPP P RP Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 700 HPXPPXNXPXPPPPPXPRXPXRPP 771 H PP P PPPPP P P P Sbjct: 52 HDPPPPPPPPPPPPPPPPPPSSSP 75 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXP 777 P PP P PPPPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/82 (25%), Positives = 21/82 (25%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSX 855 P P P PP PPPP P P P T Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPP 358 Query: 856 XXXXXXPXPXXPXPPPPPXXPP 921 P P PPPPP P Sbjct: 359 PPPGRAPQPLGGPPPPPPGRRP 380 Score = 33.5 bits (73), Expect = 0.25 Identities = 22/85 (25%), Positives = 24/85 (28%), Gaps = 2/85 (2%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXK--XXXXXXXXXXXXXXXPKTS 843 A P P+ P PP P PPP R PP P P+ Sbjct: 309 APPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPL 368 Query: 844 XGSXXXXXXXPXPXXPXPPPPPXXP 918 G P PPPP P Sbjct: 369 GGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 31.1 bits (67), Expect = 1.3 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 10/83 (12%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXR---PPXPXXKXXXXXXXXXXXXXXXP----KTSXGSXXX 861 P PP PPPPP R P + P P P TS G Sbjct: 206 PPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP 265 Query: 862 XXXXPXP---XXPXPPPPPXXPP 921 P P PPPPP P Sbjct: 266 PKNAPPPPKRGSSNPPPPPTRGP 288 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +1 Query: 709 PPXNXPXPPPPP-XPRXPXRPP 771 PP P PPPPP P P +PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPP 24 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/79 (27%), Positives = 23/79 (29%) Frame = +1 Query: 691 TPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXX 870 T P PP P PPP P PP P + P S Sbjct: 295 TQGPPLPPSRDQAPAPPP-PLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPIS-----K 348 Query: 871 XPXPXXPXPPPPPXXPPXP 927 P PPPPP P P Sbjct: 349 PPTSTRSAPPPPPGRAPQP 367 Score = 29.9 bits (64), Expect = 3.1 Identities = 21/78 (26%), Positives = 23/78 (29%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSX 855 P P+ P P PPPP R PP P + P S Sbjct: 251 PPPMRGPTSGGEPPPPKNAPPPP-KRGSSNPPPPPTRGPPSNSFTTQGPPLPP-----SR 304 Query: 856 XXXXXXPXPXXPXPPPPP 909 P P PPPPP Sbjct: 305 DQAPAPPPPLNATPPPPP 322 Score = 29.5 bits (63), Expect = 4.0 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 2/70 (2%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPP--XTXP 896 P PPP PP P PP + PP P PP T P Sbjct: 266 PKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSR------DQAPAPPPPLNATPP 319 Query: 897 PXPPXXPXXP 926 P PP P Sbjct: 320 PPPPSRDQVP 329 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP P P Sbjct: 3 PPPPPPGPPPPPSAPSGP 20 Score = 28.7 bits (61), Expect = 7.1 Identities = 19/78 (24%), Positives = 21/78 (26%), Gaps = 3/78 (3%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXPXXK---XXXXXXXXXXXXXXXPKTSXGSXXXXXXX 873 P PP + PPP R PP P + P G Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPM 254 Query: 874 PXPXXPXPPPPPXXPPXP 927 P PPPP P P Sbjct: 255 RGPTSGGEPPPPKNAPPP 272 Score = 28.3 bits (60), Expect = 9.3 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPXP 905 P PP PP PP PPPP L PP PP P Sbjct: 121 PALKPPGFRTTAPPPKNSSPPPP---FGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPP 177 Score = 28.3 bits (60), Expect = 9.3 Identities = 18/70 (25%), Positives = 19/70 (27%), Gaps = 2/70 (2%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXX--PXNLXXXXXXXXXXXXPPXTXP 896 PP P P P P R PPPP P + P P Sbjct: 312 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGP 371 Query: 897 PXPPXXPXXP 926 P PP P Sbjct: 372 PPPPPGRRPP 381 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 34.3 bits (75), Expect = 0.14 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = -1 Query: 907 GGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVX 728 GG GG GG G GGG GG G GG G GGG Sbjct: 48 GGDGG---GGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGD-GDGGGGGDG 103 Query: 727 GGXXGGGGG 701 GG GGGG Sbjct: 104 GGGGDGGGG 112 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 820 GGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G G GG GG G GGG G GG GGG G Sbjct: 65 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 107 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG G G G GG GGGGG G G Sbjct: 78 GGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDG 109 Score = 29.5 bits (63), Expect = 4.0 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GG G G GG G GGG G GGGG G G G Sbjct: 52 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGG-GDGDGGGGGDGDGGGGGDG 103 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG G G GGG G GGG GG G G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/82 (25%), Positives = 21/82 (25%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSX 855 P P P PP PPPP P P P T Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPP 270 Query: 856 XXXXXXPXPXXPXPPPPPXXPP 921 P P PPPPP P Sbjct: 271 PPPGRAPQPLGGPPPPPPGRRP 292 Score = 33.5 bits (73), Expect = 0.25 Identities = 22/85 (25%), Positives = 24/85 (28%), Gaps = 2/85 (2%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXK--XXXXXXXXXXXXXXXPKTS 843 A P P+ P PP P PPP R PP P P+ Sbjct: 221 APPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPL 280 Query: 844 XGSXXXXXXXPXPXXPXPPPPPXXP 918 G P PPPP P Sbjct: 281 GGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 31.1 bits (67), Expect = 1.3 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 10/83 (12%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXR---PPXPXXKXXXXXXXXXXXXXXXP----KTSXGSXXX 861 P PP PPPPP R P + P P P TS G Sbjct: 118 PPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPP 177 Query: 862 XXXXPXP---XXPXPPPPPXXPP 921 P P PPPPP P Sbjct: 178 PKNAPPPPKRGSSNPPPPPTRGP 200 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/79 (27%), Positives = 23/79 (29%) Frame = +1 Query: 691 TPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXX 870 T P PP P PPP P PP P + P S Sbjct: 207 TQGPPLPPSRDQAPAPPP-PLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPIS-----K 260 Query: 871 XPXPXXPXPPPPPXXPPXP 927 P PPPPP P P Sbjct: 261 PPTSTRSAPPPPPGRAPQP 279 Score = 29.9 bits (64), Expect = 3.1 Identities = 21/78 (26%), Positives = 23/78 (29%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSX 855 P P+ P P PPPP R PP P + P S Sbjct: 163 PPPMRGPTSGGEPPPPKNAPPPP-KRGSSNPPPPPTRGPPSNSFTTQGPPLPP-----SR 216 Query: 856 XXXXXXPXPXXPXPPPPP 909 P P PPPPP Sbjct: 217 DQAPAPPPPLNATPPPPP 234 Score = 29.5 bits (63), Expect = 4.0 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 2/70 (2%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPP--XTXP 896 P PPP PP P PP + PP P PP T P Sbjct: 178 PKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSR------DQAPAPPPPLNATPP 231 Query: 897 PXPPXXPXXP 926 P PP P Sbjct: 232 PPPPSRDQVP 241 Score = 28.7 bits (61), Expect = 7.1 Identities = 19/78 (24%), Positives = 21/78 (26%), Gaps = 3/78 (3%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXPXXK---XXXXXXXXXXXXXXXPKTSXGSXXXXXXX 873 P PP + PPP R PP P + P G Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPM 166 Query: 874 PXPXXPXPPPPPXXPPXP 927 P PPPP P P Sbjct: 167 RGPTSGGEPPPPKNAPPP 184 Score = 28.3 bits (60), Expect = 9.3 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPXP 905 P PP PP PP PPPP L PP PP P Sbjct: 33 PALKPPGFRTTAPPPKNSSPPPP---FGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPP 89 Score = 28.3 bits (60), Expect = 9.3 Identities = 18/70 (25%), Positives = 19/70 (27%), Gaps = 2/70 (2%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXX--PXNLXXXXXXXXXXXXPPXTXP 896 PP P P P P R PPPP P + P P Sbjct: 224 PPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGP 283 Query: 897 PXPPXXPXXP 926 P PP P Sbjct: 284 PPPPPGRRPP 293 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 34.3 bits (75), Expect = 0.14 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = -1 Query: 907 GGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVX 728 GG GG GG G GGG GG G GG G GGG Sbjct: 63 GGDGG---GGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGD-GDGGGGGDG 118 Query: 727 GGXXGGGGG 701 GG GGGG Sbjct: 119 GGGGDGGGG 127 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 820 GGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G G GG GG G GGG G GG GGG G Sbjct: 80 GDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGG 122 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG G G G GG GGGGG G G Sbjct: 93 GGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDG 124 Score = 29.5 bits (63), Expect = 4.0 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GG G G GG G GGG G GGGG G G G Sbjct: 67 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGG-GDGDGGGGGDGDGGGGGDG 118 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG G G GGG G GGG GG G G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 PP PP P APP P IPPPP P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P V P P PP P PP PP P P P Sbjct: 183 PPGVLAPP-PAPPGVLPPPPAPPGALIPPPPAPP 215 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PPP P GAPP P PP PPPP Sbjct: 197 PPPPPPPPGFPGGAPPPP---PPP---FGAPPPP 224 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P P P PPPPP P PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPP--PP 224 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P PP P PPP P PP P Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 759 GAPPXPXXXTPPRXNXXIPPPPXXP 833 G PP P PP PPPP P Sbjct: 193 GMPPPPPPPPPPGFPGGAPPPPPPP 217 Score = 28.3 bits (60), Expect(2) = 0.15 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 724 PXPPPPPXPRXPXRPPXP 777 P PPPPP P P P P Sbjct: 196 PPPPPPPPPGFPGGAPPP 213 Score = 24.6 bits (51), Expect(2) = 0.15 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 889 PXPPPPPXXPPXP 927 P PPPPP P P Sbjct: 211 PPPPPPPFGAPPP 223 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 796 RGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGG 701 RGG G GG G GGG GG GGGGG Sbjct: 336 RGGSGRGGGGGGGGGGGGGGG--GGGRGGGGG 365 Score = 32.3 bits (70), Expect = 0.57 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G G G GGG GG GGG GG G + G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 760 PXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 P G GG GG GGGGGG G G Sbjct: 335 PRGGSGRGGGGGGGGGGGGGGGGGGRGGG 363 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 33.9 bits (74), Expect = 0.19 Identities = 25/76 (32%), Positives = 28/76 (36%), Gaps = 1/76 (1%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXX-GGGGXFXLXRGGVXXXGXGGAPXGXXXG 740 G GG G GG G G GG + +GG G GG G G Sbjct: 11 GSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG-WGRMQG 69 Query: 739 GGVXGGXXGGGGGGXG 692 GG+ G GG G G G Sbjct: 70 GGMGRGPGGGLGRGPG 85 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 33.9 bits (74), Expect = 0.19 Identities = 26/83 (31%), Positives = 30/83 (36%), Gaps = 2/83 (2%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGG-GXFXLXRGGVXXXGXGGAPX-GXXX 743 G G GG + GG G GGG + RGG+ G GG G Sbjct: 34 GRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGM 93 Query: 742 GGGVXGGXXGGGGGGXGXXPAXG 674 G G G GGGG G + G Sbjct: 94 GRGGIAGEGMGGGGMAGEGMSRG 116 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXG-GAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG + RGG+ G G G G GGG G GGGG G G Sbjct: 116 GGIAGEGMGRGGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGG 166 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXG-XGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG + RGG+ G GG G GGG G GGGG G + G Sbjct: 126 GGMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGG 176 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.5 bits (73), Expect = 0.25 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = +3 Query: 723 PPXTPPPXXX---PXGAPPXPXXXTPPRXNXXIPPP-PXXPXNLXXXXXXXXXXXXPPXT 890 PP PP P GAPP P PP +PPP P PP Sbjct: 224 PPMIPPVGMLGHPPMGAPPPPHSMPPP----GMPPPGMMPPPGFPPMGMPGMGGMPPPGM 279 Query: 891 XPPXPP 908 PP PP Sbjct: 280 PPPMPP 285 Score = 24.2 bits (50), Expect(2) = 8.2 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXP 759 P P H PP P P P P P Sbjct: 237 PMGAPPPPHSMPPPGMPPPGMMPPPGFP 264 Score = 22.6 bits (46), Expect(2) = 8.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPP 921 P P P P PP PP Sbjct: 275 PPPGMPPPMPPGGMPP 290 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 33.5 bits (73), Expect = 0.25 Identities = 27/83 (32%), Positives = 30/83 (36%), Gaps = 2/83 (2%) Frame = -1 Query: 925 GXXGXXGGXGGX-VXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXR-GGVXXXGXGGAPXG 752 G G GG GG V G G G GG + GG+ G GG G Sbjct: 202 GGLGGLGGLGGLGVIGTGVIGAGAVGGLGGLGGLGGVGGLGGVGGLGGIGGLGGGGVIAG 261 Query: 751 XXXGGGVXGGXXGGGGGGXGXXP 683 G G+ GG G GG G P Sbjct: 262 A--GAGIGGGVIGTGGIPGGILP 282 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRP 768 P P PP P PPPPP P P P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 880 PXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 68 PPPPPPPPPPLPPPPP 83 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 62 PIPPTLPPPPPPPPPPLP 79 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 65 PTLPPPPPPPPPPLPPPP 82 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 33.5 bits (73), Expect = 0.25 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRP 768 P P PP P PPPPP P P P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 880 PXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 292 PPPPPPPPPPLPPPPP 307 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 286 PIPPTLPPPPPPPPPPLP 303 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 289 PTLPPPPPPPPPPLPPPP 306 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 33.5 bits (73), Expect = 0.25 Identities = 23/54 (42%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGG-GGGXGXXPAXG 674 G GGGG +GG G GG G GG GG GGG GGG G + G Sbjct: 89 GERGGGGS----QGGGYRSGGGG--YGGSSRGGYGGGRGGGGYGGGRGGGGSYG 136 Score = 32.3 bits (70), Expect = 0.57 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GG + GG GG G GGG GG GGG G G Sbjct: 93 GGGSQGGGYRSGGGGYGGSSRGGY-GGGRGGGGYGGGRGGGGSYGGG 138 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGG 701 GGGG RGG GG G GGG GG GG Sbjct: 104 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 796 RGGVXXXGXGGAPXGXXXGGGVXGGXXGGGG 704 RGG G GG G GG GG GGGG Sbjct: 315 RGGGYRSGGGGGYGGGRGGGRGYGGGRGGGG 345 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 760 PXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 P G GGG GG GGGG G G Sbjct: 87 PRGERGGGGSQGGGYRSGGGGYGGSSRGG 115 Score = 28.7 bits (61), Expect = 7.1 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 775 GXGGAPXGXXX--GGGVXGGXXGGGGGGXGXXPAXGXR 668 G GG+ G GGG G GG GGG G G R Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGR 129 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 742 GGGVXGGXXGGGGGGXGXXPAXG 674 GGG GG GGGGG G G Sbjct: 312 GGGRGGGYRSGGGGGYGGGRGGG 334 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 33.1 bits (72), Expect = 0.33 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGG GG G GGA G G GG GGGG G Sbjct: 132 GSQAGGGA--AGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSG 176 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 1/54 (1%) Frame = -1 Query: 832 GXXGGGGXFXLXRGG-VXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGG GG G G G GGG GG G GGG G A G Sbjct: 105 GTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGG-GGQEGGGQGGAQAGG 157 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGG--GGXGXXPAXG 674 GG G GG GG GGGG GG A G Sbjct: 104 GGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGG 137 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 33.1 bits (72), Expect = 0.33 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGG-GVXGGXXGGGGGGXG 692 GGGG + GG G A G GG G+ GG G GGG G Sbjct: 1087 GGGGQQPMMMGGGQGMMMGNAMGGGMGGGMGMQGGGMGMQGGGMG 1131 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 33.1 bits (72), Expect = 0.33 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXP 777 P PP + PPPPP P PP P Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPP 327 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 735 PPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 PPP APP P PP +PPPP P Sbjct: 301 PPPPPPTDFAPPPP----PPEPTSELPPPPPPP 329 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PP P PP P PP PPPP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPP------PPPP 328 Score = 24.2 bits (50), Expect(2) = 4.9 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXP 750 P P N PPPPP P Sbjct: 269 PPIPSASQNATPPPPPPPP 287 Score = 23.4 bits (48), Expect(2) = 4.9 Identities = 10/32 (31%), Positives = 11/32 (34%) Frame = +1 Query: 832 PKTSXGSXXXXXXXPXPXXPXPPPPPXXPPXP 927 P + G P P P PP PP P Sbjct: 287 PSNTPGMFASSGFQPPPPPPTDFAPPPPPPEP 318 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P + P P P + P PP PP P+ P P P Sbjct: 621 PAGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP 654 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P + P P P + P PP PP P+ P P P Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP 824 Score = 32.3 bits (70), Expect = 0.57 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPP 771 P PP PPPPP P P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPP 51 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P PP P P PP P P PP Sbjct: 628 PGPASPPSPPGPP-GPPGPKGPPGPNGPLGPP 658 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P PP P P PP P P PP Sbjct: 798 PGPASPPSPPGPP-GPPGPKGPPGPNGPLGPP 828 Score = 31.9 bits (69), Expect = 0.76 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P + P P P + P PP PP P P P P Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGP 739 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P PP P P PP P P PP Sbjct: 713 PGPASPPSPPGPP-GPPGPNGPPGPNGPLGPP 743 Score = 31.9 bits (69), Expect = 0.76 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXP 777 P P + P PP PP P P PP P Sbjct: 882 PPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRP 768 P + P P P + P PP PP P+ P P Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 691 TPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 TP P P P PP PP P P P P Sbjct: 28 TPPPPPPYEAPPPPPGPPGPDGPPGFPGP 56 Score = 28.3 bits (60), Expect = 9.3 Identities = 21/89 (23%), Positives = 23/89 (25%), Gaps = 5/89 (5%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXG-- 849 P P P P P PP P P+ P P P P + G Sbjct: 32 PPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPP 91 Query: 850 ---SXXXXXXXPXPXXPXPPPPPXXPPXP 927 P PP P PP P Sbjct: 92 GLPGPNGVNGPPGELGDMGPPGPPGPPGP 120 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P PP P P PP P PP Sbjct: 883 PGPASPPSPPGPP-GPPGPKGPPGPNGCLGPP 913 Score = 26.6 bits (56), Expect(2) = 0.33 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 712 PXNXPXPPPPPXPRXPXRPPXP 777 P P PP P P P PP P Sbjct: 876 PPGLPGPPGPASPPSPPGPPGP 897 Score = 26.2 bits (55), Expect(2) = 0.43 Identities = 19/77 (24%), Positives = 20/77 (25%), Gaps = 2/77 (2%) Frame = +1 Query: 553 PPXP--PPGXPRXHXKRGXXXGKXXXXXXXXXXXXXXXXXXAXPXPVXTPXHPXPPXNXP 726 PP P P G P G G P + P P Sbjct: 648 PPGPNGPLGPPGESGPAGNAGGVGYQGNHGNPAGVQGPNGQPGPPGINGPPGQIGEMGPP 707 Query: 727 XPPPPPXPRXPXRPPXP 777 P PP P P PP P Sbjct: 708 GLPGPPGPASPPSPPGP 724 Score = 25.4 bits (53), Expect(2) = 0.73 Identities = 19/77 (24%), Positives = 20/77 (25%), Gaps = 2/77 (2%) Frame = +1 Query: 553 PPXP--PPGXPRXHXKRGXXXGKXXXXXXXXXXXXXXXXXXAXPXPVXTPXHPXPPXNXP 726 PP P P G P G G P + P P Sbjct: 733 PPGPNGPLGPPGECGPAGNAGGVGCQGHHGNPAGSQGPNGQPGPPGINGPPGQVGEMGPP 792 Query: 727 XPPPPPXPRXPXRPPXP 777 P PP P P PP P Sbjct: 793 GLPGPPGPASPPSPPGP 809 Score = 25.0 bits (52), Expect(2) = 0.43 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PP P PP P Sbjct: 719 PSPPGPPGPPGPNGPPGP 736 Score = 25.0 bits (52), Expect(2) = 0.73 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PP P PP P Sbjct: 804 PSPPGPPGPPGPKGPPGP 821 Score = 25.0 bits (52), Expect(2) = 0.33 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PP P PP P Sbjct: 889 PSPPGPPGPPGPKGPPGP 906 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 32.7 bits (71), Expect = 0.43 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG+ GG P G GG+ GG G GG G A G Sbjct: 180 GGMPGGMPGGMPGGFPGAGGMPGGFPGAGGMPGGFPGAGG 219 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 32.7 bits (71), Expect = 0.43 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTP--PRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPP 899 P PP PP P P P +PPPP + PP PP Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPP---GMRPMPPQPPFMPPPPRMQPP 1278 Query: 900 XPPXXPXXP 926 PP P P Sbjct: 1279 GPPGPPGPP 1287 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPP--PPPXPRXPXRPPXP 777 P P P P PP P PP PP P P PP P Sbjct: 1255 PPPGMRPMPPQPPF-MPPPPRMQPPGPPGPPGPPGP 1289 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPP---PPXPRXPXRPPXP 777 P P P P P PPP P P+ P PP P Sbjct: 1237 PPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPP 1273 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXR--PPXP 777 P PP P PP PP P R PP P Sbjct: 1254 PPPPGMRPMPPQPPFMPPPPRMQPPGP 1280 Score = 25.4 bits (53), Expect(2) = 5.6 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PP PP PP P Sbjct: 1256 PPGMRPMPPQPPFMPPPP 1273 Score = 21.8 bits (44), Expect(2) = 5.6 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPP 771 P PP P PP P PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPP 1257 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 32.7 bits (71), Expect = 0.43 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGGG GG G GG G G GGGGGG G G Sbjct: 42 GGGGGGGG-----GGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 32.3 bits (70), Expect = 0.57 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -1 Query: 754 GXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGG GG GGGGGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDG 67 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GGGG GG G G G G GGGGGG G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXG-GAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG GG G G G GGG GG G G G G Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 32.7 bits (71), Expect = 0.43 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +3 Query: 732 TPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPXPPX 911 TP P P PP P PP N PP P P + PP T PP Sbjct: 19 TPKP---PQPTPPKPDTP-PPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQP 74 Query: 912 XP 917 P Sbjct: 75 PP 76 Score = 32.7 bits (71), Expect = 0.43 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PP P PP TPP N PPP + PP T PP Sbjct: 22 PPQPTPPK--PDTPPPGTNIPTPPSPN---TPPPVTQPPVTQPPVTQPPVTQPPVTQPPP 76 Query: 903 P 905 P Sbjct: 77 P 77 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 32.7 bits (71), Expect = 0.43 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 709 PPXNXPXPPPPPXPRXPXRPPXP 777 PP + P PPPPP P P PP P Sbjct: 1307 PPESPPPPPPPPPP--PPPPPLP 1327 Score = 32.3 bits (70), Expect = 0.57 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 709 PPXNXPXPPPPPXPRXPXRPPXP 777 P P PPPPP P P PP P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 32.3 bits (70), Expect = 0.57 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P P PPPPP PP P Sbjct: 1313 PPPPPPPPPPPPPLPPTP 1330 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXP 759 P PP P PPPPP P P Sbjct: 1312 PPPPPPPPPPPPPPLPPTP 1330 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXP 759 P PP P PPPPP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 880 PXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 1308 PESPPPPPPPPPPPPP 1323 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 880 PXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 1312 PPPPPPPPPPPPPPLP 1327 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 Query: 685 VXTPXHPXPPXNXPXPPPPP 744 + P P PP P PPPPP Sbjct: 1305 IQPPESPPPPPPPPPPPPPP 1324 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPP 1324 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 874 PXPXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 1308 PESPPPPPPPPPPPPPPP 1325 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPP-PPXP 750 P +P P PP P PPP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 32.3 bits (70), Expect = 0.57 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 766 GAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G G GGG GG GGGGGG G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDG 332 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GG G GGG GG GG GGG G G Sbjct: 306 GDGGG-GGDGGGGGGGGGGGGGDGGGDGDGDGDG 338 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG G GGG GG GGG G G G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDG 340 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 766 GAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G G G G GG GGGGGG G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDG 334 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 793 GGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG G GG G GGG G G G G G G Sbjct: 311 GGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 32.3 bits (70), Expect = 0.57 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP TPPP APP PP N P PP P L P PP Sbjct: 285 PPMTPPPAVVT--APPP----APPLPNFTSPSPPPPPP-LPPAMPAMDDLLPPEVLSPPP 337 Query: 903 PP 908 PP Sbjct: 338 PP 339 Score = 29.1 bits (62), Expect = 5.3 Identities = 25/90 (27%), Positives = 25/90 (27%), Gaps = 6/90 (6%) Frame = +1 Query: 676 PXPVXTPXHPXPPX-NXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGS 852 P V T P PP N P PPP P P P P P S Sbjct: 290 PPAVVTAPPPAPPLPNFTSPSPPPPP--PLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYS 347 Query: 853 XXXXXXXPXP-----XXPXPPPPPXXPPXP 927 P P P P P PP P Sbjct: 348 MPSSLPMPSPPEDLYDAPATLPSPIMPPPP 377 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 32.3 bits (70), Expect = 0.57 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPP-PPXPRXPXRPPXP 777 P TP P PP P PPP P P P P P Sbjct: 755 PKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLP 787 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +1 Query: 676 PXPVXTPXH--PXPPXNXPXPPPPPXPRXPXR 765 P P H P P + PPPPP R P R Sbjct: 790 PAPFSAAPHLPPAPNISAEPPPPPPVARKPSR 821 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 32.3 bits (70), Expect = 0.57 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P P PPPPP P P P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 29.9 bits (64), Expect = 3.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 880 PXXPXPPPPPXXPPXP 927 P P PPPPP PP P Sbjct: 375 PFAPPPPPPPPPPPAP 390 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXP 833 PP TP P P + P PP PPPP P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPP---PPPPPPPPAP 390 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 31.9 bits (69), Expect = 0.76 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 718 NXPXPPPPPXPRXPXRPP 771 N P PPPPP P P PP Sbjct: 141 NPPPPPPPPSPPPPCHPP 158 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 31.9 bits (69), Expect = 0.76 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 1/79 (1%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG GG G G GGGG + G G G Sbjct: 213 GGYGGGGGYGGY-GGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYGSYDGYGSMGMYNQSS 271 Query: 745 XG-GGVXGGXXGGGGGGXG 692 G G GG GGG GG G Sbjct: 272 SGYGKSYGGMSGGGSGGRG 290 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = -1 Query: 796 RGGVXXXGXGGAPXGXXXGGGVXGGXXG----GGGGGXGXXPAXG 674 RGG G GG G GGG GG G GGG G + G Sbjct: 199 RGGYGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYG 243 Score = 29.1 bits (62), Expect = 5.3 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGG-GGXG 692 G G G GGG GG GGGG GG G Sbjct: 197 GGRGGYGGRGRGGGGRGGYGGGGGYGGYG 225 Score = 28.3 bits (60), Expect = 9.3 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = -1 Query: 838 FXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 + G GGG GG G GG G G G G GGG G + G Sbjct: 202 YGGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGGYGSSYG 256 >SB_11512| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) Length = 639 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPP-PPPXPRXPXRPPXP 777 P+ TP PP + P P P P PR PP P Sbjct: 567 PIATPRSARPPSDSPRPARPQPEPRHLRSPPEP 599 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.76 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 769 GGAPXGXXXGGGVXG-GXXGGGGGGXG 692 GGA GGG+ G G GGGGGG G Sbjct: 67 GGAGGDDDDGGGISGCGDGGGGGGGAG 93 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GG G GG G GGGGG G Sbjct: 64 GAGGGAGGDDDDGGGISGCGDGGGGGGG 91 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGG 701 G GG G GG+ G GG GGG G GGGG Sbjct: 64 GAGGGAGGDDDDGGGISGCGDGGG-----GGGGAGGDDDDGGGG 102 >SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) Length = 2658 Score = 31.9 bits (69), Expect = 0.76 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPP-PPPXPRXPXRPPXP 777 P+ TP PP + P P P P PR PP P Sbjct: 2586 PIATPRSARPPSDSPRPARPQPEPRHLRSPPEP 2618 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 31.9 bits (69), Expect = 0.76 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGGGGXG 692 GG P G G GG GGGGG G Sbjct: 371 GGEPGAFGSGSGFGGGGSSGGGGGGG 396 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 31.9 bits (69), Expect = 0.76 Identities = 17/62 (27%), Positives = 19/62 (30%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP P P P PP P P + PPPP + PP Sbjct: 857 PPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPPP 916 Query: 903 PP 908 PP Sbjct: 917 PP 918 Score = 28.7 bits (61), Expect = 7.1 Identities = 18/76 (23%), Positives = 19/76 (25%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXX 861 P P P P PP P P PP P + P Sbjct: 843 PTTKTDRPLSPSAPPPLPPRPVGAPPSLPPRPRTR-PLPPKSDTPPPPPRPAADESQEMS 901 Query: 862 XXXXPXPXXPXPPPPP 909 P PPPPP Sbjct: 902 RTRGPKDGRKPPPPPP 917 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 694 PXHPXPPXNXPX--PPPPPXPRXPXRPP 771 P P P P PPPPP P P PP Sbjct: 345 PPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXP 759 P T P P PPPPP P P Sbjct: 346 PTPTTPKTHPQLGPPPPPPPPPPTPP 371 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXP 750 P P HP P PPPPP P Sbjct: 346 PTPTTPKTHPQLGPPPPPPPPPPTP 370 Score = 27.5 bits (58), Expect(2) = 0.92 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 880 PXXPXPPPPPXXPP 921 P P PPPPP PP Sbjct: 359 PPPPPPPPPPTPPP 372 Score = 22.6 bits (46), Expect(2) = 0.92 Identities = 9/26 (34%), Positives = 9/26 (34%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P PP P P P Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHP 355 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXN--XXIPPPPXXPXNLXXXXXXXXXXXXPPXTXP 896 P PPP P G P P PP N IPP P + PP P Sbjct: 383 PGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPP---P 439 Query: 897 PXPPXXP 917 P P P Sbjct: 440 PPPSDAP 446 Score = 28.7 bits (61), Expect = 7.1 Identities = 21/79 (26%), Positives = 21/79 (26%), Gaps = 6/79 (7%) Frame = +1 Query: 703 PXPPXNXPXP-PPPPXPRXPXRPP-----XPXXKXXXXXXXXXXXXXXXPKTSXGSXXXX 864 P PP P PPPP P PP K P G Sbjct: 328 PPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGAGNGPGGPP 387 Query: 865 XXXPXPXXPXPPPPPXXPP 921 P P PPP PP Sbjct: 388 PPWSKPGGILPGPPPPGPP 406 Score = 28.7 bits (61), Expect = 7.1 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = -2 Query: 438 GXXNG-GXPPPPPXKXGN-LXXXXXXXXXXXFLVPXXPXXXX---FXXXXXFFXPXFXPP 274 G NG G PPPP K G L + P P + P F PP Sbjct: 378 GAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPP 437 Query: 273 PPPXP 259 PPP P Sbjct: 438 PPPPP 442 Score = 28.3 bits (60), Expect = 9.3 Identities = 22/82 (26%), Positives = 25/82 (30%), Gaps = 2/82 (2%) Frame = +1 Query: 682 PVXTPXHPXPPX--NXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSX 855 PV P PP N P PPPP + P P +T+ G Sbjct: 367 PVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPW--QTTPGYI 424 Query: 856 XXXXXXPXPXXPXPPPPPXXPP 921 P PPPPP P Sbjct: 425 PPPPPGFPQFQPPPPPPPSDAP 446 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 796 RGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXGXR 668 RGG G G G G G G GGG GG G G R Sbjct: 396 RGGYRGRGGRGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGGLR 438 Score = 28.7 bits (61), Expect = 7.1 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G G GG RGG G G GGG GG GG GG G Sbjct: 398 GYRGRGG-----RGGYRGRGGGRGYYRGGRGGGRGGGGRGGRGGLRG 439 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 676 PXPVX-TPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P+ P PP P PPPPP P PP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPP 241 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/75 (28%), Positives = 23/75 (30%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXXPXP 882 P PP P PPPP + R + P P P Sbjct: 373 PPPP---PQPPPPNEQQVVDRTVEYSEQVIYDLRGRTIRPFPTPNRRRRRSLVQPPPPPP 429 Query: 883 XXPXPPPPPXXPPXP 927 P PPPPP PP P Sbjct: 430 PAPLPPPPP-PPPQP 443 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P PP P PPPPP P+ P P Sbjct: 424 PPPPPPPAPLP-PPPPPPPQPTTALPDP 450 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 685 VXTPXHPXPPXNXPXPPPPPXP 750 V P P P P PPPPP P Sbjct: 422 VQPPPPPPPAPLPPPPPPPPQP 443 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXP 777 P PP N P PP P P P PP P Sbjct: 236 PVPPTNPPVPPTNP-PAPPTNPPKP 259 Score = 26.6 bits (56), Expect(2) = 2.3 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P T P P PP P P PP P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAP 252 Score = 22.2 bits (45), Expect(2) = 2.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 895 PPPPPXXPPXP 927 PP PP PP P Sbjct: 249 PPAPPTNPPKP 259 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G G+P GGG GG GGGGG G Sbjct: 409 GEEGSPSVFLGGGGRGGGGGDGGGGGEG 436 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 27.1 bits (57), Expect(2) = 1.2 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 730 PPPPPXPRXPXRPP 771 PPPPP P P PP Sbjct: 1455 PPPPPPPAPPCPPP 1468 Score = 25.4 bits (53), Expect(2) = 2.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 895 PPPPPXXPPXP 927 PPPPP PP P Sbjct: 1456 PPPPPPAPPCP 1466 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 730 PPPPPXPRXPXRPPXP 777 P PPP P PP P Sbjct: 1423 PAPPPPMAFPPMPPAP 1438 Score = 22.6 bits (46), Expect(2) = 1.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXP 750 P PP PP PP P Sbjct: 1423 PAPPPPMAFPPMPPAP 1438 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 31.1 bits (67), Expect = 1.3 Identities = 27/85 (31%), Positives = 29/85 (34%), Gaps = 4/85 (4%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXX-GGGGXFXLXRGGVXXXGXGGAPXGXXXG 740 G GG G GG G G GG + +GG G GG G G Sbjct: 255 GSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG-WGRMQG 313 Query: 739 G---GVXGGXXGGGGGGXGXXPAXG 674 G G GG GGG G P G Sbjct: 314 GMGRGPGGGWGRMQGGGMGRGPGGG 338 Score = 28.3 bits (60), Expect = 9.3 Identities = 27/83 (32%), Positives = 30/83 (36%), Gaps = 3/83 (3%) Frame = -1 Query: 907 GGXGGXVXGGXXXXXXXXXXXXRFXGXXG---GGGXFXLXRGGVXXXGXGGAPXGXXXGG 737 GG G + GG R G G GGG + GG+ GG G GG Sbjct: 289 GGGWGRMQGGGMGRGPGGGWG-RMQGGMGRGPGGGWGRMQGGGMGRGPGGG--LGRGPGG 345 Query: 736 GVXGGXXGGGGGGXGXXPAXGXR 668 G G GGG G G G R Sbjct: 346 G--WGRMQGGGMGRGPGQGWGCR 366 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P PP P PPPP P P P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGP 254 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = +3 Query: 732 TPPPXXXPXGAPPXPXXXTPPRXNXXI-PPPPXXPXNLXXXXXXXXXXXXPPXTXPP--X 902 TPPP GAP P PP + PPPP P PP PP Sbjct: 2123 TPPPMGQ-YGAPARPAMGPPPMGSSRYGPPPPMGPAR--HSPSGPSPLGAPPSVPPPMGA 2179 Query: 903 PPXXP 917 PP P Sbjct: 2180 PPSGP 2184 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P+ P PP P PPP P PP Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPP 2195 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GG GG G G G GGG GG GG GGG G Sbjct: 441 GRGGDGGGDGGGGGDGGGDGIDGGD--GGGDGGGDGGGDGGGDG 482 Score = 29.1 bits (62), Expect = 5.3 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGG 698 G G GG G G G G GGG GG GG GGG Sbjct: 441 GRGGDGGGDGGGGGDGGGDGIDGGDGGGD-GGGDGGGDGGGDGGG 484 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.1 bits (67), Expect = 1.3 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 4/79 (5%) Frame = -1 Query: 916 GXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGG 737 G GG GG GG G GG GG G G P G GG Sbjct: 233 GYKGGQGGTSSGGGGYGGETYACLSSTYGK-GGDRNQPGNAGGGAGEGSTGGPGGINAGG 291 Query: 736 G----VXGGXXGGGGGGXG 692 G G GGGG G Sbjct: 292 GGGDSTTDSDDGAGGGGGG 310 >SB_7400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1499 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 670 AXPXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 A P PV P PP P PPP R P P P Sbjct: 860 ATPLPVRVPVATLPPVRLPVATPPPV-RVPVATPLP 894 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXPXXK 786 P PP PPPP PR P P K Sbjct: 740 PPPPATAAKAPPPPPPRKDVEEPSPIEK 767 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXPXXK 786 P P P P P N P PP P P PP K Sbjct: 780 PPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTK 816 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P PPPP P P +P P Sbjct: 792 PPNIPSRPPGARPTPPPPPPGKPTKPTKPSLP 823 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGG 701 G G G GGG GG GGGGG Sbjct: 336 GDGSGDRGFLGGGGGGGGSSGGGGG 360 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXP-----RXPXRPPXP 777 P P P PP PPPPP P P +PP P Sbjct: 645 PNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 760 PXGXXXGGGVXGGXXGGGGGGXG 692 P GGG GG GGGGGG G Sbjct: 509 PRRRRGGGGGGGGGGGGGGGGRG 531 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 754 GXXXGGGVXGGXXGGGGGGXG 692 G GGG GG GGG GG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGG-GGGXGXXPAXG 674 G GGG RGG G GG G GG GGG GGG G A G Sbjct: 41 GAGRGGG-----RGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRGVFIARG 89 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGGGGXG 692 G +P G GGG G GG GGG G Sbjct: 36 GFSPRGAGRGGGRGGPRGGGRGGGRG 61 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 26.6 bits (56), Expect(2) = 1.8 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P P P P P P PP P Sbjct: 64 PEMPGQPQVTPQTPSPASPGLPFMPPPP 91 Score = 22.6 bits (46), Expect(2) = 1.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 880 PXXPXPPPPP 909 P P PPPPP Sbjct: 85 PFMPPPPPPP 94 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXP 750 P P P P P P PPPP P Sbjct: 116 PAPTSVPSGPRAPPGGPGAPPPPPP 140 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 742 GGGVXGGXXGGGGGGXG 692 GGG GG GGGGGG G Sbjct: 320 GGGGGGGGGGGGGGGGG 336 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 742 GGGVXGGXXGGGGGGXG 692 GGG GG GGGGGG G Sbjct: 321 GGGGGGGGGGGGGGGGG 337 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 742 GGGVXGGXXGGGGGGXG 692 GGG GG GGGGGG G Sbjct: 322 GGGGGGGGGGGGGGGGG 338 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 742 GGGVXGGXXGGGGGGXG 692 GGG GG GGGGGG G Sbjct: 323 GGGGGGGGGGGGGGGGG 339 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 754 GXXXGGGVXGGXXGGGGGG 698 G GGG GG GGGGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGG 338 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 754 GXXXGGGVXGGXXGGGGGG 698 G GGG GG GGGGGG Sbjct: 321 GGGGGGGGGGGGGGGGGGG 339 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXP 750 P P P P P PPPPP P Sbjct: 299 PAAAPPPPPLPAGVPAPPPPPPP 321 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 790 GVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GV G GG G GG GG GGGG G G G Sbjct: 53 GVGGQGGGGQGGGQGVGGQEVGGQ-GGGGQGVGGQEVGG 90 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -1 Query: 832 GXXGG--GGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGG 698 G GG GG F GG GG+ G G G GGGGGG Sbjct: 420 GAFGGSSGGGF----GGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGG 698 G GG G GG GG G GGGG Sbjct: 11 GEGGGDGGDSGGGSDGGGDGGDGGGG 36 Score = 28.7 bits (61), Expect = 7.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GG G GGG G GG GG G Sbjct: 15 GDGGDSGGGSDGGGDGGDGGGGSDGGDG 42 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GG G G GGA G GG GG GG GG G Sbjct: 778 GASGGAGGSSGGANGGAGSSSGGASGG---AGGSSGGASGGAGGSSG 821 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = -1 Query: 823 GGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GG GG G + GG GG G GG G Sbjct: 782 GAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASG 825 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG GG GG G GGG G GGGG G Sbjct: 98 GSNGGGGDDDGSNGG------GGDDDGSNGGGGDDDGSNGGGGDDDG 138 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GG G GGG G GGGG G G Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGG 134 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 691 TPXHPXPPXNXPXPPPPPXPRXP 759 TP P PP + P P PPP P Sbjct: 460 TPIPPPPPMSPPPPTPPPPATSP 482 Score = 28.7 bits (61), Expect = 7.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 724 PXPPPPPXPRXPXRPPXP 777 P PPPPP P PP P Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXP----XRPP 771 P P P PP P PPP P P P RPP Sbjct: 223 PPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPP 258 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 820 GGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 GG GG G G A G G G G GG G G Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGG 459 Score = 29.5 bits (63), Expect = 4.0 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GG GG GG+ G G G G G GG G G Sbjct: 412 GASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = -1 Query: 820 GGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXGXR 668 GGG G G G G G G G GGG G + G + Sbjct: 425 GGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSGSK 475 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG + G G GG P G G G G GGG G Sbjct: 1271 GMHGGGGGYGNYGG---YGGYGGNPQGGYGFAGYGGQYGGPRGGGSG 1314 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P P P P P P+ P PP Sbjct: 1666 PPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPP 1697 >SB_13204| Best HMM Match : GRP (HMM E-Value=0.0017) Length = 723 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = -2 Query: 921 GXXXRGGXGG-GXXGG--GXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWG 772 G GG GG G GG G GF GG L W G G+ WG Sbjct: 358 GYGGLGGYGGLGGYGGFLGHAGFGGWGFPGGFLGGYGGYAPLGWGGYGYDAWG 410 Score = 28.7 bits (61), Expect = 7.1 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = -2 Query: 906 GGXGG-GXXGGGXXXXXXX*XXXGFXXXXGGGGXLXWXGGGFXXWGGG 766 GG GG G G G G GG G W G GF WG G Sbjct: 460 GGYGGYGGCGYGGYGGYGFPGGWGHGLGWGGPG-FGWGGPGFGGWGHG 506 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P+ + P P + PPPPP P P P P Sbjct: 450 PLPSDEPPPLPPDEEKPPPPPAPALPPLPLPP 481 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXP 750 P V T P PP PPPPP P Sbjct: 1906 PLDVNTNSCPTPPREPTPPPPPPTP 1930 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPP--PPXPRXPXRPPXPXXK 786 P TP P PP P PPP P P +P P K Sbjct: 940 PTPTPP-PSPPPKEPTPPPSSKPSPVKEIKPKKPIEK 975 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P P P PPP P P+ P PP Sbjct: 926 PSPEPLPEVDIMRSPTPTPPPSPPPKEPTPPP 957 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPP-PPXPRXPXR 765 P P P P P PPP PP PR P R Sbjct: 139 PPPTPPQSTPKPRRVLPTPPPKPPTPRPPRR 169 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 5/32 (15%) Frame = +1 Query: 691 TPXHPXPPXNXPXP-----PPPPXPRXPXRPP 771 TP P PP + P P PPP P P RPP Sbjct: 137 TPPPPTPPQSTPKPRRVLPTPPPKPPTP-RPP 167 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/62 (27%), Positives = 20/62 (32%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP P P P GAP P P + +PPP + P P Sbjct: 433 PPGAPHPRFPPPGAP-HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRV 491 Query: 903 PP 908 PP Sbjct: 492 PP 493 Score = 28.7 bits (61), Expect = 7.1 Identities = 34/134 (25%), Positives = 35/134 (26%), Gaps = 9/134 (6%) Frame = +1 Query: 553 PPXPPPGXPRXHXKRGXXXGKXXXXXXXXXXXXXXXXXXAXPXPVXTPX---HPX-PPXN 720 P PPPG P R G P P P HP PP Sbjct: 399 PRVPPPGAPHP---RVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPG 455 Query: 721 XPXP--PPP--PXPR-XPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXXXXXXXPXPX 885 P P PPP P PR P P P + P P Sbjct: 456 APHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPG 515 Query: 886 XPXPPPPPXXPPXP 927 P P PP P P Sbjct: 516 APHPRVPPPGAPHP 529 Score = 28.3 bits (60), Expect = 9.3 Identities = 23/84 (27%), Positives = 25/84 (29%), Gaps = 2/84 (2%) Frame = +1 Query: 676 PXPVXT-PXHPXPPXNXPXPPPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGS 852 P P T P P P + P PPP P R P P P + Sbjct: 382 PPPGATHPRVPSPGASHPRVPPPGAPH--PRVPPPGASHQRVRPPGAPHPRVPPPGAPHP 439 Query: 853 XXXXXXXPXPXXPXP-PPPPXXPP 921 P P P P P P PP Sbjct: 440 RFPPPGAPHPRVPPPGAPHPRVPP 463 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.9 bits (64), Expect = 3.1 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 1/81 (1%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXP-PPPPXPRXPXRPPXPXXKXXXXXXXXXXXXXXXPKTSXGSXX 858 P TP PP N P P PPP P PP P T Sbjct: 44 PPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNT------ 97 Query: 859 XXXXXPXPXXPXPPPPPXXPP 921 P P P P PP P Sbjct: 98 PIPGDPPPNTPIPGDPPPNTP 118 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 676 PXPVXTPXHPXPP---XNXPXPPPPPXP 750 P P HP PP N P PPPP P Sbjct: 578 PVATSPPPHPPPPAHHVNKPGVPPPPPP 605 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 29.9 bits (64), Expect = 3.1 Identities = 20/68 (29%), Positives = 22/68 (32%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PP PP +PPR P PP P +L P PP Sbjct: 275 PPRYPPSLIRYPTLPPR-YPPSPPRYP---PSPPRYPPSLHRYPQSPLRYPPSPIRYPPL 330 Query: 903 PPXXPXXP 926 P P P Sbjct: 331 PSRYPPSP 338 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 29.9 bits (64), Expect = 3.1 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = -1 Query: 907 GGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVX 728 G GG GG G GGG GG G G G GG Sbjct: 333 GDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGG-GDHGDGDHGGGDHGGGDHG 391 Query: 727 GGXXGGGGGGXG 692 GG GGG G G Sbjct: 392 GGDHGGGDYGDG 403 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG P G GGG GG GGG G G Sbjct: 337 GGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGG 368 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG P G GGG GG GGG G G Sbjct: 342 GGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGG 373 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 769 GGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 GG P G GGG GG GGG G G Sbjct: 347 GGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDG 378 Score = 28.3 bits (60), Expect = 9.3 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGX---GGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 G GGG GG G GG P G GGG GG G G G G Sbjct: 333 GDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGG 388 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 24.6 bits (51), Expect(2) = 3.6 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +1 Query: 700 HPXPPXNXPXPPPPPXPRXPXRPPXP 777 HP P P PP P P +P P Sbjct: 506 HPSYPPTQPSYPPTPSSYLPTQPYYP 531 Score = 23.4 bits (48), Expect(2) = 3.6 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 880 PXXPXPPPPPXXPPXP 927 P P PP P PP P Sbjct: 532 PPQPYPPTQPSYPPTP 547 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPP 771 P PP + P PPPP P PP Sbjct: 159 PPSSSPPLSSPPPPPPSTPSSSLLPP 184 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P+ + P PP P PP P PR P P P Sbjct: 1353 PIPSTPRPRPPT--PPRPPTPRPRPPTPRPGP 1382 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 691 TPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 +P P P PP PP PR RPP P Sbjct: 1352 SPIPSTPRPRPPTPPRPPTPR--PRPPTP 1378 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 29.5 bits (63), Expect = 4.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXP 777 P PP PPPPP R PP P Sbjct: 197 PPPPGPGGIPPPPPPIRGGVPPPPP 221 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGG 704 G GGGG GG GG GGG G GGGG Sbjct: 79 GCEGGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGG 121 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPP 824 PP PP P A P P PP PPP Sbjct: 560 PPAPPPSVFAPSSAVPTPATAPPPVAATLSAPPP 593 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P T P PP P P P P PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVP 155 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 676 PXPVXT-PXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P T P P P P PPPP P PP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPP 771 P P TP P PP P PP +PP Sbjct: 144 PPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPP 821 PP TPPP P P PP PP Sbjct: 133 PPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 703 PXPPXNXPXPPPPPXPRXPXRPPXP 777 P PP P PP P P +PP P Sbjct: 1260 PLPPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPR 753 P P P PP P PP PP P+ Sbjct: 1260 PLPPLPPPDAQPPSLPPQPPQPPQPQ 1285 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXR 765 PV +P PP P PPP P P P R Sbjct: 143 PVSSPPRTPPPE--PTPPPTPPPLRPLR 168 >SB_46131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 899 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGGGG 698 G G P G GGG GG GG GG Sbjct: 161 GGGRGPFGPVFGGGNFGGGFGGDFGG 186 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 29.1 bits (62), Expect = 5.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 820 GGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGG 701 GGG RGG GG P G G G GG G GG Sbjct: 427 GGGYEGRGRGG-RGGPRGGGPRGYDGGYGQGGGYEGYSGG 465 Score = 28.3 bits (60), Expect = 9.3 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 3/83 (3%) Frame = -1 Query: 907 GGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGX---GGAPXGXXXGG 737 GG GG GG + G GG GG GG GG Sbjct: 436 GGRGGPRGGGPRGYDGGYGQGGGYEGYSGGYRDDYGYGGGSYDHYDSYYGGGYDDYYGGG 495 Query: 736 GVXGGXXGGGGGGXGXXPAXGXR 668 GG GG GG G P R Sbjct: 496 PPRGGPRGGRGGSRGGPPRGAPR 518 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 29.1 bits (62), Expect = 5.3 Identities = 26/86 (30%), Positives = 27/86 (31%), Gaps = 2/86 (2%) Frame = -1 Query: 925 GXXGXXGGXGGXVXGGXXXXXXXXXXXXRFXGXXGGGGXFXLXRGGVXXXGXGGAPXGXX 746 G G GG G V GG G GG + G G G G Sbjct: 471 GAIGCDGGGGANV-GGDIGGNNGAIGGDNDDGAIGGDDGATVD-GDDGAIGGGAIGDGGD 528 Query: 745 XGGGVXGGXXGGGG--GGXGXXPAXG 674 GGG GG G G GG G G Sbjct: 529 NGGGDDGGDDGAGNSDGGGGNDNGGG 554 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 29.1 bits (62), Expect = 5.3 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXG 692 G GGGG F GV GG G GV G G G Sbjct: 231 GTGGGGGSFVYTSAGVLLVAAGGGGGGSSGFKGVDGQATENGAASKG 277 >SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 902 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 670 AXPXPVXTPXHPX-PPXNXPXPPPPPXP 750 A P P+ TP PP P PPP P P Sbjct: 835 APPYPLYTPADAAFPPAQAPYPPPYPTP 862 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 29.1 bits (62), Expect = 5.3 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -1 Query: 832 GXXGGGGXFXLXRGGVXXXGXG-GAPXGXXXGG-GVXGGXXGGGGGG 698 G GGG RGG G G G G GG G GG GG GG Sbjct: 193 GGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGG 239 >SB_52268| Best HMM Match : SecA_PP_bind (HMM E-Value=0.33) Length = 774 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 847 GSXXXXXXXPXPXXPXPPPPPXXPPXP 927 GS P P P PPPPP P P Sbjct: 399 GSTLERVAHPQPWSPAPPPPPTPPFNP 425 >SB_33342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1189 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P TP PP P PPP P RPP P Sbjct: 482 PTTAQTPTTILPPTTTPTPPPTTT--EPQRPPDP 513 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PP + PP P P+ PP P Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLPQTVPTPPRP 460 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 29.1 bits (62), Expect = 5.3 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -1 Query: 838 FXGXXGGGGXFXLXRGGVXXXGXGGAPXGXXXGGGVXGGXXGGGGGGXGXXPAXG 674 F GGGG RG G G G G G G G G G G G Sbjct: 13 FRPIAGGGGDRGRGRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSGQG 67 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 24.6 bits (51), Expect(2) = 5.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 724 PXPPPPPXPRXPXRP 768 P PPPPP P+ +P Sbjct: 457 PPPPPPPPPQMYQQP 471 Score = 22.6 bits (46), Expect(2) = 5.9 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 712 PXNXPXPPPPP 744 P P PPPPP Sbjct: 454 PQGPPPPPPPP 464 >SB_18739| Best HMM Match : YhhN (HMM E-Value=7.3) Length = 306 Score = 25.0 bits (52), Expect(2) = 6.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 718 NXPXPPPPPXP 750 N P PPPPP P Sbjct: 250 NRPPPPPPPPP 260 Score = 22.2 bits (45), Expect(2) = 6.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 730 PPPPPXPRXP 759 PPPPP P P Sbjct: 252 PPPPPPPPPP 261 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXP 759 P PV T P P PPPP R P Sbjct: 3133 PVPVSTEVEPMRPPRKMRAPPPPSTRIP 3160 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 691 TPXHPXPPXNXPXPPPPPXPRXPXRP 768 TP P PP P P P P+ P P Sbjct: 300 TPQTPPPPQTPPPPQTPAPPQTPAPP 325 >SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) Length = 264 Score = 28.7 bits (61), Expect = 7.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 694 PXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 P P P PP P P P PP P Sbjct: 89 PHRPLEPHRPLEPPRPQEPHRPQEPPRP 116 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 28.7 bits (61), Expect = 7.1 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = -1 Query: 742 GGGVXGGXXGGGGGG--XGXXPAXGXR 668 GGG GG GGGGGG G A G R Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGARGRR 1029 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 28.7 bits (61), Expect = 7.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 691 TPXHPXPPXNXPXPPPPPXPRXPXRPPXP 777 TP PP P PPP P PP P Sbjct: 429 TPPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 28.7 bits (61), Expect = 7.1 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 726 PXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPP 821 P PPP P PP P PP+ + IPPP Sbjct: 380 PHVPPPMIGPVTVPP-PPLIPPPQAS--IPPP 408 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 28.3 bits (60), Expect = 9.3 Identities = 19/67 (28%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +3 Query: 723 PPXTPPPXXXP--XGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXP 896 PP TPPP + P P PP IP P +L PP P Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSP-SKDDLPLPPPPEEVSLPPPDESP 739 Query: 897 PXPPXXP 917 P P Sbjct: 740 PSSKHPP 746 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 676 PXPVXTPXHPXPPXNXPXPPPPPXPRXPXRP 768 P P+ TP P P PPPP P P Sbjct: 686 PPPLPTPIASSEPLPLPPPPPPTGIDIPHSP 716 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTP-PRXNXXIPPPP 824 PP P P PP P P P +PPPP Sbjct: 53 PPTRPSHSCGPHPVPPTPLVQHPEPEAPPQLPPPP 87 >SB_37296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.3 bits (60), Expect = 9.3 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -1 Query: 775 GXGGAPXGXXXGGGVXGGXXGGGG-GGXG 692 G GGA G GGGV G GG G GG G Sbjct: 380 GLGGA--GVFGGGGVGGAGVGGAGVGGAG 406 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 742 GGGVXGGXXGGGGGGXGXXPAXG 674 GGG GG G GGGG G G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTG 3720 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 703 PXP-PXNXPXPPPPPXPRXPXRPP 771 P P P + P P PPP P P PP Sbjct: 165 PTPAPHSSPSPTPPPPPIIPPCPP 188 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.3 bits (60), Expect = 9.3 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +3 Query: 723 PPXTPPPXXXPXGAPPXPXXXTPPRXNXXIPPPPXXPXNLXXXXXXXXXXXXPPXTXPPX 902 PP PPP P A P P PP IP P P + P P Sbjct: 785 PPEYPPPP--PGLARPNPPPPNPPLQVTSIPGEPAPPF-VKLIASAMAAAFPFPFNPAPA 841 Query: 903 PPXXP 917 PP P Sbjct: 842 PPITP 846 >SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 Query: 700 HPXPPXNXPXPPPPPXPRXPXRPPXP 777 +P PP N P P P P+ P P P Sbjct: 353 NPNPPHNGPKVHPQPSPQWPKVHPQP 378 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 691 TPXHPXPPXNXPXPPPPP 744 TP P PP P PPPP Sbjct: 73 TPPQPTPPPPRPPTPPPP 90 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -1 Query: 775 GXGGAPXGXXXG--GGVXGGXXGGGGGGXG 692 G G P G G GG+ GG GGG G G Sbjct: 626 GMFGTPGGQQSGFHGGIGGGGMGGGFSGQG 655 >SB_16709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 758 RXAPPPXXXNPPPXQXKXPPP 820 R PPP +PPP + PPP Sbjct: 115 RSYPPPPPGSPPPAYTEMPPP 135 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +1 Query: 682 PVXTPXHPXPPXNXPXPP---PPPXPRXPXRPPXP 777 P+ P P PP P PP PPP P PP P Sbjct: 75 PMMMPFPPPPPIYMPPPPVYMPPPPVYMP--PPMP 107 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.310 0.144 0.483 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,973,431 Number of Sequences: 59808 Number of extensions: 295099 Number of successful extensions: 7734 Number of sequences better than 10.0: 171 Number of HSP's better than 10.0 without gapping: 865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3588 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2693287426 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 43 (22.0 bits)
- SilkBase 1999-2023 -