BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D21 (1015 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 55 8e-08 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 44 1e-04 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 44 3e-04 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 43 5e-04 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 41 0.001 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 41 0.002 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 41 0.002 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 41 0.002 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 40 0.004 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 39 0.007 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.017 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 37 0.023 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 37 0.030 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 37 0.030 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.046 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 36 0.052 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.052 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 35 0.091 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 35 0.091 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 35 0.091 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 35 0.12 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 35 0.12 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 35 0.12 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.21 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 33 0.28 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 33 0.37 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 33 0.48 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 33 0.48 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.48 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 32 0.85 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 32 0.85 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.85 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 31 1.1 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 31 1.1 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 31 1.1 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 31 1.1 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 31 1.1 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 31 1.1 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 31 1.5 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 31 1.5 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 31 1.5 SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 31 2.0 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 31 2.0 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.0 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 30 2.6 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 30 3.4 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.4 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 30 3.4 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 30 3.4 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 29 4.5 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 4.5 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) 29 4.5 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 29 4.5 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 29 6.0 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 29 6.0 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 29 6.0 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 6.0 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 29 6.0 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.9 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 7.9 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 7.9 SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) 29 7.9 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.9 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.9 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 55.2 bits (127), Expect = 8e-08 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P P PPP PPP PPP P P PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 995 PP 1000 PP Sbjct: 430 PP 431 Score = 52.8 bits (121), Expect = 4e-07 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P PPP PPP PPP P P PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 995 PP 1000 PP Sbjct: 426 PP 427 Score = 52.4 bits (120), Expect = 6e-07 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P P PPP PPP PPP P P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Query: 995 P 997 P Sbjct: 432 P 432 Score = 52.0 bits (119), Expect = 7e-07 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P P PPP PPP PPP P P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 995 PP 1000 PP Sbjct: 425 PP 426 Score = 52.0 bits (119), Expect = 7e-07 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P P PPP PPP PPP P P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 995 PP 1000 PP Sbjct: 428 PP 429 Score = 52.0 bits (119), Expect = 7e-07 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P PPP PPP PPP P P PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 995 PP 1000 PP Sbjct: 429 PP 430 Score = 48.8 bits (111), Expect = 7e-06 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P PPP PPP PPP P PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 995 PP 1000 PP Sbjct: 431 PP 432 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P P PPP PPP PPP P P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACA 439 Query: 995 PP 1000 PP Sbjct: 440 PP 441 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPR 988 P P P PP P P P PPP PPP PPP PPR Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPR 442 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P S P P P PP P P P PPP PPP PPP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +3 Query: 813 TPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAX 992 +P P P P P P PP P PP PP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Query: 993 PPPPP 1007 PPPPP Sbjct: 424 PPPPP 428 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPPXXL 1008 PP PPP P PPP PP PP PP L Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPAL 434 Score = 37.1 bits (82), Expect = 0.023 Identities = 20/70 (28%), Positives = 22/70 (31%) Frame = +3 Query: 798 IXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPS 977 I + P P P P P P PP P PP PP P+ Sbjct: 361 INMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP-PPPPPPPPPPPPPPPA 419 Query: 978 XXXAXPPPPP 1007 PPPPP Sbjct: 420 PPPPPPPPPP 429 Score = 35.5 bits (78), Expect = 0.069 Identities = 21/72 (29%), Positives = 22/72 (30%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXS 971 SP P P P P P P PP P PP PP + Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP----PA 419 Query: 972 PSXXXAXPPPPP 1007 P PPPPP Sbjct: 420 PPPPPPPPPPPP 431 Score = 35.5 bits (78), Expect = 0.069 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPPXXL 1008 PP PPP P PPP PP PP P L Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRL 436 Score = 32.3 bits (70), Expect = 0.64 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPPXXL 1008 PP PPP P PP PP PP P L Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPRL 443 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 44.8 bits (101), Expect = 1e-04 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPP----PXPPPXPXXXPLXP 982 P P P P PP P P P PPP PP P PP P P P Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Query: 983 PRXXPP 1000 P PP Sbjct: 210 PYPPPP 215 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 +P P P P PP P P P PPP PP P P P PP Sbjct: 94 YPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPN 153 Query: 992 XP 997 P Sbjct: 154 PP 155 Score = 42.7 bits (96), Expect = 5e-04 Identities = 26/73 (35%), Positives = 26/73 (35%), Gaps = 4/73 (5%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXP---PXPXPXXXXXXXXPXXP-PPXXXXXXPPPXPPPXP 961 PY P P P P P P P P P P PP PPP PP P Sbjct: 98 PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 Query: 962 XXXPLXPPRXXPP 1000 PL PP PP Sbjct: 158 --PPLYPPPPNPP 168 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 PY +P P P P P P P P PPP PP P P P P Sbjct: 155 PYPPPLYPPPPN----PPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Query: 974 LXPPRXXP 997 PP P Sbjct: 211 YPPPPNAP 218 Score = 41.9 bits (94), Expect = 8e-04 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 PY +P P P P PP P P P P P PP PPP P Sbjct: 173 PYPPPPYPPPPNPPYPPP-PNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNP 231 Query: 974 LXPPRXXP 997 PP P Sbjct: 232 PYPPPPNP 239 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP-PXPXXXPLXPPRXXP 997 P PP P P P PPP PPP P P P P PP P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P PP P P P PPP PP PPP P P P PP Sbjct: 142 PSPNAPYPPPPNPPYPPPLYPPP---PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P PPP PPP PP P PP Sbjct: 168 PPPNAPYPPPPYPPPPNP---PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPP 224 Query: 995 PP 1000 PP Sbjct: 225 PP 226 Score = 39.1 bits (87), Expect = 0.006 Identities = 25/77 (32%), Positives = 26/77 (33%), Gaps = 8/77 (10%) Frame = +2 Query: 794 PYSXXXHPX--PXXXXXXPXXPXPPXPXPXXXXXXXXPXXP------PPXXXXXXPPPXP 949 PY +P P P P PP P P P P PP PPP Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN 166 Query: 950 PPXPXXXPLXPPRXXPP 1000 PP P P PP PP Sbjct: 167 PP-PPNAPYPPPPYPPP 182 Score = 38.3 bits (85), Expect = 0.010 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 8/77 (10%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXP------PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 PY +P P P P P P P PPP PPP PPP Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPP 182 Query: 956 --XPXXXPLXPPRXXPP 1000 P P PP PP Sbjct: 183 PNPPYPPPPNPPYPPPP 199 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP PP P A PPPP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P P P PP P PP PP P PPPP Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPP 207 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PPP P PP PP PP PP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P P PP P PP PP P PPPP Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 32.3 bits (70), Expect = 0.64 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +3 Query: 813 TPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAX 992 +P P P P P P P PP PP PS Sbjct: 89 SPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPY 148 Query: 993 PPPP 1004 PPPP Sbjct: 149 PPPP 152 Score = 32.3 bits (70), Expect = 0.64 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP P PP P P+ PPPP Sbjct: 189 PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 31.9 bits (69), Expect = 0.85 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +3 Query: 816 PXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXP 995 P P P P P P PP P PP P +P P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Query: 996 PPPP 1007 P PP Sbjct: 155 PYPP 158 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXP--PXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P P P PP PP P+ PP PP Sbjct: 131 PYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP 181 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/49 (28%), Positives = 16/49 (32%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP P PP P +P+ PP P Sbjct: 181 PPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 29.1 bits (62), Expect = 6.0 Identities = 16/52 (30%), Positives = 16/52 (30%), Gaps = 3/52 (5%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXP---PXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP P P P PP P PP PP Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPP 224 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P PPP PPP P P P L PP PP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 43.6 bits (98), Expect = 3e-04 Identities = 25/85 (29%), Positives = 29/85 (34%) Frame = +2 Query: 731 IKLLXXPQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXP 910 +K + P ++ L P P P P P PP P P P P Sbjct: 673 LKKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Query: 911 PPXXXXXXPPPXPPPXPXXXPLXPP 985 P PPP PPP P L PP Sbjct: 733 QP-GCAGLPPPPPPPPPGCAGLPPP 756 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P P PP P P P PPP PPP P P Sbjct: 715 PPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 29.5 bits (63), Expect = 4.5 Identities = 16/64 (25%), Positives = 16/64 (25%) Frame = +3 Query: 816 PXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXP 995 P P P P P PP P PP P P Sbjct: 682 PLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPP 741 Query: 996 PPPP 1007 PPPP Sbjct: 742 PPPP 745 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 43.6 bits (98), Expect = 3e-04 Identities = 25/76 (32%), Positives = 28/76 (36%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G G GGG GGG GGG G G G GG G G G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Query: 819 XGXXXXE*GFNRNXNG 772 G + G + +G Sbjct: 832 DGGGFGDGGGYADGDG 847 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G GGG GGG GGG G G G GG G G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G G G G GGG GGG G G G GG G G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 816 G 814 G Sbjct: 829 G 829 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G G GGG GGG GGG G G GG G G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Query: 819 XG 814 G Sbjct: 830 YG 831 Score = 39.1 bits (87), Expect = 0.006 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GGG G G GGG G G G GG G G G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDG-GGFGDGGGYADGDG 847 Query: 819 XG 814 G Sbjct: 848 GG 849 Score = 39.1 bits (87), Expect = 0.006 Identities = 26/81 (32%), Positives = 27/81 (33%), Gaps = 2/81 (2%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGG--GXXGXXXXXXXXGXGXGGXGXXGXXXXX 826 GG GG G G GGG GGG GG G G G GG G G Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 Query: 825 XGXGXXXXE*GFNRNXNGTIR 763 G G G G I+ Sbjct: 859 GGGGGGGGGGGGGGGGGGVIK 879 Score = 37.1 bits (82), Expect = 0.023 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXG---GXGXXGXXXX 829 GG GG G G G G GGG GGG G G G G G G G Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Query: 828 XXGXG 814 G G Sbjct: 855 GGGGG 859 Score = 36.7 bits (81), Expect = 0.030 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G G G GGG GGG G G GG G G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGG 852 Query: 819 XG 814 G Sbjct: 853 GG 854 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 42.7 bits (96), Expect = 5e-04 Identities = 32/109 (29%), Positives = 38/109 (34%), Gaps = 2/109 (1%) Frame = +2 Query: 665 R*HFKHHWYLSLQYESTLSSYTIKLLXXPQXXARIVPLXFLLKPYSXXXHPXPXXXXXXP 844 R H HH + S Y+S+ SS ++K L P + L S P P Sbjct: 222 RSHHHHHHHSSSHYKSSSSS-SLKPLIPPSPTLGLRD-KHLASSSSKGHPPIPSASQNAT 279 Query: 845 XXPXPPXPX--PXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PP P P PPP PPP P P P PP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GGG GGG GG G G G GG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 972 GXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 G G GGG GGG GGG G G G GG G G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 37.5 bits (83), Expect = 0.017 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = -2 Query: 960 GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXGXXXXE*GFNRN 781 G GGG GGG GGG G G GG G G G G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFGSTYT 123 Query: 780 XNGTIR 763 GTI+ Sbjct: 124 KIGTIQ 129 Score = 32.7 bits (71), Expect = 0.48 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = -2 Query: 960 GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXGXXXXE*GFNRN 781 G GGG GGG GGG G G G GG G G G G G R Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDD-----GDGGGGDGGGGGGGGDGGGGGGGGGGGVGRA 116 Query: 780 XNGT 769 G+ Sbjct: 117 RFGS 120 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/63 (33%), Positives = 22/63 (34%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 +P P P P P P P PPP PPP PPP P PP Sbjct: 345 NPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTN--GPPPPPPPTNGPPPPPPPTN 402 Query: 992 XPP 1000 PP Sbjct: 403 GPP 405 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/69 (31%), Positives = 23/69 (33%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P + P P P P P P P PPP PPP PPP P Sbjct: 350 PTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNG---PPPPPPPTNGPPP 406 Query: 974 LXPPRXXPP 1000 PP PP Sbjct: 407 PPPPTNGPP 415 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PP PPP P P P P Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Query: 995 PP 1000 PP Sbjct: 408 PP 409 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP PP PP P PPPPP Sbjct: 350 PTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP PP P PPPP Sbjct: 369 PPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP PP PP P PPPPP Sbjct: 370 PTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 H P P P P P PPP PPP PPP P PP Sbjct: 275 HDIPEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Query: 992 XPP 1000 PP Sbjct: 335 PPP 337 Score = 33.1 bits (72), Expect = 0.37 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP PP P A PPPPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPP-PGDGGAPPPPPP 336 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP +P PPPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GG GGG GGG G G G GG G G Sbjct: 169 GGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 39.1 bits (87), Expect = 0.006 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG RGG G G GGG G GGG G G G GG G G G Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRG-GGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Query: 819 XG 814 G Sbjct: 183 GG 184 Score = 37.9 bits (84), Expect = 0.013 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG RG RG GGG GGG GGG G G G GG G G Sbjct: 158 GGGYRGRGRGGGGYGGGGYGGG---GYGGGGHGGGGYGGGGYGGGGGGYGGSG 207 Score = 33.9 bits (74), Expect = 0.21 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G GG G G GG GGG GGG G G G GG G G Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYG-GGGGGYGGSGYGGGGGYG 215 Score = 33.5 bits (73), Expect = 0.28 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = -2 Query: 996 GXXRGGXRGXXXGX--GGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXX 823 G GG RG G GGG GG GGG G G G GG G G Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRG--RGRGGGGYGGGGYGGGGYGGGGH 186 Query: 822 GXG 814 G G Sbjct: 187 GGG 189 Score = 33.1 bits (72), Expect = 0.37 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGG--GXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXX 826 GG R G G G GG G GGG GGG G G G GG G G Sbjct: 139 GGGYRSG--GGYRGGGGYRGGGGGYRGRGRGGGGYG-GGGYGGGGYGGGGHGGGGYGGGG 195 Query: 825 XGXG 814 G G Sbjct: 196 YGGG 199 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G GGG GGG G G G G G G Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGG 227 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 1007 RXXGGXXXXXXGGXXXXXGGXXGGGXXGXXXGGG 906 R GG GG GG GGG G GGG Sbjct: 166 RGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGG 199 Score = 29.1 bits (62), Expect = 6.0 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXG 859 GG GG G GGG GG GGG G G G Sbjct: 182 GGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G GGG GGG GGG G G G GG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G GGG GGG GGG G G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 G GG G G GGG GGG GGG G G G GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 39.1 bits (87), Expect = 0.006 Identities = 21/62 (33%), Positives = 23/62 (37%) Frame = -2 Query: 960 GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXGXXXXE*GFNRN 781 G GGG GGG GGG G G G GG G G G G + + N Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGDVDSN 721 Query: 780 XN 775 N Sbjct: 722 NN 723 Score = 38.7 bits (86), Expect = 0.007 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = -2 Query: 981 GXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXGXXXX 802 G G G GGG GGG GGG G G G GG G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Query: 801 E*GFNRN 781 + N N Sbjct: 717 DVDSNNN 723 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GGG GGG GGG G G G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 38.3 bits (85), Expect = 0.010 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GGG GGG GGG G G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 35.1 bits (77), Expect = 0.091 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 G G G GGG GGG GGG G G G G G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PP P P P PPP PP PPP P PP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPR 988 P P PP P P P PPP PPP PP L PR Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPP--PPPPIGGGAPPPPPPGFGGFANLVKPR 717 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 39.1 bits (87), Expect = 0.006 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG RGG RG G GG G G GGG G G GG G Sbjct: 145 GGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGG 194 Score = 36.7 bits (81), Expect = 0.030 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 3/76 (3%) Frame = -2 Query: 987 RGGXRGXXXGXGGGXGGG---XXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 RGG RG G G G GGG GGG G G GG G G G Sbjct: 129 RGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGG 188 Query: 816 GXXXXE*GFNRNXNGT 769 G R GT Sbjct: 189 SRGGGGDGRGRGRGGT 204 Score = 36.3 bits (80), Expect = 0.039 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG RGG RG G GGG G G GG G G G G G G Sbjct: 122 GGVQRGG-RGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 Query: 819 XG 814 G Sbjct: 181 RG 182 Score = 33.5 bits (73), Expect = 0.28 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG RGG G G GG GG GGG G G G G G Sbjct: 151 GGRGRGGGEGGWGGRGG--NGGGRGGGEGGGGRGRGTGGGSRGGGGDGRG 198 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 1007 RXXGGXXXXXXGGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 R G GG GG GGG G GGG GG Sbjct: 155 RGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGG 193 Score = 29.1 bits (62), Expect = 6.0 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G RGG + G G GGG GG G G G GG G G G Sbjct: 118 GWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRG---GGRGRGGGEGGWGGRGGNGGGRGG 174 Query: 816 G 814 G Sbjct: 175 G 175 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG--XGGXGXXGXXXXX 826 GG GG G G GG GGG GGG G G G GG G G Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 302 Query: 825 XGXG 814 G G Sbjct: 303 TGGG 306 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG--XGGXGXXGXXXXX 826 GG GG G G GG GGG GGG G G G GG G G Sbjct: 271 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGA 330 Query: 825 XGXG 814 G G Sbjct: 331 TGGG 334 Score = 37.1 bits (82), Expect = 0.023 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G GG GGG GGG G G G G G Sbjct: 264 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVG 313 Score = 35.9 bits (79), Expect = 0.052 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GG GGG GGG G G G GG G G Sbjct: 320 GGGATGGGVGATGGGGGATGGGGGVTGGGGGATG-----GGGGPGSGGCGEDG 367 Score = 35.1 bits (77), Expect = 0.091 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GG GGG GGG G G G G G G Sbjct: 257 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT--GGGGGATGGGG 307 Score = 35.1 bits (77), Expect = 0.091 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG--XGGXGXXGXXXXX 826 GG GG G G GG G G GGG G G G GG G G Sbjct: 292 GGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGA 351 Query: 825 XGXG 814 G G Sbjct: 352 TGGG 355 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G G GGG GGG G G G G G Sbjct: 313 GGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 Score = 33.5 bits (73), Expect = 0.28 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGG-XGGGXXXXXXGGGXXGXXXXXXXXGXG--XGGXGXXGXXXX 829 GG G G G GGG GGG GGG G G G GG G G Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGG 315 Query: 828 XXGXG 814 G G Sbjct: 316 ATGGG 320 Score = 33.1 bits (72), Expect = 0.37 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = -2 Query: 987 RGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG--XGGXGXXGXXXXXXGXG 814 R G G G GG GGG GGG G G G GG G G G G Sbjct: 240 RLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 299 Score = 32.3 bits (70), Expect = 0.64 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 2/55 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGG-XGGGXXXXXXGGGXXGXXXXXXXXGXG-XGGXGXXG 841 GG G G G GGG GGG GGG G G G GG G G Sbjct: 305 GGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPG 359 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 1007 RXXGGXXXXXXGGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 R GG GG GG GGG GGG GG Sbjct: 240 RLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 278 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG 865 GG GG G G GG GGG G G G G G Sbjct: 334 GGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDGTENVSLEFGSG 378 Score = 29.9 bits (64), Expect = 3.4 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGG-GXGGGXXXXXXGGGXXGXXXXXXXXGXG--XGGXGXXGXXXX 829 GG GG G G GG GGG GGG G G G GG G G Sbjct: 285 GGGATGGGGGATGGGGGA-TGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGG 343 Query: 828 XXGXG 814 G G Sbjct: 344 VTGGG 348 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 800 SXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLX 979 S P P P P PP P P P P P PPP P P Sbjct: 199 SQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTL 258 Query: 980 PP 985 PP Sbjct: 259 PP 260 Score = 36.7 bits (81), Expect = 0.030 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXP-PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPR 988 HP P P P P P P P PPP PPP PPP P PL Sbjct: 194 HPTSPSQITQPPPPPPRPPPSP-------PPPPPPPSPSPPRPPPPPPPSP-PRPLAAKL 245 Query: 989 XXPP 1000 PP Sbjct: 246 PEPP 249 Score = 33.9 bits (74), Expect = 0.21 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 912 PXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP PP SPS PPPPP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 P P P P PP P P P P PP PPP Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P P P P PP P PP PP + PP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP PP P A P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPP 249 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 38.3 bits (85), Expect = 0.010 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P PPP PPP PPP P P PP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 36.7 bits (81), Expect = 0.030 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P PPP PPP PPP P PP PP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPP----PPPPPPPPQPSTPPPPPPSTPP 715 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 P P P P PP P P P PPP PPP PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPP------PPPSTPP 715 Score = 29.5 bits (63), Expect = 4.5 Identities = 19/77 (24%), Positives = 22/77 (28%) Frame = +2 Query: 770 VPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP 949 +P+ L P P P P P PP P P P P P P Sbjct: 669 IPIQILPIPIQTMVPPPPPPP---PPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Query: 950 PPXPXXXPLXPPRXXPP 1000 P P+ PP Sbjct: 726 AGSPSGTSAGNPQQQPP 742 Score = 29.1 bits (62), Expect = 6.0 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 924 PXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP PP P + PPPPP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 924 PXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP PP P PPPPP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXP 996 PP PPP P P PP PP P Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXP 996 PP PP P PPP PP P P Sbjct: 695 PPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.5 bits (83), Expect = 0.017 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGG---GXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXX 829 GG GG R G GG G GGG GGG G G G GG G Sbjct: 181 GGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGG 240 Query: 828 XXGXG 814 G G Sbjct: 241 SKGGG 245 Score = 33.1 bits (72), Expect = 0.37 Identities = 24/76 (31%), Positives = 27/76 (35%), Gaps = 3/76 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGG---GXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXX 829 G GG +G GGG G G GGG G G G GG G G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRH 235 Query: 828 XXGXGXXXXE*GFNRN 781 G G G++RN Sbjct: 236 DYGGGSKGG--GYDRN 249 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 37.1 bits (82), Expect = 0.023 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 GG G RG G GGG G G GGG G G G GG Sbjct: 94 GGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 37.1 bits (82), Expect = 0.023 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 981 GXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G RG G GGG GGG GGG G G G GG G G Sbjct: 81 GGRGGGFGGGGGFGGG-GGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 37.1 bits (82), Expect = 0.023 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 987 RGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 RGG G G GGG GGG GG G G G GG G Sbjct: 83 RGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 36.7 bits (81), Expect = 0.030 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 975 RGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 R G GGG GGG GGG G G G GG G G Sbjct: 77 RASVGGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGG 121 Score = 34.7 bits (76), Expect = 0.12 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G GG G G GGG GGG GGG G G G GG G G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG-------GGFGGGGGGGFG 128 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG GG G G GGG GGG GG G Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 31.1 bits (67), Expect = 1.5 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG G G G GGG GGG GGG G Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 37.1 bits (82), Expect = 0.023 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGG-GXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXX 823 GG GG G G GG GG G GGG G G GG G G Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG 1818 Query: 822 GXG 814 G G Sbjct: 1819 GGG 1821 Score = 35.9 bits (79), Expect = 0.052 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 GG G G G GGG GGG GG G G G GG Sbjct: 1799 GGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 35.1 bits (77), Expect = 0.091 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G G GGG GG GG G G G GG G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Query: 816 G 814 G Sbjct: 1816 G 1816 Score = 33.9 bits (74), Expect = 0.21 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GGG GGG GG G G GG G G Sbjct: 1794 GGEGMGG--GGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXG-GGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG GGG G GG GGG G G G G G Sbjct: 1778 GGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAG 1828 Score = 30.3 bits (65), Expect = 2.6 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G GGG GG GGG G G G G G G Sbjct: 1788 GGGEFGGGEGMG---GGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGG 1844 Query: 819 XG 814 G Sbjct: 1845 GG 1846 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 36.7 bits (81), Expect = 0.030 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PPP PPP PPP P P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 36.7 bits (81), Expect = 0.030 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP PPP P P PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 36.7 bits (81), Expect = 0.030 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PPP PPP PPP P P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 35.9 bits (79), Expect = 0.052 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 PPP PPP PPP P P PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPP 975 PP PPP P PPP PP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPP 975 PP PPP P PPP PP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPP 975 PP PPP P PPP PP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 34.7 bits (76), Expect = 0.12 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPP 975 PP PPP P PPP PP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 907 PPPXXXPXXPPPXXPPXXXXXPPXXXXXXPPXXL 1008 PPP P PPP PP PP PP L Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPL 497 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P PP P P P PPP PPP PPP P Sbjct: 464 PPPPPPPP-------PPPPPPPPPPPPPPPPFPPPPP 493 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXP 982 P PPP PPP PPP P P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 PP P P P PPP PPP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXP 972 PP PPP P PPP PP P Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 36.7 bits (81), Expect = 0.030 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PPP PPP PP P P R Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPP--PPPARMGTAPPPPPPSRSSQRPPPPSRGA 345 Query: 995 PP 1000 PP Sbjct: 346 PP 347 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 909 PPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 PP P PP PP PS PPPPP Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 1/49 (2%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP-RXXPP 1000 PP P PPP PPP PPP P PP PP Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP PP S PPPPP Sbjct: 357 PVGGAAPPPPPPPPVGGP---PPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 31.1 bits (67), Expect = 1.5 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP---XPX 964 P S P P P P PP P P P PPP PPP P Sbjct: 348 PPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP---PIEGRPPSSLGNPPPPPPPGRGAPP 404 Query: 965 XXPLXPPR 988 P+ P R Sbjct: 405 PGPMIPGR 412 Score = 29.5 bits (63), Expect = 4.5 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 3/72 (4%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P S P P P P P PPP PPP PPP P Sbjct: 330 PPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGG---PPPPPPPIEGRPP 386 Query: 974 L---XPPRXXPP 1000 PP PP Sbjct: 387 SSLGNPPPPPPP 398 Score = 29.1 bits (62), Expect = 6.0 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P S P P P PP PPP PPP P P Sbjct: 308 PPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPP 367 Query: 974 LXPPRXXPP 1000 PP PP Sbjct: 368 -PPPVGGPP 375 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.039 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP-PPXPXXXPLXPPRX 991 P P P P PP P P PP PPP P PP P P P Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPP-----PPPPLPAPPPPPAQPAPQPPP 107 Query: 992 XPP 1000 PP Sbjct: 108 APP 110 Score = 35.5 bits (78), Expect = 0.069 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P P PPP PP P P P PP PP Sbjct: 50 PPPPPPSPPAAA----PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPP 95 Score = 34.3 bits (75), Expect = 0.16 Identities = 19/72 (26%), Positives = 20/72 (27%) Frame = +2 Query: 782 FLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 F P+ P P P P P P PP P P PPP P Sbjct: 39 FTYYPHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Query: 962 XXXPLXPPRXXP 997 PP P Sbjct: 99 AQPAPQPPPAPP 110 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP P+ A PPPPP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P P PP PP P P PP P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQP 101 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P P P P PP P PP PP P A PPP Sbjct: 62 PAAPPPPAAAPAAP--PPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 36.3 bits (80), Expect = 0.039 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P P PP P PPP PPP PPP P Sbjct: 946 PPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 33.9 bits (74), Expect = 0.21 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +2 Query: 842 PXXPXPPX---PXPXXXXXXXXPXXPPPXXXXXXPPPXPP--PXPXXXPLXPPRXXPP 1000 P P PP P P P PPP PPP PP P PP PP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 32.7 bits (71), Expect = 0.48 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP PPP PP PPP P PP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGA--PPLPPPPGGSAPPPPPPPPP 990 Query: 995 PP 1000 PP Sbjct: 991 PP 992 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P P PP P A PPPPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 28.7 bits (61), Expect(2) = 0.046 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 5/45 (11%) Frame = +2 Query: 842 PXXPXPPXPX-----PXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P PP P P P PP PPP PP P Sbjct: 684 PPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPP 728 Score = 26.2 bits (55), Expect(2) = 0.046 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 935 PPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP PP PP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPP 776 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 35.9 bits (79), Expect = 0.052 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 G RGG RG G GG GGG GGG G G GG G G Sbjct: 191 GRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYG--GYGNYGGYSQGGYGGYADNSWSGG 248 Query: 819 XG 814 G Sbjct: 249 YG 250 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 35.9 bits (79), Expect = 0.052 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG-XGGXG 850 GG GG G G GG GGG GGG G G G GG G Sbjct: 65 GGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHG 115 Score = 35.5 bits (78), Expect = 0.069 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG--XGGXGXXGXXXXX 826 GG GG G G GG GG GGG G G G GG G G Sbjct: 58 GGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGA 117 Query: 825 XGXG 814 G G Sbjct: 118 TGGG 121 Score = 32.7 bits (71), Expect = 0.48 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G G GG GGG G G G GG G G G Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG 99 Query: 816 G 814 G Sbjct: 100 G 100 Score = 32.3 bits (70), Expect = 0.64 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG--XXXXXXXXGXGXGGXGXXGXXXXX 826 GG GG G G GG GGG GG G G GG G G Sbjct: 100 GGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGA 159 Query: 825 XGXG 814 G G Sbjct: 160 TGGG 163 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG-XGGXG 850 G GG G GG GGG GGG G G G GG G Sbjct: 80 GGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHG 129 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 972 GXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 G G GG GG GGG G G GG G G G G Sbjct: 34 GVVVGHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGG 86 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 G GG G G GG GGG GGG G Sbjct: 136 GGATGGHGGATGGGGGATGGGGGATGGGGGATG 168 Score = 29.9 bits (64), Expect = 3.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G GG GGG GG G G G G G Sbjct: 53 GGGATGG--GATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGG 100 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 35.9 bits (79), Expect = 0.052 Identities = 17/62 (27%), Positives = 19/62 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P P P P P PP P+ + Sbjct: 909 PPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVP 968 Query: 995 PP 1000 PP Sbjct: 969 PP 970 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXP--PPXXXXXXPPPXPPPXPXXXPLXPPR 988 P P P PP P P P P P P PPP P P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPAT 965 Query: 989 XXPP 1000 PP Sbjct: 966 QVPP 969 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P PPP PPP PP P PP P Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLP-PLPPPPPPVQTTTAPTLPPASCMP 997 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXP 996 P PPP PPP PP PP P Sbjct: 954 PTSALPPPIPATQVPPPPLPPLPPPPPPVQTTTAP 988 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 35.1 bits (77), Expect = 0.091 Identities = 22/73 (30%), Positives = 24/73 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 G GG R GGG GG GGG G G G GG G Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRD 143 Query: 819 XGXXXXE*GFNRN 781 G G++RN Sbjct: 144 YGGGSKGGGYDRN 156 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 35.1 bits (77), Expect = 0.091 Identities = 21/78 (26%), Positives = 25/78 (32%), Gaps = 6/78 (7%) Frame = +2 Query: 785 LLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP---- 952 ++ P + P P PP P P PP PPP PP Sbjct: 144 VMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 203 Query: 953 --PXPXXXPLXPPRXXPP 1000 P P+ PPR PP Sbjct: 204 RTQPPPIPPIDPPRTQPP 221 Score = 30.7 bits (66), Expect = 2.0 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP---PXPXXXPLXPP 985 P P P PP P P P PP PPP PP P P+ P Sbjct: 168 PPPIFPIDPPRTQPPPIP-PIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQ 226 Query: 986 RXXP 997 P Sbjct: 227 PTTP 230 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.1 bits (77), Expect = 0.091 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG GG RG G GGG GGG GG G Sbjct: 323 GGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 31.1 bits (67), Expect = 1.5 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG R G GG GG GGG G G G G Sbjct: 94 GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYG 143 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 35.1 bits (77), Expect = 0.091 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +2 Query: 815 PXPXXXXXXPXX-PXPPX--PXPXXXXXXXXPXXP-PPXXXXXXPPPXPPPXPXXXPLXP 982 P P P P PP P P P PP PPP P P P P Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPP 1072 Query: 983 PRXXPP 1000 PR PP Sbjct: 1073 PRQPPP 1078 Score = 35.1 bits (77), Expect = 0.091 Identities = 22/77 (28%), Positives = 23/77 (29%), Gaps = 6/77 (7%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXP------PXPXPXXXXXXXXPXXPPPXXXXXXPPPXP 949 LKP P P P P P P P PP PP P Sbjct: 1017 LKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQP 1076 Query: 950 PPXPXXXPLXPPRXXPP 1000 PP P+ PPR P Sbjct: 1077 PPPSTSQPVPPPRQPDP 1093 Score = 30.3 bits (65), Expect = 2.6 Identities = 24/90 (26%), Positives = 25/90 (27%), Gaps = 3/90 (3%) Frame = +2 Query: 740 LXXPQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXX---PXPPXPXPXXXXXXXXPXXP 910 L P + VP P S P P P P P P P P P Sbjct: 1017 LKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQP 1076 Query: 911 PPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP PP P P P PP Sbjct: 1077 PPPSTSQPVPPPRQPDPIPTNPAHPTEPPP 1106 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 35.1 bits (77), Expect = 0.091 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 3/55 (5%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXX---PPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P PP P P P PPP PPP P P P PP+ P Sbjct: 65 PVASTPPAPQPVPNNMGPPPHVNQGPPPNSANQAPPPNPGPSPSFNSQGPPQRLP 119 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG GG G G GGG GGG GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG GG G G GGG GGG GGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG GG G G GGG GGG GGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 34.3 bits (75), Expect = 0.16 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 960 GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 G GGG GGG GGG G G G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 951 GGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GGG GGG G G G GG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 960 GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G GGG GGG GGG G G G G G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 998 GGXXXXXXGGXXXXXGGXXGGGXXGXXXGGGXXXG 894 GG GG GG GGG G GGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PPP P PP PP PP PP Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 866 PXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P P P PPP PPP PPP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 914 PXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PPP PPP P P P PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPP 216 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPP 998 P P P PP P PP PP P PP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P PPP PPP PPP P P+ PP Sbjct: 159 PATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 34.3 bits (75), Expect = 0.16 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PP PPP PP P PP Sbjct: 98 PTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPI 157 Query: 995 PP 1000 P Sbjct: 158 AP 159 Score = 34.3 bits (75), Expect = 0.16 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P + P P P PP P P P PP PPP PP P Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 Score = 33.9 bits (74), Expect = 0.21 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PP PPP PP P PP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPI 170 Query: 995 PP 1000 P Sbjct: 171 AP 172 Score = 33.5 bits (73), Expect = 0.28 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P PPP PPP PPP P L PP Sbjct: 169 PIAPAATVPAPAVPLAAASP--PPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 31.9 bits (69), Expect = 0.85 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 2/59 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPX--PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P P P P P PPP PP PPP PP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPP 166 Score = 31.9 bits (69), Expect = 0.85 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 6/75 (8%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP------XPPP 955 P S P P PP P P P PP P P PP Sbjct: 130 PTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPP 189 Query: 956 XPXXXPLXPPRXXPP 1000 P P PP PP Sbjct: 190 PPSGGPPPPPPPPPP 204 Score = 28.7 bits (61), Expect = 7.9 Identities = 17/64 (26%), Positives = 19/64 (29%) Frame = +3 Query: 813 TPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAX 992 TP P P P P PP PP PP +P+ Sbjct: 97 TPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP----IAPATGGPP 152 Query: 993 PPPP 1004 PPPP Sbjct: 153 PPPP 156 Score = 28.7 bits (61), Expect = 7.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P PP PP PP P A PPPP Sbjct: 182 PLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.3 bits (75), Expect = 0.16 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 G G G G GG GGG GGG G G G GG G G Sbjct: 50 GNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Query: 819 XG 814 G Sbjct: 110 NG 111 Score = 33.1 bits (72), Expect = 0.37 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGG-GXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXX 823 GG GG G G GG G GGG GGG G G G Sbjct: 41 GGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVG 100 Query: 822 GXG 814 G G Sbjct: 101 GGG 103 Score = 29.9 bits (64), Expect = 3.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 981 GXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G G G GGG GGG GG G G G G G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGG 79 Score = 29.5 bits (63), Expect = 4.5 Identities = 21/77 (27%), Positives = 22/77 (28%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G G GG GG GG G G G G G G Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGA 87 Query: 819 XGXXXXE*GFNRNXNGT 769 G G N G+ Sbjct: 88 AGAAGAGAGGNVGGGGS 104 >SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 33.9 bits (74), Expect = 0.21 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 GG G G GGG GGG GGG G G GG Sbjct: 46 GGGVGDDDGGGGGCGGGDDDDDGGGGGDDDDDDDDDDGGGGGG 88 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 908 PPPXXXXXXPPPXPP---PXPXXXPLXPPRXXPP 1000 PPP PPP PP P P P PP PP Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPP 588 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/50 (30%), Positives = 15/50 (30%), Gaps = 1/50 (2%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXX-PXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP P P PPPPP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 33.5 bits (73), Expect = 0.28 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGG-GXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG RGG G GGG GG G GGG G G G GG G Sbjct: 203 GGRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYG-GGGGYG 252 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 33.5 bits (73), Expect = 0.28 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP P P PPP P PPP P P PP PP Sbjct: 280 PPPPPPLTGGML-----PPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 33.1 bits (72), Expect = 0.37 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 935 PPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP P P PP PP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPP 1180 Score = 32.7 bits (71), Expect = 0.48 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXP 973 P PPP PPP PPP P P Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P PP P P P PPP PPP PPP P Sbjct: 1157 PPPPPPPPPPP-----PSSPSPPPP-----PPPPPPPPTP 1186 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPP 975 PP PPP P P P PP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP PP P P PP PP Sbjct: 1157 PPPPPP---PPPPPPSSPSPPPPPPPPPPPP 1184 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXP 982 P PPP P P PPP P P P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 924 PXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP PP SP PPPPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 33.1 bits (72), Expect = 0.37 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 5/74 (6%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPX---PXPXXXXXXXXPXXPPPXXXXXXP--PPXPPPX 958 PYS P P P P P P P P P PP PPP Sbjct: 121 PYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQ 180 Query: 959 PXXXPLXPPRXXPP 1000 P PP+ PP Sbjct: 181 AYPQPGYPPQGYPP 194 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 32.7 bits (71), Expect = 0.48 Identities = 19/64 (29%), Positives = 22/64 (34%) Frame = -2 Query: 960 GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXGXXXXE*GFNRN 781 G GGG GGG GGG G G G G G G + + + Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDGDADNDDDDD 100 Query: 780 XNGT 769 NGT Sbjct: 101 DNGT 104 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 972 GXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G G GGG GGG G G G G GG G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG G G GGG GGG G G G GG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 32.7 bits (71), Expect = 0.48 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP PPP P PP+ PP Sbjct: 654 PPPPGGGMFPPP-PPPPPGGGVPGPPKPPPP 683 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 32.7 bits (71), Expect = 0.48 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXG 859 G RGG G G GG GG GGG G G G G Sbjct: 439 GDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG GG G G GGG GGG GG G Sbjct: 451 GGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 32.7 bits (71), Expect = 0.48 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P H P P P P P P PPP PP P Sbjct: 437 PQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRG 496 Query: 974 LXPPRXXPP 1000 PPR PP Sbjct: 497 PPPPRGMPP 505 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 2/62 (3%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXP--XXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PPP PPP P PP Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFG 488 Query: 995 PP 1000 PP Sbjct: 489 PP 490 Score = 28.7 bits (61), Expect = 7.9 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP---XPPPXPXXXPLXPP 985 P P P P P P P PPP PPP PPP PP Sbjct: 460 PPPGGMRGMPPPPMGMYPPPRGFPPP--PFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 Query: 986 RXXPP 1000 + P Sbjct: 518 QVHYP 522 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 32.3 bits (70), Expect = 0.64 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXP 982 PPP PPP PPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 935 PPPXPPPXPXXXPLXPPRXXP 997 PPP PPP P P PP P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSP 75 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 935 PPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP P P PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 32.3 bits (70), Expect = 0.64 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP-PPXPPPXPXXXPLXPPRX 991 P P P PP P PPP P PP PP P P PP Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGP 1283 Query: 992 XPP 1000 P Sbjct: 1284 PGP 1286 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 PP P P PPP PP PP P P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 32.3 bits (70), Expect = 0.64 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P PPP PP P P P PP PP Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAP--PPPPAPP 209 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 860 PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P P P PPP PPP PPP L P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 31.9 bits (69), Expect = 0.85 Identities = 24/73 (32%), Positives = 26/73 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG R G GG GG GGG G G GG G G G Sbjct: 185 GGSQGGGYRSGGGGYGGSSRGGYGGGRGGGG----------YGGGRGGGGGYGGGRRDYG 234 Query: 819 XGXXXXE*GFNRN 781 G G++RN Sbjct: 235 GGSKGG--GYDRN 245 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 911 PPXXXXXXPPPXPPPXPXXXPLXPP 985 PP PPP PPP P P PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 31.9 bits (69), Expect = 0.85 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P PP P P P P PPP P P PP Sbjct: 105 PPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXP 982 P PP PPP PPP P P P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 29.1 bits (62), Expect = 6.0 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P P PP P P PP PPP P P PP P Sbjct: 136 PAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPPAP--MPAPPPMVVP 185 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG G G GGG GGG GGG G Sbjct: 88 GGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG G GGG GGG GGG G G G G Sbjct: 75 GGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGG 907 GG GG G G GGG GGG GG Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGGGDDCEDGG 112 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/73 (27%), Positives = 21/73 (28%), Gaps = 2/73 (2%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP--PPXPPPXP 961 L P+ P P P P P P P P P P P P P Sbjct: 225 LHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPN 284 Query: 962 XXXPLXPPRXXPP 1000 PL PP P Sbjct: 285 PSIPLAPPNPYIP 297 Score = 29.1 bits (62), Expect = 6.0 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 6/75 (8%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXP--PPXXXXXXPPPXP--PPXP 961 P+ P P P P P P P P PP PP P PP P Sbjct: 259 PFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAP 318 Query: 962 --XXXPLXPPRXXPP 1000 P PP P Sbjct: 319 PNPYIPTAPPNPSIP 333 Score = 29.1 bits (62), Expect = 6.0 Identities = 20/70 (28%), Positives = 20/70 (28%), Gaps = 1/70 (1%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPX-PXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXX 970 PY P P PP P P P PP PP PP P Sbjct: 294 PYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPA--PPNPSIP 351 Query: 971 PLXPPRXXPP 1000 P P PP Sbjct: 352 PAPPNLFIPP 361 Score = 28.7 bits (61), Expect = 7.9 Identities = 18/70 (25%), Positives = 19/70 (27%), Gaps = 1/70 (1%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPX-PXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXX 970 P + P P P PP P P P PP PP P P Sbjct: 182 PSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIA 241 Query: 971 PLXPPRXXPP 1000 PP P Sbjct: 242 TPNPPMPETP 251 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 G RGG RG G G G GGG GG G Sbjct: 45 GGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGG 77 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGG 907 GG RGG G G GGG GGG GGG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGG--GRGGGGG 365 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGG 907 GG GG G G GGG GGG G G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 P P PP P P PPP PPP PPP Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPP-----PPPPTPPP 372 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 31.5 bits (68), Expect = 1.1 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G RGG RG GG GGG GGG G G G G Sbjct: 152 GGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGY 211 Query: 816 GXXXXE*GFNRNXNG 772 G G N + G Sbjct: 212 GSYSGGGGGNYDYQG 226 Score = 29.5 bits (63), Expect = 4.5 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG RGG G G G GGG G G G G GG G Sbjct: 160 GGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYG 212 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +2 Query: 851 PXPPX-PXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P PP P P PP PP PP P P PPR P Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPP 308 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP PP PP P P PP PP Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 30.7 bits (66), Expect = 2.0 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P S +P P PP P P PPP PP PP P P Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTD------PPTPPPTEPPTPPPTEPPTPPPTDP 1055 Query: 974 LXPPR 988 PR Sbjct: 1056 PTQPR 1060 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P PPP PPP P P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXP 961 P PPP PPP PPP P Sbjct: 864 PRRPPPPPPPPPPPPPPPPPP 884 Score = 28.7 bits (61), Expect = 7.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPP 955 P PPP PPP PPP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 31.1 bits (67), Expect = 1.5 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 5/67 (7%) Frame = +2 Query: 815 PXPXXXXXXPXXPXP--PXPXPXXXXXXXXPXXPPPXXXXXXPPPXP---PPXPXXXPLX 979 P P P P P P P P PPP PPP P PP Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPP 358 Query: 980 PPRXXPP 1000 PP P Sbjct: 359 PPPGRAP 365 Score = 31.1 bits (67), Expect = 1.5 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 3/72 (4%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPP---PXXXXXXPPPXPPPXPX 964 P S P P P PP P PP P PPP P P Sbjct: 322 PPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPP 381 Query: 965 XXPLXPPRXXPP 1000 + PP PP Sbjct: 382 SGKINPPPPPPP 393 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP +P PPPPP Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 376 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP PS PPPPP Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 31.1 bits (67), Expect = 1.5 Identities = 21/83 (25%), Positives = 22/83 (26%), Gaps = 7/83 (8%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX-- 946 P + P P P P PP P P PP PP Sbjct: 360 PKPLMSTPVQRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQT 419 Query: 947 -----PPPXPXXXPLXPPRXXPP 1000 PPP P PP PP Sbjct: 420 TPGYIPPPPPGFPQFQPPPPPPP 442 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 PP P P P PPP P PPP P Sbjct: 50 PPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PPP PP PPP PP PP Sbjct: 51 PPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 31.1 bits (67), Expect = 1.5 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 5/67 (7%) Frame = +2 Query: 815 PXPXXXXXXPXXPXP--PXPXPXXXXXXXXPXXPPPXXXXXXPPPXP---PPXPXXXPLX 979 P P P P P P P P PPP PPP P PP Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPP 270 Query: 980 PPRXXPP 1000 PP P Sbjct: 271 PPPGRAP 277 Score = 31.1 bits (67), Expect = 1.5 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 3/72 (4%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPP---PXXXXXXPPPXPPPXPX 964 P S P P P PP P PP P PPP P P Sbjct: 234 PPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPP 293 Query: 965 XXPLXPPRXXPP 1000 + PP PP Sbjct: 294 SGKINPPPPPPP 305 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP +P PPPPP Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 288 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP PS PPPPP Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G G GGG GG G G G G Sbjct: 123 GGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGG 172 >SB_31262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 31.1 bits (67), Expect = 1.5 Identities = 23/62 (37%), Positives = 31/62 (50%) Frame = +1 Query: 496 SVTPKTKPARKSPGSLPPCWKTTEFTSRSCPPRTNST*SSITRKVLVMTVSSTVXAPLTL 675 S++P + R S GSL P +T+ TSRS PR+ S S R + ST P T+ Sbjct: 179 SISPASPALRSSLGSLAPTSRTSTPTSRS-TPRSRS--RSRARTPSTPSTPSTPSTPSTI 235 Query: 676 QT 681 T Sbjct: 236 TT 237 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.7 bits (66), Expect = 2.0 Identities = 18/72 (25%), Positives = 21/72 (29%) Frame = +2 Query: 785 LLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPX 964 ++ P HP P P P P P P PP PPP P Sbjct: 226 MIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 Query: 965 XXPLXPPRXXPP 1000 + P PP Sbjct: 286 GG-MPPNMEQPP 296 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 30.7 bits (66), Expect = 2.0 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G GG RG GGG GGG GGG G G G GG G G Sbjct: 752 GNRSGGGYRG-----GGGYGGGGGGYRGGGGYGG----GHRGGGGYGGGGHRG 795 Score = 29.5 bits (63), Expect = 4.5 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G GGG GGG GG G G G G G Sbjct: 770 GGYRGGGGYGGGHRGGGGYGGG---GHRGGSYSGYRGSYKSGGYGQGSGG 816 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 30.7 bits (66), Expect = 2.0 Identities = 19/76 (25%), Positives = 22/76 (28%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP 952 P+ + P + P P P PP P P PP PPP P Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPS 342 Query: 953 PXPXXXPLXPPRXXPP 1000 P P PP Sbjct: 343 EDFYSMPSSLPMPSPP 358 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 30.7 bits (66), Expect = 2.0 Identities = 21/77 (27%), Positives = 23/77 (29%) Frame = +2 Query: 767 IVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX 946 I+P+ P H P P P P P PPP PPP Sbjct: 366 IIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASI-------PPPTMIQTLPPPS 418 Query: 947 PPPXPXXXPLXPPRXXP 997 PP P P P P Sbjct: 419 VPPPPIGVPNRPSVLYP 435 Score = 30.3 bits (65), Expect = 2.6 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P P P P P PPP PP P P + PP Sbjct: 353 PPPNLLFSFPPPPIIPIP-PPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPP 408 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 30.3 bits (65), Expect = 2.6 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG G G G GGG GG GGG G G G G G Sbjct: 161 GGDDDDGDGGGSNGSGGGDDGG-DGGDDGGGSGGGGDDGGSDGGGGGNDG 209 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXP 982 P PPP PP PPP P P P Sbjct: 8 PPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 907 PPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PPP PPP PP PP PP Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPPPPDTPAPP 153 Score = 29.5 bits (63), Expect = 4.5 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 866 PXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P PPP PPP P P P P PP Sbjct: 123 PPPPTGTLPPPPVTPPPGPET--PPPPDTPAPPVPPTEAPPTAPP 165 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 P P P P P PPP PPP PPP Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPX--PPPXPXXXPLXPP 985 P PPP PPP PPP P P+ P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P P PP P A PPPPP Sbjct: 212 PVNPPE--PDYLEPTPPPPAAPAPPPPPAAAPPPPP 245 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 30.3 bits (65), Expect = 2.6 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = +2 Query: 812 HPX-PXXXXXXPXXPXPPXPXPXXXXXXXX-PXXPPPXXXXXXPPPXPPPXPXXXP--LX 979 HP P P P P P P P PPP PP P P P Sbjct: 458 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAP 517 Query: 980 PPRXXPP 1000 PR PP Sbjct: 518 HPRVPPP 524 Score = 29.1 bits (62), Expect = 6.0 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = +2 Query: 812 HPX-PXXXXXXPXXPXPPXPXPXXXXXXXX-PXXPPPXXXXXX-PPPXPPPXPXXXPLXP 982 HP P P P P P P P PPP PPP P P P Sbjct: 428 HPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Query: 983 -PRXXPP 1000 PR PP Sbjct: 488 HPRVPPP 494 Score = 29.1 bits (62), Expect = 6.0 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = +2 Query: 812 HPX-PXXXXXXPXXPXPPXPXPXXXXXXXX-PXXPPPXXXXXX-PPPXPPPXPXXXPLXP 982 HP P P P P P P P PPP PPP P P P Sbjct: 448 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAP 507 Query: 983 -PRXXPP 1000 PR PP Sbjct: 508 HPRVPPP 514 Score = 29.1 bits (62), Expect = 6.0 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = +2 Query: 812 HPX-PXXXXXXPXXPXPPXPXPXXXXXXXX-PXXPPPXXXXXX-PPPXPPPXPXXXPLXP 982 HP P P P P P P P PPP PPP P P P Sbjct: 518 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Query: 983 -PRXXPP 1000 PR PP Sbjct: 578 HPRVPPP 584 Score = 29.1 bits (62), Expect = 6.0 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = +2 Query: 812 HPX-PXXXXXXPXXPXPPXPXPXXXXXXXX-PXXPPPXXXXXX-PPPXPPPXPXXXPLXP 982 HP P P P P P P P PPP PPP P P P Sbjct: 528 HPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Query: 983 -PRXXPP 1000 PR PP Sbjct: 588 HPRVPPP 594 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 29.9 bits (64), Expect = 3.4 Identities = 29/87 (33%), Positives = 35/87 (40%), Gaps = 3/87 (3%) Frame = +1 Query: 451 TPSS*STXK-XTTKLHSVTPKT--KPARKSPGSLPPCWKTTEFTSRSCPPRTNST*SSIT 621 TPS+ ST +T + TP T P+ S S P T S C P T ST S+ + Sbjct: 227 TPSTPSTPSTLSTPITPSTPSTPSTPSTPSMPSTPSTPSTPSTPSTPCTPNTPSTPSTPS 286 Query: 622 RKVLVMTVSSTVXAPLTLQTPLVLEPP 702 T ST P T TP P Sbjct: 287 MPSTPST-PSTPSTPSTPSTPSAPSTP 312 Score = 29.9 bits (64), Expect = 3.4 Identities = 29/87 (33%), Positives = 35/87 (40%), Gaps = 3/87 (3%) Frame = +1 Query: 451 TPSS*STXK-XTTKLHSVTPKT--KPARKSPGSLPPCWKTTEFTSRSCPPRTNST*SSIT 621 TPS+ ST +T + TP T P+ S S P T S C P T ST S+ + Sbjct: 777 TPSTPSTPSTLSTPITPSTPSTPSTPSTPSMPSTPSTPSTPSTPSTPCTPNTPSTPSTPS 836 Query: 622 RKVLVMTVSSTVXAPLTLQTPLVLEPP 702 T ST P T TP P Sbjct: 837 MPSTPST-PSTPSTPSTPSTPSAPSTP 862 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 29.9 bits (64), Expect = 3.4 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G GGG GGG G G G G G G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGG-DGDGDGDGDGDGDGDGDGDGDGDDGWG 357 Score = 29.5 bits (63), Expect = 4.5 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G G G G GGG GGG GGG G G G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGG-----GGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGW 356 Query: 816 G 814 G Sbjct: 357 G 357 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGG 910 GG GG G G GG GGG GG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG G G GGG GG GGG G Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 29.9 bits (64), Expect = 3.4 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPP-PXPPPXPXXXPL-XPPRXXPP 1000 P PP P P P PPP PP P PP P+ PP PP Sbjct: 20 PKPPQPTP------PKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPP 65 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP PPP P L P PP Sbjct: 430 PPPT-----PPPTPPPTPPPTTLPPTTQPPP 455 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG GG G G GGG GGG G G Sbjct: 84 GGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 29.1 bits (62), Expect = 6.0 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G G GGG GGG G G GG G G Sbjct: 54 GGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGG 106 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 960 GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 G GGG GG GGG G G G G G Sbjct: 75 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG GG G G GGG GGG G G Sbjct: 99 GGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 29.1 bits (62), Expect = 6.0 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G G GGG GGG G G GG G G Sbjct: 69 GGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGG 121 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 960 GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 G GGG GG GGG G G G G G Sbjct: 90 GDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 935 PPPXPPPXPXXXPLXPPRXXPP 1000 PP PPP P P PP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.1 bits (62), Expect = 6.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 911 PPXXXXXXPPPXPPPXPXXXPLXP 982 PP PPP PPP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PPP P PPP P PP PP Sbjct: 96 PPPATPPPPTMPPTPPPPQTP----APPGPDTPAPP 127 >SB_23967| Best HMM Match : SRCR (HMM E-Value=5.4e-11) Length = 3369 Score = 29.5 bits (63), Expect = 4.5 Identities = 28/81 (34%), Positives = 36/81 (44%) Frame = +1 Query: 442 GTITPSS*STXKXTTKLHSVTPKTKPARKSPGSLPPCWKTTEFTSRSCPPRTNST*SSIT 621 G+ TP + ST T S+TP T + PP TT+FT S P T ST + T Sbjct: 3115 GSTTPFTGSTTPFTG---SITPFTGSVTPNTDETPPTGITTQFTG-STTPFTGST-TPFT 3169 Query: 622 RKVLVMTVSSTVXAPLTLQTP 684 T S+T P T + P Sbjct: 3170 GSTTPFTGSTT--PPPTTRPP 3188 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGG 934 GG RGG RG G GGG GGG Sbjct: 154 GGGGRGGGRG--HGRGGGSGGG 173 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.5 bits (63), Expect = 4.5 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXX-PXXPPPXXXXXXPPPXPPPXPXXXPL 976 P P P P P PPP PPP PPP P P+ Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPP-----PPPPPPPAPGSTPV 395 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 29.1 bits (62), Expect = 6.0 Identities = 20/74 (27%), Positives = 20/74 (27%), Gaps = 6/74 (8%) Frame = +2 Query: 782 FLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX------PPPXXXXXXPPP 943 F KP P P P PP P P P PPP PP Sbjct: 677 FSSKPPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPD 736 Query: 944 XPPPXPXXXPLXPP 985 PP P P Sbjct: 737 ESPPSSKHPPTVSP 750 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 29.1 bits (62), Expect = 6.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXP 961 PPP PPP PPP P Sbjct: 73 PPPLCAPPPPPPPPPPPP 90 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.1 bits (62), Expect = 6.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 938 PPXPPPXPXXXPLXPPRXXPP 1000 PP PP P PL PP PP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPP 49 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 29.1 bits (62), Expect = 6.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXP 961 PPP PPP PPP P Sbjct: 274 PPPLCAPPPPPPPPPPPP 291 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 29.1 bits (62), Expect = 6.0 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G RGG RG G GG GG GG G G G G G Sbjct: 228 GGPRGGGRGGFGGDFGGDGGRFDASNMGGATGGTGNMFGGVG-GTAAGGQTG 278 >SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 532 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGG 907 GG RG RG G G GGG GGG Sbjct: 445 GGNERGQRRGGRGGHGPPRGGGGFSGPRGGG 475 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.1 bits (62), Expect = 6.0 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPP-PXPPPXPXXXPLXPPRXXPP 1000 P PP P P PPP PP P PPP P PP Sbjct: 244 PHPPSVKPSVPIPP--PTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPP 292 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 899 PXXPPPXXXXXX-PPPXPPPXPXXXPLXPPRXXPP 1000 P PPP PP PP P PL P PP Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPP 887 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P PP P PP PPP P P PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPP 824 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXP 973 P P P PPP PPP P P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXP 973 P P P PPP PPP P P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 >SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) Length = 458 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 469 TXKXTTKLHSVTPKTKPARKSPGSLPPCWKTTEFTSRSCPPRT 597 T TK P TK PP K T + R CPP T Sbjct: 40 TIPPLTKTRRCNPLTKGNYYRKRRCPPLTKCTNYRKRRCPPLT 82 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 28.7 bits (61), Expect = 7.9 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = -2 Query: 987 RGGXRGXXXGXGGGXGGGXXXXXXG---GGXXGXXXXXXXXGXGXGGXG 850 +GG R GGG G G G GG G G G GG G Sbjct: 262 KGGDRNQPGNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGG 310 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 972 GXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G G GGG GG GGG G G G G G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDG 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,473,133 Number of Sequences: 59808 Number of extensions: 558919 Number of successful extensions: 6890 Number of sequences better than 10.0: 102 Number of HSP's better than 10.0 without gapping: 1624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3443 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3011777822 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -