BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D21 (1015 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 25 0.70 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 2.1 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 8.6 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 8.6 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 25.4 bits (53), Expect = 0.70 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 8/79 (10%) Frame = +3 Query: 261 EKKGEVIXEAVKRLIENGKRNTMDFAYQL-------WTKDGKEIVKSYFPI-QFRVIFXE 416 + G + + ++ E+G R + FA + +T KE++ F + +FR+ Sbjct: 606 DSSGYGLGAELYQIQEDGSRGVIAFASRSLRGPELNYTTTEKELLGVIFALHKFRIYI-- 663 Query: 417 QTVKLINKRDHHALKLIDQ 473 Q K+I + DH ALK + + Sbjct: 664 QVTKIIIRTDHQALKFLSR 682 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.8 bits (49), Expect = 2.1 Identities = 21/69 (30%), Positives = 30/69 (43%) Frame = +1 Query: 511 TKPARKSPGSLPPCWKTTEFTSRSCPPRTNST*SSITRKVLVMTVSSTVXAPLTLQTPLV 690 TKP+ + W TT T R+ R +T S+ TR T ++ T+ P V Sbjct: 1037 TKPSTWWSSTTTSPWWTTTTTRRTTTTRPTTT-STTTRP----TTTNWPTQGTTIPPPAV 1091 Query: 691 LEPPVRKHS 717 + P V K S Sbjct: 1092 VMPEVDKPS 1100 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 8.6 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 586 PPRTNST*SSITRKVLVMTVSSTVXAPLTLQTP 684 P T +T S T+ T SST P T +TP Sbjct: 401 PQPTQTTESEPTQASEQPTESSTTQKPQTTKTP 433 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.8 bits (44), Expect = 8.6 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGG 946 G RGG R G GGG Sbjct: 92 GGGRGGGRDGDRGDGGG 108 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,070 Number of Sequences: 336 Number of extensions: 4333 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 58 effective length of database: 103,097 effective search space used: 28764063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -