BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D21 (1015 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 52 5e-07 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 48 1e-05 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 47 2e-05 At1g61080.1 68414.m06877 proline-rich family protein 46 5e-05 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 45 9e-05 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 44 2e-04 At5g46730.1 68418.m05757 glycine-rich protein 40 0.002 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 40 0.002 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 40 0.002 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 40 0.003 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 40 0.003 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 40 0.003 At4g01985.1 68417.m00265 expressed protein 39 0.005 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 39 0.005 At2g05440.2 68415.m00575 glycine-rich protein 39 0.005 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 39 0.005 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 39 0.006 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 39 0.006 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 38 0.008 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 38 0.008 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 38 0.011 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 38 0.011 At1g26150.1 68414.m03192 protein kinase family protein similar t... 38 0.011 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 38 0.011 At2g30560.1 68415.m03722 glycine-rich protein 38 0.014 At1g75550.1 68414.m08780 glycine-rich protein 38 0.014 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 38 0.014 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 37 0.019 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 37 0.019 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 37 0.019 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 37 0.025 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 37 0.025 At3g50180.1 68416.m05486 hypothetical protein 36 0.032 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 36 0.043 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 36 0.043 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 36 0.043 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 36 0.057 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 36 0.057 At4g18570.1 68417.m02749 proline-rich family protein common fami... 36 0.057 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 36 0.057 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 36 0.057 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 36 0.057 At1g27710.1 68414.m03387 glycine-rich protein 36 0.057 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 35 0.075 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 35 0.075 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 35 0.099 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 35 0.099 At1g04800.1 68414.m00476 glycine-rich protein 35 0.099 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 34 0.13 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 34 0.13 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 34 0.13 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 34 0.13 At1g02710.1 68414.m00222 glycine-rich protein 34 0.13 At5g38560.1 68418.m04662 protein kinase family protein contains ... 34 0.17 At4g30460.1 68417.m04325 glycine-rich protein 34 0.17 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 34 0.17 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 34 0.17 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 34 0.17 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 34 0.17 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 33 0.23 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 33 0.23 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 33 0.23 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 33 0.23 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 33 0.23 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 33 0.30 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 33 0.30 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 33 0.30 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 33 0.30 At2g05440.1 68415.m00574 glycine-rich protein 33 0.30 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 33 0.30 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 33 0.40 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 33 0.40 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 33 0.40 At1g29380.1 68414.m03592 hypothetical protein 33 0.40 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 33 0.40 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 32 0.53 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 32 0.53 At1g15830.1 68414.m01900 expressed protein 32 0.53 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 32 0.70 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 32 0.70 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 32 0.70 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 32 0.70 At1g15840.1 68414.m01901 expressed protein 32 0.70 At1g10620.1 68414.m01204 protein kinase family protein contains ... 32 0.70 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 31 0.92 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 31 0.92 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 31 0.92 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 31 1.2 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 31 1.2 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 31 1.6 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 31 1.6 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 31 1.6 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 31 1.6 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 31 1.6 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 31 1.6 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 31 1.6 At2g05510.1 68415.m00583 glycine-rich protein 31 1.6 At1g53625.1 68414.m06096 expressed protein 31 1.6 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 31 1.6 At1g11850.2 68414.m01364 expressed protein 31 1.6 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 30 2.1 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 30 2.1 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 30 2.1 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 30 2.1 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 30 2.1 At3g24550.1 68416.m03083 protein kinase family protein contains ... 30 2.1 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 30 2.1 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 30 2.1 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 30 2.1 At2g05170.1 68415.m00544 vacuolar protein sorting 11 family prot... 30 2.1 At1g70990.1 68414.m08190 proline-rich family protein 30 2.1 At1g62250.2 68414.m07023 expressed protein 30 2.1 At1g62250.1 68414.m07022 expressed protein 30 2.1 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 30 2.8 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 30 2.8 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 30 2.8 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 30 2.8 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 30 2.8 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 30 2.8 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 30 2.8 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 29 3.7 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 29 3.7 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 29 3.7 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 29 3.7 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 29 3.7 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 29 3.7 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 29 3.7 At4g16240.1 68417.m02464 hypothetical protein 29 3.7 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 29 3.7 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 29 3.7 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 3.7 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 26 4.7 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 26 4.7 At1g62240.1 68414.m07021 expressed protein 29 4.7 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 29 4.9 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 29 4.9 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 29 4.9 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 29 4.9 At2g11005.1 68415.m01177 glycine-rich protein 29 4.9 At1g49270.1 68414.m05524 protein kinase family protein contains ... 29 4.9 At1g04660.1 68414.m00463 glycine-rich protein 29 4.9 At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (AT... 29 6.5 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 29 6.5 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 29 6.5 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 29 6.5 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 29 6.5 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 29 6.5 At4g32285.1 68417.m04593 epsin N-terminal homology (ENTH) domain... 29 6.5 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 29 6.5 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 29 6.5 At3g51290.1 68416.m05614 proline-rich family protein 29 6.5 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 29 6.5 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 29 6.5 At3g18810.1 68416.m02389 protein kinase family protein contains ... 29 6.5 At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid t... 29 6.5 At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid t... 29 6.5 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 29 6.5 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 28 8.6 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 28 8.6 At4g33660.1 68417.m04781 expressed protein 28 8.6 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 28 8.6 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 28 8.6 At4g15150.1 68417.m02326 glycine-rich protein 28 8.6 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 28 8.6 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 28 8.6 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 28 8.6 At2g17870.1 68415.m02070 cold-shock DNA-binding family protein c... 28 8.6 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 28 8.6 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 28 8.6 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 28 8.6 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 28 8.6 At1g51580.1 68414.m05806 KH domain-containing protein 28 8.6 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 28 8.6 At1g26110.1 68414.m03186 expressed protein 28 8.6 At1g23540.1 68414.m02960 protein kinase family protein contains ... 28 8.6 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 52.4 bits (120), Expect = 5e-07 Identities = 28/79 (35%), Positives = 29/79 (36%), Gaps = 3/79 (3%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXX---PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP 943 P+ L P S P P P P PP P P P PPP PPP Sbjct: 397 PVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPP 456 Query: 944 XPPPXPXXXPLXPPRXXPP 1000 PPP P P PP PP Sbjct: 457 PPPPPPVYSPPPPPPPPPP 475 Score = 51.6 bits (118), Expect = 8e-07 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = +2 Query: 797 YSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX---PPPXPXX 967 YS P P P P PP P P P PPP PPP PPP P Sbjct: 436 YSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVY 495 Query: 968 XPLXPPRXXPP 1000 P PP PP Sbjct: 496 SPPPPPPPPPP 506 Score = 49.6 bits (113), Expect = 3e-06 Identities = 26/87 (29%), Positives = 28/87 (32%) Frame = +2 Query: 740 LXXPQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPX 919 L P + P P + P P P PP P P P PPP Sbjct: 402 LPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Query: 920 XXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP P PP PP Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P PPP PPP PPP P PP Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Query: 995 PP 1000 PP Sbjct: 489 PP 490 Score = 48.4 bits (110), Expect = 8e-06 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P PP P P P PPP PPP PPP P PP Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP 513 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P PP P P P PPP PPP PPP P PP Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P PPP PPP PPP P P PP Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYS 519 Query: 995 PP 1000 P Sbjct: 520 SP 521 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 6/68 (8%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPP------PXPPPXPXXXPL 976 P P P P PP P P P PPP PP P PPP P P+ Sbjct: 473 PPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPV 532 Query: 977 XPPRXXPP 1000 R PP Sbjct: 533 YCTRPPPP 540 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P P PPP PP PP P P PP Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSP--PPPSPPPPPPPVYSPPPPPPPPPPPPVYS 511 Query: 995 PP 1000 PP Sbjct: 512 PP 513 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP--XXXPLXPPR 988 P P P PP P P PPP PPP P P P P PP Sbjct: 483 PPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPP 542 Query: 989 XXPP 1000 PP Sbjct: 543 HSPP 546 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP PP SP PPPPP Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP PP PP SP PPPPP Sbjct: 429 PSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 37.5 bits (83), Expect = 0.014 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP PP P PPPPP Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +3 Query: 813 TPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSP--SXXX 986 +P P P P P P PP P PP PP P S Sbjct: 425 SPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484 Query: 987 AXPPPPP 1007 PPPPP Sbjct: 485 PSPPPPP 491 Score = 36.3 bits (80), Expect = 0.032 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX----PPPXPXXXPLXP 982 P P P P PP P P PP P P PPP P P P Sbjct: 489 PPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSP-PP 547 Query: 983 PRXXPP 1000 P+ PP Sbjct: 548 PQFSPP 553 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 5/62 (8%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPXPXXXPLX 979 P P P P PP P P PPP PPP PPP P P Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSP--PPPPTPVSSPPPTPVYSPPPPPPCIEPPP 620 Query: 980 PP 985 PP Sbjct: 621 PP 622 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 3/67 (4%) Frame = +3 Query: 816 PXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPP---XXPPXXXXXSPSXXX 986 P P P P P P PP P PP PP SP Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501 Query: 987 AXPPPPP 1007 PPPPP Sbjct: 502 PPPPPPP 508 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P P PP PPP PP P L PP Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPP--PHSPPPPHSPPPPIYPYLSPPPPP 595 Query: 995 PP 1000 P Sbjct: 596 TP 597 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/71 (25%), Positives = 19/71 (26%) Frame = +3 Query: 795 PIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSP 974 P+ P P P P P P PP P P P P Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Query: 975 SXXXAXPPPPP 1007 PPPPP Sbjct: 494 VYSPPPPPPPP 504 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PP P P PPP PPP PP P PP Sbjct: 587 PYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/49 (30%), Positives = 17/49 (34%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP P P+ + PPPPP Sbjct: 566 PHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P P PPP PP P PP Sbjct: 497 PPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPE 556 Query: 995 P 997 P Sbjct: 557 P 557 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XPXXXPLXPPRXXPP 1000 P PP P PPP PPP P P P P+ P PP Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 33.5 bits (73), Expect = 0.23 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 5/73 (6%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP-----PPX 958 P + P P P P P P P PPP PPP P PP Sbjct: 594 PPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPP 653 Query: 959 PXXXPLXPPRXXP 997 P PP P Sbjct: 654 PPVYYSSPPPPPP 666 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/72 (26%), Positives = 20/72 (27%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXS 971 SP +P P P P P PP P P PP Sbjct: 430 SPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPP 489 Query: 972 PSXXXAXPPPPP 1007 P PPPPP Sbjct: 490 PPPPVYSPPPPP 501 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXP-XXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 P P PP P P P P P PPP P P P PP Sbjct: 523 PPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPP--PPHS 580 Query: 992 XPP 1000 PP Sbjct: 581 PPP 583 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/72 (26%), Positives = 20/72 (27%), Gaps = 1/72 (1%) Frame = +3 Query: 795 PIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPP-XXPPXXXXXS 971 P + P P P P P PP P PP PP Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Query: 972 PSXXXAXPPPPP 1007 P PPPPP Sbjct: 505 PPPPVYSPPPPP 516 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/71 (26%), Positives = 20/71 (28%), Gaps = 7/71 (9%) Frame = +3 Query: 816 PXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXP-------PXXXXXSP 974 P P P P P P PP P PP P P +P Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Query: 975 SXXXAXPPPPP 1007 PPPPP Sbjct: 532 VYCTRPPPPPP 542 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P P PPP PPP P PP Sbjct: 512 PPPPPVYSSPPPPPSPAPTPVYCTR---PPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHS 568 Query: 995 PP 1000 P Sbjct: 569 SP 570 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP PP P PPPP Sbjct: 594 PPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPP 632 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/72 (27%), Positives = 20/72 (27%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXS 971 SP TP P P P P PP PP PP Sbjct: 393 SPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPP 452 Query: 972 PSXXXAXPPPPP 1007 P PPPPP Sbjct: 453 PP-----PPPPP 459 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 5/62 (8%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPXPXXXPLX 979 P P P P P P P PPP PPP PPP P Sbjct: 582 PPPIYPYLSPPPPPTPVSSP-PPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSS 640 Query: 980 PP 985 PP Sbjct: 641 PP 642 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 4/53 (7%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXX----AXPPPPP 1007 P P P PP P PP PP P + PPPPP Sbjct: 593 PPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX--PPPXPXXXPLXPPRXXPP 1000 P PP P P PPP PP PPP P+ P PP Sbjct: 394 PRPPVVTPLPPPSLPSP--PPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP 443 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/70 (28%), Positives = 20/70 (28%), Gaps = 8/70 (11%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPX---PXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPXPXXX 970 P P P PP P P PPP PPP PPP P Sbjct: 630 PPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHY 689 Query: 971 PLXPPRXXPP 1000 PP P Sbjct: 690 SSPPPPPSAP 699 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/71 (25%), Positives = 20/71 (28%) Frame = +3 Query: 795 PIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSP 974 P+ P P P P P PP PP PP P Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP-------PPPPPPPVYSPPP 514 Query: 975 SXXXAXPPPPP 1007 + PPPPP Sbjct: 515 PPVYSSPPPPP 525 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 895 PXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 P PPP P PP P PP PP Sbjct: 587 PYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P P PPP PP PPP P PP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVY 444 Query: 995 PP 1000 PP Sbjct: 445 PP 446 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P PP P P P PPP PPP P P P P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/72 (30%), Positives = 22/72 (30%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXS 971 SP P P P P P P PP P PP PP Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPP 437 Query: 972 PSXXXAXPPPPP 1007 PS PPPPP Sbjct: 438 PSPPYVYPPPPP 449 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX--PPPXXXXXXPPPXPPPXPXXXPLXPPR 988 P P P PP P P P PPP PPP P P P P P Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCN 462 Query: 989 XXP 997 P Sbjct: 463 DLP 465 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP PP P P PPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 33.1 bits (72), Expect = 0.30 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 7/68 (10%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX-------PPPXXXXXXPPPXPPPXPXXXP 973 P P P P PP P P P PPP PPP PP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPP 447 Query: 974 LXPPRXXP 997 PP P Sbjct: 448 --PPSPQP 453 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPP--PXXPPXXXXXPPXXXXXXPP 999 PP PPP P PP P PP PP PP Sbjct: 400 PPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPP 437 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 891 PXXPXXPPXXXP---XXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP PP P PPPPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/68 (35%), Positives = 25/68 (36%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P S P P P P PP P P P PPP PPP PP P P Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPP----PSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Query: 974 LXPPRXXP 997 PP+ P Sbjct: 103 PAPPKPQP 110 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +2 Query: 842 PXXPXP---PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P P PPP PPP PPP P L PP PP Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PPP P PPP PP PP PP Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +2 Query: 860 PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P PPP PPP PP P PP PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 35.5 bits (78), Expect = 0.057 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPPXXL 1008 PP PPP P PPP PP P PP L Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQL 100 Score = 35.1 bits (77), Expect = 0.075 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P P P P P P P PPP PP P P P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSP 112 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP PP PS PPP P Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSP 85 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXP--PPPP 1007 P P P PP P PP PP SP P PPPP Sbjct: 48 PSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 31.9 bits (69), Expect = 0.70 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P P P PP P PP PP P PP P Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/64 (26%), Positives = 19/64 (29%) Frame = +3 Query: 813 TPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAX 992 +P P P P P P PP P PP PP P+ Sbjct: 51 SPEPEPEPADCPPPPPPPPCPPPPSPPPCP-PPPSPPPSPPPPQLPPPPQLPPPAPPKPQ 109 Query: 993 PPPP 1004 P PP Sbjct: 110 PSPP 113 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPP--PP 1007 P P PP P PP PP SP PPP PP Sbjct: 65 PPPPPCPPPPSP---PPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP PP P PP P Sbjct: 73 PPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 45.6 bits (103), Expect = 5e-05 Identities = 25/84 (29%), Positives = 28/84 (33%) Frame = +2 Query: 749 PQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXX 928 P + P LK ++ P P PP P P P PPP Sbjct: 474 PPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAA 533 Query: 929 XXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP P PP PP Sbjct: 534 VAPPP-PPPPPGTAAAPPPPPPPP 556 Score = 44.8 bits (101), Expect = 9e-05 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = +2 Query: 791 KPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXX 970 KP P P PP P P P PPP PPP PPP P Sbjct: 501 KPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP-PPPPPGTQ 559 Query: 971 PLXPPRXXPP 1000 PP PP Sbjct: 560 AAPPPPPPPP 569 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/84 (28%), Positives = 26/84 (30%) Frame = +2 Query: 749 PQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXX 928 P A + P P + P P P PP P P P P Sbjct: 528 PPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGS 587 Query: 929 XXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP P PP PP Sbjct: 588 GGPPPPPPPMPLANGATPPPPPPP 611 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P PP P P P PPP PPP PPP P PP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 37.9 bits (84), Expect = 0.011 Identities = 26/94 (27%), Positives = 28/94 (29%), Gaps = 7/94 (7%) Frame = +2 Query: 740 LXXPQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXP----XXXXXXXXPXX 907 L P I + + P P P P PP P P P Sbjct: 437 LPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPT 496 Query: 908 PP---PXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP P PPP PPP P PP PP Sbjct: 497 PPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPP 530 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP PP PP P A PPPPP Sbjct: 498 PAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPP-----PRAAVAPPPPPP 541 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP P A PPPPP Sbjct: 475 PPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPP 513 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +3 Query: 816 PXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXP 995 P P P P P P PP PP PP P P Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPP-----P 565 Query: 996 PPPP 1007 PPPP Sbjct: 566 PPPP 569 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 8/61 (13%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPP--------XXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P P PP P P PP PPP PPP P PL P Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPP 476 Query: 998 P 1000 P Sbjct: 477 P 477 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 891 PXXPXXPPXXXPXXX--PPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP PP P A PPP P Sbjct: 457 PPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTP 497 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/64 (25%), Positives = 18/64 (28%) Frame = +3 Query: 816 PXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXP 995 P P P P P PP P PP + + A P Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGP 621 Query: 996 PPPP 1007 PPPP Sbjct: 622 PPPP 625 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP P P P PPP PPP P + PP Sbjct: 591 PPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPP 638 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 891 PXXPXXPPXXX---PXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP PP PP P A PPPPP Sbjct: 438 PSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPP 479 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 10/63 (15%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPP-------XXXXXXPPPXPPPXPXXXPL---XPPRX 991 P PP P P PPP PPP PP P PL PP Sbjct: 436 PLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPP 495 Query: 992 XPP 1000 PP Sbjct: 496 TPP 498 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 4/65 (6%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXX----PPPXPPPXPXXXPLXP 982 P P P PP P P P PPP PPP PP P Sbjct: 563 PPPPPPPMQNRAPSPP-PMPMGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGP 621 Query: 983 PRXXP 997 P P Sbjct: 622 PPPPP 626 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P P PPP PPP P Sbjct: 579 PMPMGNSGSGGPPPPPPPMPLANGATP-PPPPPPMAMANGAAGPPPPPPRMGMANGAAGP 637 Query: 995 PP 1000 PP Sbjct: 638 PP 639 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P P PP P P PPP PPP P Sbjct: 593 PPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPP 641 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 44.8 bits (101), Expect = 9e-05 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P PPP P P PP P PL PP PP Sbjct: 1071 PLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPP 1123 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-XPPPXPXXXPLXPPRXXPP 1000 P P PP P P P P PPP PPP P P PP PP Sbjct: 1074 PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXP 982 P P PP P P PPP PP PPP P P P Sbjct: 1082 PSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 35.9 bits (79), Expect = 0.043 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXX--PLXPPRXXPP 1000 PP P P PPP P PPP P PL PP PP Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPP 1111 Score = 35.1 bits (77), Expect = 0.075 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P P PP P P PPP P P PPP P Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 31.5 bits (68), Expect = 0.92 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P PP P SP PPPPP Sbjct: 1080 PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P PP PP PS + PPPPP Sbjct: 1056 PLPEDSPPLPQESPPPLPPL-PPSPPPPSPPLPPS---SLPPPPP 1096 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP P PPPPP Sbjct: 1077 PSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = +2 Query: 797 YSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPL 976 YS P P P PP P P P PPP PPP PPP PL Sbjct: 10 YSLVPLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPP-----PL 64 Query: 977 XPPRXXPP 1000 P PP Sbjct: 65 PRPCSRPP 72 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GGG GGG GGG G G GG G G Sbjct: 225 GGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHG 284 Query: 819 XG 814 G Sbjct: 285 GG 286 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GG GG GGG G G GG G G G Sbjct: 185 GGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244 Query: 819 XG 814 G Sbjct: 245 GG 246 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G G GG GGG GG G G G GG G G G Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHG 270 Query: 819 XG 814 G Sbjct: 271 GG 272 Score = 37.5 bits (83), Expect = 0.014 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G G GGG GGG GG G G G GG G G G Sbjct: 153 GGAGASGYGGGAYGGGGGHGGG-GGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGG 211 Query: 819 XG 814 G Sbjct: 212 GG 213 Score = 36.3 bits (80), Expect = 0.032 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 1/70 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXG-GXGXXGXXXXXX 823 GG GG G G GGG GGG GG G G G G G G G Sbjct: 195 GGAGGGGSHGGAGGYGGGGGGG---SGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGY 251 Query: 822 GXGXXXXE*G 793 G G E G Sbjct: 252 GGGGGGGEGG 261 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G GG GG GGG G G G GG G G G Sbjct: 167 GGGGHGGG-GGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGG 225 Query: 819 XG 814 G Sbjct: 226 GG 227 Score = 35.1 bits (77), Expect = 0.075 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GGG GGG GG G G G G G G Sbjct: 176 GGGSAGGAHGGS-GYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYG 234 Query: 819 XG 814 G Sbjct: 235 SG 236 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GGG GG G G G G GG G G G Sbjct: 108 GGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEG-GGAGASGYGGGAYG 166 Query: 819 XG 814 G Sbjct: 167 GG 168 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 GG G G G GGG GGG G G G G G G G Sbjct: 138 GGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEG 194 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG G G G GG GG GGG G G G GG G Sbjct: 42 GGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGG 91 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G G G G GGG GG G G G G G Sbjct: 70 GGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGG 129 Query: 816 G 814 G Sbjct: 130 G 130 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G G GGG GGG G G GG G G G Sbjct: 63 GGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEG-GGGGYGGAAGGHAG 121 Query: 819 XG 814 G Sbjct: 122 GG 123 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G GG GGG GGG G G G G G Sbjct: 103 GAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGG 162 Query: 816 G 814 G Sbjct: 163 G 163 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 972 GXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G G GG GGG GG G G G G G G Sbjct: 31 GQASGGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYG 74 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P PP P P P PPP P P PPP P PR PP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLP-PPPPPAMRRRVLPRPPPP 73 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P P PPP PP PPP L P PP Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPP 75 Score = 35.9 bits (79), Expect = 0.043 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPP---XXXXXXPPPXPPPXP 961 P P P PP P P P PPP PPP PPP P Sbjct: 27 PPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP PP PP +P PPPPP Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAP----LPPPPPP 60 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX--PPPXPXXXPLXPPRXX 994 P P P P P P PPP PPP PPP P P PP Sbjct: 61 PKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVK 120 Query: 995 PP 1000 PP Sbjct: 121 PP 122 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P P PP PPP P P PP Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPY 172 Query: 995 PP 1000 PP Sbjct: 173 PP 174 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/78 (29%), Positives = 25/78 (32%), Gaps = 2/78 (2%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX-- 946 P + KP + P P P PP P PPP PPP Sbjct: 77 PPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPY 136 Query: 947 PPPXPXXXPLXPPRXXPP 1000 PP P P PP PP Sbjct: 137 TPPPPTVKPPPPPVVTPP 154 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPX-PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 P P P P PP P PPP PPP P P P PP Sbjct: 36 PHPVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYV 95 Query: 992 XPP 1000 PP Sbjct: 96 KPP 98 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP--XPPPXPXXXPLXPPR 988 P P P PP P P PPP PPP PPP P P PP Sbjct: 99 PPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTP-PPPT 157 Query: 989 XXP 997 P Sbjct: 158 PTP 160 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/80 (27%), Positives = 25/80 (31%), Gaps = 2/80 (2%) Frame = +2 Query: 749 PQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX--PPPXX 922 P + P ++ P P P P P P P P P PPP Sbjct: 99 PPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Query: 923 XXXXPPPXPPPXPXXXPLXP 982 P P PPP P P P Sbjct: 159 TPEAPCPPPPPTPYPPPPKP 178 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-XPPPXPXXXPLXPPRX 991 P P P PP P P PPP PPP PP P P P Sbjct: 107 PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPP 166 Query: 992 XPP 1000 PP Sbjct: 167 PPP 169 Score = 35.9 bits (79), Expect = 0.043 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPP---PXPPPXPXXXPLXPP 985 P P P PP P PPP PP P PPP P P P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Query: 986 RXXPP 1000 PP Sbjct: 136 YTPPP 140 Score = 35.5 bits (78), Expect = 0.057 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP----PPXPXXXPLXPPRXXPP 1000 P P P P P P PP PPP P PP P P PP P Sbjct: 74 PCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP 130 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 4/66 (6%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX----PPPXPXXXPLXP 982 P P P PP P P P PPP PPP P P P Sbjct: 49 PKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPP 108 Query: 983 PRXXPP 1000 P PP Sbjct: 109 PYVKPP 114 Score = 32.3 bits (70), Expect = 0.53 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 4/69 (5%) Frame = +3 Query: 813 TPXPXXXXXXXXXXXXPXXXPXXXXXPXX---PXXPPXXXPXXXP-PXXPPXXXXXSPSX 980 TP P P P P P PP P P P PP +P Sbjct: 81 TPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPP 140 Query: 981 XXAXPPPPP 1007 PPPPP Sbjct: 141 PTVKPPPPP 149 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP P P PPPPP Sbjct: 57 PTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPP 101 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PPP PPP P PP PP Sbjct: 140 PPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPP 175 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP P PPPPP Sbjct: 71 PYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 7/61 (11%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPX----PXXXXXXXXPXXPPPXXXXXXPPPXP---PPXPXXXP 973 P P P P P P P P P P PPP P PP P P Sbjct: 123 PPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 Query: 974 L 976 + Sbjct: 183 I 183 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP P PP P P PPPP Sbjct: 32 PKPSPHPVKPPKHPAKPPKP-PTVKPPTHTPKPPTVKPPPPYIPCPPPP 79 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/67 (34%), Positives = 25/67 (37%), Gaps = 4/67 (5%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP----PPXPPPXPXXXPLX 979 +P P P P PP P P PPP P PP PP P PL Sbjct: 41 NPGPPPPQPDPQPPTPPTFQPAPPANDQPP--PPPQSTSPPPVATTPPALPPKPLPPPLS 98 Query: 980 PPRXXPP 1000 PP+ PP Sbjct: 99 PPQTTPP 105 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/82 (26%), Positives = 29/82 (35%), Gaps = 4/82 (4%) Frame = +2 Query: 767 IVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP- 943 I+PL +++ + + P P PP P P P P PPP Sbjct: 14 IIPLLTIVRADNHSVYCPPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPP 73 Query: 944 ---XPPPXPXXXPLXPPRXXPP 1000 PPP P PP+ PP Sbjct: 74 QSTSPPPVATTPPALPPKPLPP 95 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPP-----PXPPPXPXXXPLXPPRXXPP 1000 P PP P P PPP PP P PP P PL PP+ PP Sbjct: 105 PPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPP 159 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P P P P P P P P P P P PPP P P Sbjct: 54 PTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLP-PPLSPPQTTPPPPPAITP 112 Query: 974 LXPPRXXPP 1000 PP PP Sbjct: 113 PPPPAITPP 121 Score = 35.1 bits (77), Expect = 0.075 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P S P P P PP P P PP PP PPP P P Sbjct: 73 PQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPP-PAITP 131 Query: 974 LXPPRXXPP 1000 P PP Sbjct: 132 PPPLATTPP 140 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 3/60 (5%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX---PPPXPXXXPLXPP 985 P P P P PP P P PP PP PPP PL PP Sbjct: 112 PPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP P P+ PPPP Sbjct: 89 PPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPP 127 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/63 (25%), Positives = 16/63 (25%) Frame = +3 Query: 816 PXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXP 995 P P P P P PP P PP P P P Sbjct: 54 PTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPP 113 Query: 996 PPP 1004 PPP Sbjct: 114 PPP 116 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/69 (24%), Positives = 18/69 (26%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P + P P P PP P P P PP PP Sbjct: 64 PANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLS 123 Query: 974 LXPPRXXPP 1000 PP PP Sbjct: 124 PPPPAITPP 132 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P P PP PP P PP P Sbjct: 95 PPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALP 143 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P PPP PPP PPP P + P PP Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPP-----RPPPPPPPPPSSRSIPSPSAPPP 620 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P P PPP PPP + PP PP Sbjct: 543 PSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPP 595 Score = 35.9 bits (79), Expect = 0.043 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP-----PXPXXXPLXPPRXXPP 1000 P PP P P P PP PPP PP P P P PP PP Sbjct: 574 PPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPP--PPPPPPP 626 Score = 35.9 bits (79), Expect = 0.043 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P P P P PPP P P PPP P+ PP Sbjct: 686 PPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPL-SKTPVPPP 741 Score = 35.1 bits (77), Expect = 0.075 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP 952 PL L +P + P P P PP P PPP P PP Sbjct: 560 PLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPP 619 Query: 953 PXPXXXP 973 P P P Sbjct: 620 PPPPPPP 626 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 5/53 (9%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXP-----PPXXXXXXPPPXPPPXPXXXPLXPP 985 P P PP P P P P PP PP PPP P PP Sbjct: 677 PSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPP 729 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 909 PPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 PP P PP P SPS PPPPP Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPP----XXXXXXPPPXPPPXPXXXPLXPP 985 P PP P P PPP PPP PPP P PP Sbjct: 682 PPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPP 730 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP PP PS PPPPP Sbjct: 579 PPPLPSRSIPPPLAQPPPPRPP---PPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 32.3 bits (70), Expect = 0.53 Identities = 23/86 (26%), Positives = 26/86 (30%) Frame = +3 Query: 750 HNXXHESFHXDSY*SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPX 929 H+ HE DS +P+ L P P P P P P Sbjct: 449 HHHHHEIPAKDSVDNPLNLPSDP-PSSGDHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPP 507 Query: 930 XXPPXXPPXXXXXSPSXXXAXPPPPP 1007 PP SPS PPPPP Sbjct: 508 PPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 31.5 bits (68), Expect = 0.92 Identities = 18/60 (30%), Positives = 18/60 (30%), Gaps = 3/60 (5%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP---XPPPXPXXXPLXPP 985 P P P P P PPP PPP PPP P P PP Sbjct: 548 PPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP---LXPPRXXPP 1000 P P PP P P P PPP PPP P P PP PP Sbjct: 615 PSAPPPPPPPPPSFGSTGNKRQAQP------PPPPPPPPPTRIPAAKCAPPPPPPP 664 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 5/49 (10%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPP-----XXXXXXPPPXPPPXPXXXP 973 P P PP P P PPP PP PPP P P Sbjct: 640 PPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPP 688 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P P PP S S PPPP Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPP 621 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 936 PPXXPPXXXXXSPSXXXAXPPPPP 1007 PP PP P+ A PPPPP Sbjct: 640 PPPPPPPPPTRIPAAKCAPPPPPP 663 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXP--XXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPR 988 P P P PP P P P PP PPP PPP P Sbjct: 646 PPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPP------PPPPPPPKANISNAPKPP 699 Query: 989 XXPP 1000 PP Sbjct: 700 APPP 703 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P P PP PPP P P P P P PP Sbjct: 43 PPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPP 102 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXP---PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P P P P P P PP P P PPP P P P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAP 93 Query: 986 RXXP 997 + P Sbjct: 94 KPVP 97 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PP PP PPP P P P Sbjct: 73 PKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPK 132 Query: 995 P 997 P Sbjct: 133 P 133 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/71 (29%), Positives = 24/71 (33%), Gaps = 1/71 (1%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPX-PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPX 964 + P + P P P PP P P PPP P P PPP P Sbjct: 1 MNPPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPS-PCPSPPPKPQ 59 Query: 965 XXPLXPPRXXP 997 P+ PP P Sbjct: 60 PKPVPPPACPP 70 Score = 36.3 bits (80), Expect = 0.032 Identities = 20/68 (29%), Positives = 21/68 (30%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P + P P P PP P PPP PPP P P P P Sbjct: 43 PPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPK-PAPPPAPKPVPCPSP 101 Query: 974 LXPPRXXP 997 PP P Sbjct: 102 PKPPAPTP 109 Score = 36.3 bits (80), Expect = 0.032 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXP-XXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 P P P PP P P P PP P P PP P P+ PP Sbjct: 58 PQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPV-PPHG 116 Query: 992 XPP 1000 PP Sbjct: 117 PPP 119 Score = 35.9 bits (79), Expect = 0.043 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXP-PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 P P P P P P P P P P P P PP P P PP Sbjct: 26 PGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP 85 Query: 992 XP 997 P Sbjct: 86 KP 87 Score = 35.9 bits (79), Expect = 0.043 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXX-PPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P P P P PPP P P P P P PP Sbjct: 85 PKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 34.7 bits (76), Expect = 0.099 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P P P PP P P P P P+ PP Sbjct: 38 PQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXP-PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 P P P P P P P P P P P P P P P P PP+ Sbjct: 46 PSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCP-SPPKP 104 Query: 992 XPP 1000 P Sbjct: 105 PAP 107 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPP-PXPPPXPXXXPLXPPRXXPP 1000 P P P P PPP PP P P P P P P+ PP Sbjct: 12 PVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPP 65 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P PP PPP P P P P P PP Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPP 55 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PP P P P P P P P Sbjct: 85 PKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKT 144 Query: 995 PP 1000 P Sbjct: 145 IP 146 Score = 31.9 bits (69), Expect = 0.70 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP-XPXXXPLXPPRXXP 997 P P P P P P PPP P P PPP P P P+ P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPP---KPQPKPVPPPACPPTPPKPQPKPAP 81 Query: 998 P 1000 P Sbjct: 82 P 82 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +2 Query: 842 PXXPXP-PXPXPXXXXXXXXPXXPPPXXXXXXP-PPXPPPXPXXXPLXPPRXXP 997 P P P P P P P P P P PP P P P PP+ P Sbjct: 70 PTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/49 (28%), Positives = 15/49 (30%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP P PP P +P PP P Sbjct: 56 PKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKP 104 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXP---P 985 P P P P P P P P PP P P PP P P+ P P Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPPPEPK-PAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPP 118 Query: 986 RXXPP 1000 P Sbjct: 119 PKPAP 123 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXP-PXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P P P PP P +PS A PP P Sbjct: 91 PAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P PP P PP P +PS PPP Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPP 56 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P PP P A PP PP Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPP 73 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXX-GGGXXGXXXXXXXXGXGXGGXGXXGXXXXXX 823 GG GG G G GGG GG GGG G G G GG G G Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGA 171 Query: 822 GXG 814 G G Sbjct: 172 GGG 174 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG RGG G G GGG GGG GG G G G G G G G Sbjct: 159 GGKGRGGKSGG--GAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGG 216 Query: 819 XG 814 G Sbjct: 217 GG 218 Score = 37.9 bits (84), Expect = 0.011 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GGG GGG GG G G G G G G G Sbjct: 122 GGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRG-GKSGGGAGGGVGGGVG 180 Query: 819 XG 814 G Sbjct: 181 AG 182 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GGG GGG GGG G G G G G G Sbjct: 482 GGVGVGGGGGIGGGAGGGVGGGVGGGV-GGGVRGAVGGAVGGGVGGAGRGSGG 533 Score = 36.3 bits (80), Expect = 0.032 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXG--GGXXGXXXXXXXXGXGXGGXGXXGXXXXX 826 GG G G G GGG GGG G GG G G G G G G Sbjct: 410 GGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 469 Query: 825 XGXG 814 G G Sbjct: 470 AGGG 473 Score = 35.9 bits (79), Expect = 0.043 Identities = 24/83 (28%), Positives = 25/83 (30%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G G GGG GG GG G G G GG G Sbjct: 127 GGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAG 186 Query: 816 GXXXXE*GFNRNXNGTIRAXXCG 748 G G GT+ A G Sbjct: 187 GSVGAGGGIGSGGGGTVGAGGRG 209 Score = 35.1 bits (77), Expect = 0.075 Identities = 22/62 (35%), Positives = 23/62 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG +G R G GGG GGG GGG G G G GG G G Sbjct: 102 GGGGKGRGRKGGGGAGGGVGGG---VGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGG 158 Query: 819 XG 814 G Sbjct: 159 GG 160 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G G GGG GGG G G G GG G G G Sbjct: 490 GGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVG 549 Query: 819 XG 814 G Sbjct: 550 GG 551 Score = 34.7 bits (76), Expect = 0.099 Identities = 25/83 (30%), Positives = 28/83 (33%), Gaps = 3/83 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXG--GGXXGXXXXXXXXG-XGXGGXGXXGXXXX 829 GG G G G GGG GGG G GG G G G GG G G Sbjct: 256 GGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGR 315 Query: 828 XXGXGXXXXE*GFNRNXNGTIRA 760 G G + G++ A Sbjct: 316 GSGGASGGASGGASGGAGGSVGA 338 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G G GGG GG GG G G G GG G G G Sbjct: 71 GGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGG-GVGGGVGAGGG 129 Query: 819 XG 814 G Sbjct: 130 AG 131 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GGG G G GG G GG G G Sbjct: 177 GGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGG 229 Score = 33.9 bits (74), Expect = 0.17 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GGG G G GG G G GG G G G Sbjct: 54 GGGASGGI-GVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKG 112 Query: 819 XG 814 G Sbjct: 113 GG 114 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG RG G GG GG GG G G G G G G Sbjct: 375 GGSVGGGGRGSG-GASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVG 433 Query: 819 XG 814 G Sbjct: 434 GG 435 Score = 32.7 bits (71), Expect = 0.40 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 6/68 (8%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXG-----GGXXXXXXGGGXXGXXXXXXXXGXGXG-GXGXXGX 838 GG GG RG G GGG G GG GGG G G G G G G G Sbjct: 457 GGSVGGGGRGSG-GAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGA 515 Query: 837 XXXXXGXG 814 G G Sbjct: 516 VGGAVGGG 523 Score = 32.3 bits (70), Expect = 0.53 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXG-GGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXX 823 GG GG G G G G G GG GGG G GG G G Sbjct: 65 GGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGV 124 Query: 822 GXG 814 G G Sbjct: 125 GAG 127 Score = 32.3 bits (70), Expect = 0.53 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G G GG GG GGG G G G G G G Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGG 457 Query: 816 G 814 G Sbjct: 458 G 458 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G G GGG GG G G G G GG G G Sbjct: 441 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIG 493 Score = 32.3 bits (70), Expect = 0.53 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXG-GXGXXG 841 GG GG G G GG GG GGG G G G G G G Sbjct: 517 GGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAG 570 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXG---GGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G G GG GGG GG G G GG G Sbjct: 449 GGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVG 501 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG RG GG GG GGG G G G G G G Sbjct: 311 GGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVG 363 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXG--GGXXGXXXXXXXXGXGXGGXGXXGXXXXX 826 GG GG G G GGG GG G GG G G G G G G Sbjct: 425 GGGVGGGVGG---GVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAG 481 Query: 825 XGXG 814 G G Sbjct: 482 GGVG 485 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G G G G GGG GGG GGG G G GG G G Sbjct: 333 GGSVGAGGGVGGGVGGGVGGG-----VGGGVGGAVGGAVGGAVGGGGGGSVG 379 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = -2 Query: 981 GXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXGXXXX 802 G G G GGG GG GGG G G G G G G Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGG 104 Query: 801 E*GFNRNXNG 772 G R G Sbjct: 105 GKGRGRKGGG 114 Score = 30.3 bits (65), Expect = 2.1 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXG-GGXGGG--XXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXX 829 GG GG G G GG GGG GGG G G G GG G Sbjct: 137 GGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 196 Query: 828 XXGXG 814 G G Sbjct: 197 SGGGG 201 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G G GGG GG GG G G G GG G G Sbjct: 168 GGGAGGGVGGGVGAGGGAGGS--VGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGR 225 Query: 816 G 814 G Sbjct: 226 G 226 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/77 (25%), Positives = 23/77 (29%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G G GG G G GGG G G GG G Sbjct: 172 GGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGAS 231 Query: 816 GXXXXE*GFNRNXNGTI 766 G G + G++ Sbjct: 232 GGVGVGGGAGGSGGGSV 248 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G RG GGG G GG G G G G G G Sbjct: 200 GGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGG 252 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 G GG G G G GG GGG G G G GG Sbjct: 86 GGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGG 132 Score = 29.9 bits (64), Expect = 2.8 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GGG GG GGG G G G G G G G Sbjct: 223 GGRGSGGASG-GVGVGGG-AGGSGGGSVGGGGRGSGGVGASGGAG-GNVGAGGGLGGGVG 279 Query: 819 XG 814 G Sbjct: 280 GG 281 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG RG GG GG G G G G G G G Sbjct: 307 GGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVG 359 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXG--GGXXGXXXXXXXXGXGXGGXGXXG 841 G G G G GGG GGG G GG G G GG G G Sbjct: 475 GGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAG 528 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G GG GG GG G G G GG G G Sbjct: 196 GSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGS 255 Query: 816 G 814 G Sbjct: 256 G 256 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 998 GGXXXXXXGGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG G GG GGG G GGG GG Sbjct: 284 GGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 319 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGX-GGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXX 823 GG GG G G GG GGG GGG G GG Sbjct: 351 GGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASG 410 Query: 822 GXG 814 G G Sbjct: 411 GVG 413 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 998 GGXXXXXXGGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG G GG GGG G GGG GG Sbjct: 352 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 387 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG RG G G GG GG GG G G G G G G Sbjct: 379 GGGGRGSG-GASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVG 437 Query: 819 XG 814 G Sbjct: 438 GG 439 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXG-GGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GG GGG GG G G G G G Sbjct: 82 GGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVG 135 Score = 29.1 bits (62), Expect = 4.9 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXG-GGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXX 823 GG GG G G GG GG GG G G G GG G G Sbjct: 211 GGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGG--GSVGGGGRGSGGVGASGGAGGNV 268 Query: 822 GXG 814 G G Sbjct: 269 GAG 271 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXG---GGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXX 829 G GG G G GGG G GG GGG G G G G Sbjct: 466 GSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVG 525 Query: 828 XXGXG 814 G G Sbjct: 526 GAGRG 530 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -2 Query: 999 GGXXRG-GXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG RG G G GGG GGG G G G GG G Sbjct: 525 GGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGGVG 575 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G G GG G G GG G G G G G Sbjct: 86 GGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGG 138 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXG---GGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G G G G GG GGG G G G G G Sbjct: 90 GGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAG 145 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXG-GXGXXGXXXXXX 823 GG GG G G G GG GG G G G G G G G Sbjct: 497 GGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGV 556 Query: 822 GXG 814 G G Sbjct: 557 GVG 559 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G RG GG GG GGG G G G G Sbjct: 521 GGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 GG G G G GGG GG G G G G GG Sbjct: 340 GGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGG 387 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G G GG GG GG G G GG G G G Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGG--ASGGASGGASGGVGGAGGAGGSVGA 424 Query: 816 G 814 G Sbjct: 425 G 425 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P PPP P P PP P PP PP Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPP 184 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP---PPXPPPXPXXXPLXPPRXXP 997 P P PP P P PPP P PP PP P P P P Sbjct: 96 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 150 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP---PPXPPPXPXXXPLXPPRXXP 997 P P PP P P PPP P PP PP P P P P Sbjct: 114 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 168 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP-PPXPPPXPXXXPLXPPRXXP 997 P P PP P P P P P PP PP P P P P Sbjct: 80 PVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 132 Score = 31.9 bits (69), Expect = 0.70 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 2/49 (4%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XPXXXPLXPPRXXP 997 PP P P P P P PPP P P P+ PP P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 31.9 bits (69), Expect = 0.70 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P P P PP P P P PP PP Sbjct: 85 PPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPP 137 Score = 31.9 bits (69), Expect = 0.70 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 3/64 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX---PPPXPXXXPLXPP 985 P P P P P P P P P P PPP PPP P PP Sbjct: 138 PTPTPSVPSPTPPVSPPP-PTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPP 196 Query: 986 RXXP 997 P Sbjct: 197 DVTP 200 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PP P P PP P P Sbjct: 135 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPS 194 Query: 995 PP 1000 PP Sbjct: 195 PP 196 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PP PP P P P PP Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP-----VSPPPPTPTPSVPSPTPPVSP 153 Query: 995 PP 1000 PP Sbjct: 154 PP 155 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/66 (27%), Positives = 18/66 (27%), Gaps = 1/66 (1%) Frame = +3 Query: 813 TPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXX-PPXXPPXXXXXSPSXXXA 989 TP P P P P PP P P PP PS Sbjct: 121 TPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPP 180 Query: 990 XPPPPP 1007 PPPP Sbjct: 181 VSPPPP 186 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/49 (30%), Positives = 17/49 (34%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P P PP P SP+ + PPP P Sbjct: 75 PAPVPPVSPPPPTPSVPSPTPP-VSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/50 (30%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXP-PXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P P PP P SP+ + PPP P Sbjct: 91 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/50 (30%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXP-PXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P P PP P SP+ + PPP P Sbjct: 109 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 158 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P P P P PP P P PP Sbjct: 156 PTPTPSVPSPTPPVPTDPMP-SPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVT 214 Query: 995 P 997 P Sbjct: 215 P 215 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/64 (26%), Positives = 18/64 (28%), Gaps = 4/64 (6%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPP----PXXXXXXPPPXPPPXPXXXPLXPPR 988 P P P PP P P PP P P P P P + P Sbjct: 173 PMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTP 232 Query: 989 XXPP 1000 PP Sbjct: 233 PTPP 236 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G GG GGG GGG G G G GG G Sbjct: 85 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGG 134 Score = 37.9 bits (84), Expect = 0.011 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 2/69 (2%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXG--XGXGGXGXXGXXXXX 826 GG GG G G GG GGG GGG G G G GG G G Sbjct: 78 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHH 137 Query: 825 XGXGXXXXE 799 G G E Sbjct: 138 GGGGHGLNE 146 Score = 35.1 bits (77), Expect = 0.075 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGG-XXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 GG G G GG GGG GGG G G G GG G G G G Sbjct: 76 GGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGG 133 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 GG G G GGG GG GGG G G GG G G G G Sbjct: 44 GGGHGGHGGHGGG-GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGG 99 Score = 32.3 bits (70), Expect = 0.53 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG--XGGXGXXGXXXXX 826 GG GG G G GGG GGG G G G GG G G Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGG 116 Query: 825 XGXG 814 G G Sbjct: 117 HGGG 120 Score = 31.9 bits (69), Expect = 0.70 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG--XGGXGXXGXXXXX 826 GG GG G G GG G G GGG G G G GG G G Sbjct: 51 GGHGGGGGHGHG-GHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGH 109 Query: 825 XGXG 814 G G Sbjct: 110 YGGG 113 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 4/66 (6%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP----XPPPXPXXXPLXP 982 P P P P PP P P PP PPP PPP P P Sbjct: 78 PPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESP 137 Query: 983 PRXXPP 1000 P PP Sbjct: 138 PAPPPP 143 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP---XPPPXPXXXPLXPP 985 P P P P P P PPP PPP PPP P P PP Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTP--PP 87 Query: 986 RXXPP 1000 PP Sbjct: 88 SSPPP 92 Score = 31.5 bits (68), Expect = 0.92 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PP PPP PP PP PP Sbjct: 71 PPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPP 106 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P P PP PP PPP P P PP PP Sbjct: 56 PAVFSPPPTVSSPP-PPPLDSSPPPPPDLTPP-PSSPPPPDAPPPIPIVFP--PPIDSPP 111 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P PPP PPP P P PP Sbjct: 37 PPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAP 96 Query: 995 PP 1000 PP Sbjct: 97 PP 98 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPP-PXPPPXPXXXPLXPPRXXPP 1000 P PP P PPP PP PPP P P PP Sbjct: 77 PPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPP 127 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/52 (26%), Positives = 15/52 (28%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P PP PPP PP PPP P P+ P Sbjct: 106 PIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSPQGGP 157 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/77 (31%), Positives = 25/77 (32%), Gaps = 1/77 (1%) Frame = +2 Query: 773 PLXFLLKPYSXXXH-PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP 949 P+ F P H P P P P PP P P PPP PPP Sbjct: 486 PVKFRRSPPPPPVHSPPPPSPIHSP--PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVH 543 Query: 950 PPXPXXXPLXPPRXXPP 1000 P P PP PP Sbjct: 544 SPPPPVHSPPPPVHSPP 560 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 H P P P P P PPP PP PP P P PP Sbjct: 600 HSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVK 659 Query: 992 XPP 1000 PP Sbjct: 660 SPP 662 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 2/62 (3%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX--PPPXPXXXPLXPPRXX 994 P P P P P P PP PPP PPP P P PP Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYS 668 Query: 995 PP 1000 PP Sbjct: 669 PP 670 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P P PP PP P + PPPPP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 35.9 bits (79), Expect = 0.043 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXP---PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P P P P P PPP PP PP P P P Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV 577 Query: 986 RXXPP 1000 PP Sbjct: 578 HSPPP 582 Score = 34.7 bits (76), Expect = 0.099 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PP PPP P P PP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYS 586 Query: 995 PP 1000 PP Sbjct: 587 PP 588 Score = 34.3 bits (75), Expect = 0.13 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPX---PXXXXXXXXPXXPPPXXXXXXPPPX--PPPXPXXXPLX 979 P P P PP P P P PP PPP PPP P P Sbjct: 538 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPP 597 Query: 980 PPRXXPP 1000 P PP Sbjct: 598 PVHSPPP 604 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 H P P P P P PPP PPP P P PP Sbjct: 578 HSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVH 637 Query: 992 XPP 1000 PP Sbjct: 638 SPP 640 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PPP PP PP P P P Sbjct: 552 PPPPVHSPPPPVHSPPPPVHSPPPPVHSP--PPPVYSPPPPPVHSPPPPVHSPPPPVHSP 609 Query: 995 PP 1000 PP Sbjct: 610 PP 611 Score = 33.9 bits (74), Expect = 0.17 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPX---PXPXXXXXXXXPXXPPPXXXXXXPPPX--PPPXPXXXPLX 979 P P P PP P P P PP PPP PPP P Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPP 626 Query: 980 PPRXXPP 1000 PP PP Sbjct: 627 PPVFSPP 633 Score = 33.5 bits (73), Expect = 0.23 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPX---PXPXXXXXXXXPXXPPPXXXXXXPPPX--PPPXPXXXPLX 979 P P P PP P P P PP PPP PPP P Sbjct: 560 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP 619 Query: 980 PPRXXPP 1000 PP PP Sbjct: 620 PPVHSPP 626 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PPP PP PP P P PP Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPPPPVYSP-PPPPPVHSPPPPVFSPPPPVHSP-PPPVYS 645 Query: 995 PP 1000 PP Sbjct: 646 PP 647 Score = 33.1 bits (72), Expect = 0.30 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PPP PP PP P P PP Sbjct: 559 PPPPVHSPPPPVHSPPPPVHSPPPPVYSP--PPPPVHSPPPPVHSPPPPVHSP-PPPVYS 615 Query: 995 PP 1000 PP Sbjct: 616 PP 617 Score = 32.3 bits (70), Expect = 0.53 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 5/74 (6%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPX---PPXPXPXXXXXXXXPXXPPPXXXXXXPPP--XPPPX 958 P S P P P P PP P P P PP PPP PP Sbjct: 503 PPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPV-HSPPPPVHSPPP 561 Query: 959 PXXXPLXPPRXXPP 1000 P P P PP Sbjct: 562 PVHSPPPPVHSPPP 575 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P P PP PPP P P PP PP Sbjct: 595 PPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPP 654 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P PP P PP P SP PPPP Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P P PPP P P P+ P PP Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPP 674 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/73 (27%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPP--XXPPXXXX 965 SP+ +P P P P P PP P PP PP Sbjct: 485 SPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPP--PPVYSPPPPPPVYSPPPPPPV 542 Query: 966 XSPSXXXAXPPPP 1004 SP PPPP Sbjct: 543 HSPPPPVHSPPPP 555 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/70 (24%), Positives = 18/70 (25%) Frame = +3 Query: 795 PIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSP 974 P+ P P P P P PP PP P SP Sbjct: 514 PVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 573 Query: 975 SXXXAXPPPP 1004 PPPP Sbjct: 574 PPPVHSPPPP 583 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/71 (25%), Positives = 19/71 (26%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXS 971 SP +P P P P PP P PP P S Sbjct: 572 SPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFS 631 Query: 972 PSXXXAXPPPP 1004 P PPPP Sbjct: 632 PPPPVHSPPPP 642 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/72 (25%), Positives = 19/72 (26%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXS 971 SP +P P P P P PP P PP Sbjct: 594 SPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSP 653 Query: 972 PSXXXAXPPPPP 1007 P PPPPP Sbjct: 654 PPPPVKSPPPPP 665 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/64 (26%), Positives = 18/64 (28%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP--PXPXXXPLXPPR 988 P P P P P P PP PP PP P P+ P Sbjct: 469 PQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPP 528 Query: 989 XXPP 1000 PP Sbjct: 529 PPPP 532 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 3/48 (6%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXX---PPXXXXXSPSXXXAXPPPPP 1007 P P P P P PP PP P + PPPPP Sbjct: 574 PPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP PP P SP PPPPP Sbjct: 547 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PPP PPP P PL PP+ Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSP--PPPPVKSPPPPPVYSP-----PLLPPKMS 677 Query: 995 PP 1000 P Sbjct: 678 SP 679 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P PPP P PPP P PPR Sbjct: 47 PPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPP-----PQPPPRSQ 101 Query: 995 PP 1000 PP Sbjct: 102 PP 103 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/78 (26%), Positives = 25/78 (32%) Frame = +2 Query: 767 IVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX 946 I+ L F + + P P P PP P P P PPP Sbjct: 17 ILALFFTIHCFLLVQSQDPPLFPQSPPPPPPPPPPP--PPPPPPPPPPPPAVNMSVETGI 74 Query: 947 PPPXPXXXPLXPPRXXPP 1000 PPP P + P PP Sbjct: 75 PPPPPPVTDMIKPLSSPP 92 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP PP + S PPPPP Sbjct: 44 PPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP PP PPPPP Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP P P PPP PPP P P PR PP Sbjct: 75 PPPPPPVTDMIKPLSSPPPP-----QPPPRSQPPPKPPQKNLPRRHPP 117 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXX-GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG RGG G G GGG GG GGG G G G GG G Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGG 140 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 G GG RG G GGG GGG G G G G G G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGG 145 Query: 819 XG 814 G Sbjct: 146 GG 147 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGG--XGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 GG GG G G GGG G GGG G G G GG Sbjct: 107 GGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGG 156 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = -2 Query: 975 RGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXGXXXXE* 796 RG G GG G G GGG G G GG G G Sbjct: 85 RGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYG 144 Query: 795 GFNRNXNG 772 G R G Sbjct: 145 GGGRREGG 152 Score = 28.3 bits (60), Expect = 8.6 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 5/67 (7%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGG----GXGGGXXXXXXGGGXXGXXXXXXXXGXG-XGGXGXXGXX 835 GG GG G G GG G GGG G G G G G G G G Sbjct: 99 GGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGD 158 Query: 834 XXXXGXG 814 G G Sbjct: 159 GGSYGGG 165 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 G GG G G G GGG GG G G GG G Sbjct: 119 GGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 167 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 998 GGXXXXXXGGXXXXXGGXXGGGXXGXXXGGG 906 GG GG GG GGG G GGG Sbjct: 136 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 166 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P P PP PPP PPP P P P PP Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSL-----PPPVPPPPPSHQPYSYPPPPPP 51 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P P P PPP PP P PPR P Sbjct: 35 PPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPPRHQGP 94 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP PP P PPPPP Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 PY P P P P P P P P PP PPP PPP Sbjct: 7 PYPPLPQP-PSQNSLAPPPPPPSLPPPV-------PPPPPSHQPYSYPPPPPPP 52 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG R G G G GG GGG GGG G G G G G Sbjct: 100 GGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 149 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GG GGG GGG G G GG G G Sbjct: 114 GGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 173 Query: 819 XG 814 G Sbjct: 174 GG 175 Score = 34.7 bits (76), Expect = 0.099 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 4/73 (5%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG----XGGXGXXGXXX 832 GG GG G G GGG GG GGG G G GG G G Sbjct: 93 GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR 152 Query: 831 XXXGXGXXXXE*G 793 G G E G Sbjct: 153 REGGGGYGGGEGG 165 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = -2 Query: 984 GGXRGXXXGXGGG-XGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG G G GGG GG GGG G G G G G Sbjct: 90 GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG 135 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PP P P P PPP PPP PPP P PP Sbjct: 390 PSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPP-PPPMSKKGPPKPP 436 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 PP P P P PPP PPP P P P PP Sbjct: 372 PPAP-PGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 33.1 bits (72), Expect = 0.30 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP P PPP P P PP PP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P P PP PPP PP P PP Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPP 425 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP PPP PPP P PP P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGP 405 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 PP P P P PPP PP PPP P PP P Sbjct: 384 PPPPPPPSAAAPPPP--PPPKKGPAAPP--PPPPPGKKGAGPPPPPP 426 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 4/66 (6%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPX----PXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXP 982 P P P PP P P P PPP PPP P P Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGP 432 Query: 983 PRXXPP 1000 P+ PP Sbjct: 433 PK--PP 436 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP---XPPPXPXXXPLXPPRXXPP 1000 P P PP P P P PP PPP PP P P P PP Sbjct: 95 PPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPP 150 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 2/52 (3%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPP--PXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P PP P PP P P P PL PP+ PP Sbjct: 124 PPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPP 175 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 1/70 (1%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P + P P P P P PPP P P PP P P Sbjct: 111 PANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPP 170 Query: 974 -LXPPRXXPP 1000 L PP PP Sbjct: 171 KLVPPSHSPP 180 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP---PPXPXXXPLXPPRXXPP 1000 P P PP P P PPP PPP P PP PP PP Sbjct: 72 PPEPSPPSPSLTGPPPTTIPVSPPP--EPSPPPPLPTEAPPPANPVSSPPPESSPP 125 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P PP P P PPP PPP P P P PP P Sbjct: 67 PLSSPPPEPSPPSPSL----TGPPPTTIPVSPPPEPSPPPPLPTEAPPPANP 114 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 5/55 (9%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPXPXXXPLXPPRXXPP 1000 P P P P PP PPP PPP P P P PP Sbjct: 57 PAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPP 111 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/71 (28%), Positives = 21/71 (29%), Gaps = 2/71 (2%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP--PPXPXX 967 P + P P P PP P P PPP PP P P P Sbjct: 64 PETPLSSPPPEPSPPSPSLTGPP-PTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPES 122 Query: 968 XPLXPPRXXPP 1000 P PP P Sbjct: 123 SPPPPPPTEAP 133 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P PP SP + PPPPP Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 30.3 bits (65), Expect = 2.1 Identities = 20/77 (25%), Positives = 21/77 (27%), Gaps = 1/77 (1%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP-PPXP 949 P + P P P P P P P PP P PP Sbjct: 87 PTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTN 146 Query: 950 PPXPXXXPLXPPRXXPP 1000 PP P P P PP Sbjct: 147 PPPPPESPPSLPAPDPP 163 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXX--PPXXXPXXXPPXX-PPXXXXXSPSXXXAXPPPP 1004 P P P P PP P PP PP SPS PPPP Sbjct: 101 PPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPP 151 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXP-PPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P P PP P P P P P PP PP Sbjct: 239 PTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSS-SPPTLLPP 288 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPR 988 P P PP P P P P PP PP P PPR Sbjct: 252 PVHPSPPSP-PEETLPPPKPSPDPLPSNSSSPPTLLPPSSVVSPPSPPR 299 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPP-PXPPPXPXXXP 973 P PP P P P PPP PP P PPP P P Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PPP P PPP PP P PP Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPP 86 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP PP P PPPPP Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 32.3 bits (70), Expect = 0.53 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXS--PSXXXAXPPPPP 1007 P P PP PP PP S PS PPPPP Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 32.3 bits (70), Expect = 0.53 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPPXXL 1008 PP PPP PP PP PP PP L Sbjct: 64 PPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPPGDL 102 Score = 31.5 bits (68), Expect = 0.92 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P PP P P P P PPP PPP P PP Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSP-------LPPPPPPPPPNYVFTYPP 99 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 914 PXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PPP PP P P PP PP Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPP 71 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P PPP PPP P PL PP PP Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPP----SPPPPKKSSCP-PSPLPPPPPPPP 90 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG G G G GGG GG GGG G G G GG G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 34.7 bits (76), Expect = 0.099 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G G GGG GGG G G G GG G G G Sbjct: 83 GGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGG-------GCGGGGGGKGGKSGGGSG 135 Query: 819 XGXXXXE*GFN 787 G G N Sbjct: 136 GGGYMVAPGSN 146 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 954 GGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 GGG GGG GGG G G GG G G G G Sbjct: 79 GGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGG 125 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 981 GXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G G G GG GGG GGG G G GG G G Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG +G G G GG GGG G G G GG G G Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGS 134 Query: 816 G 814 G Sbjct: 135 G 135 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 960 GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXGXXXXE*GFNRN 781 G GG G G GGG G G GG G G G G G NR+ Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRS 61 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -2 Query: 981 GXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G +G GGG GGG GGG G G G GG G Sbjct: 2 GGKGGSGSGGGGKGGG--GGGSGGGRGGGGGGGAKGGCGGGGKSGGG 46 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 37.5 bits (83), Expect = 0.014 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G GGG GGG GGG G G G G G G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREG 120 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G GGG GGG GGG G G G GG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG----WYKWGCGGGGKG 115 Score = 35.9 bits (79), Expect = 0.043 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G GGG GGG GGG G G G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREG 120 Score = 34.7 bits (76), Expect = 0.099 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 GG G GGG GGG GGG G G G GG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 32.7 bits (71), Expect = 0.40 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G R G G G GGG GGG GGG G G G G G G Sbjct: 63 GSYRWGW-GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGR 121 Query: 816 G 814 G Sbjct: 122 G 122 Score = 32.7 bits (71), Expect = 0.40 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G GGG G G GGG G G G G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRG 122 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 37.5 bits (83), Expect = 0.014 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P P P P P P P PP PPP PPP P P Sbjct: 536 PQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPP-PVHSP 594 Query: 974 LXPPRXXPP 1000 PP PP Sbjct: 595 PPPPVFSPP 603 Score = 37.5 bits (83), Expect = 0.014 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 3/53 (5%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP---PPXPXXXPLXPPRXXPP 1000 P PP P P P PP PPP P PP P P PP PP Sbjct: 582 PPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSP-PPPVYSPP 633 Score = 35.1 bits (77), Expect = 0.075 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP---XPPPXPXXXPLXPPRXXPP 1000 P PP P PPP PPP PPP P P P PP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPP 627 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXP---PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P P P P P PPP PPP P P PP Sbjct: 576 PPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPP 635 Query: 986 RXXPP 1000 PP Sbjct: 636 TFSPP 640 Score = 33.5 bits (73), Expect = 0.23 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPX---PXXXXXXXXPXXPPPXXXXXXPPP--XPPPXPXXXPLX 979 P P P PP P P P PPP PPP PPP P Sbjct: 553 PPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPP 612 Query: 980 PPRXXPP 1000 P PP Sbjct: 613 SPVYSPP 619 Score = 31.5 bits (68), Expect = 0.92 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P P PP P PPP P P PP PP Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSP-PPPVFSPP 610 Score = 31.5 bits (68), Expect = 0.92 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PP PPP PP PP PP Sbjct: 569 PPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPP 604 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 H P P P P P P PP PPP P P PP Sbjct: 592 HSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTHNTNQPPMG 651 Query: 992 XP 997 P Sbjct: 652 AP 653 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/71 (25%), Positives = 20/71 (28%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXS 971 SP+ +P P P P PP P PP S Sbjct: 515 SPVKNRRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYS 574 Query: 972 PSXXXAXPPPP 1004 P A PPPP Sbjct: 575 PPPPVASPPPP 585 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/69 (27%), Positives = 20/69 (28%) Frame = +2 Query: 791 KPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXX 970 KP P P P P P P P P P PP P P P Sbjct: 56 KPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPA 115 Query: 971 PLXPPRXXP 997 P P+ P Sbjct: 116 PTPAPKPKP 124 Score = 33.5 bits (73), Expect = 0.23 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXP-PRX 991 P P P P P P P P P PP P P P P P P+ Sbjct: 31 PKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKP 90 Query: 992 XP 997 P Sbjct: 91 AP 92 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 3/65 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXP---P 985 P P P P P P P P P PP P P P P P P Sbjct: 42 PKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTP 101 Query: 986 RXXPP 1000 PP Sbjct: 102 APTPP 106 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P P P P P P P P P P P+ Sbjct: 70 PTPPKPKPAPA-PTPPKPKPKPAPT---PPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPA 125 Query: 995 P 997 P Sbjct: 126 P 126 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 842 PXXPXP-PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXP---PRXXPP 1000 P P P P P P P P P PP P P P P P P PP Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P P P PP P P P P P Sbjct: 53 PKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Query: 995 PP 1000 P Sbjct: 113 AP 114 Score = 32.3 bits (70), Expect = 0.53 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 1/71 (1%) Frame = +2 Query: 791 KPYSXXXHPXPXXXXXXPXX-PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 KP P P P P PP P P P P P P P P P P Sbjct: 27 KPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPK-PAPAPTPPKPKPAPAPTP-P 84 Query: 968 XPLXPPRXXPP 1000 P P PP Sbjct: 85 KPKPKPAPTPP 95 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXP-XXPPPXXXXXXPPPXP-PPXPXXXPL-XPP 985 P P P P PP P P P P P P P P PP P P PP Sbjct: 26 PKPPKPKPAPA-PTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Query: 986 RXXP 997 + P Sbjct: 85 KPKP 88 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = +2 Query: 791 KPYSXXXHPXPXXXXXXPXXPXP-PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 KP P P P P P P P P P PP P P P P Sbjct: 32 KPAPAPTPPKPKPTPA-PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKP 90 Query: 968 XPLXP-PRXXP 997 P P P+ P Sbjct: 91 APTPPNPKPTP 101 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 1/70 (1%) Frame = +2 Query: 791 KPYSXXXHPXPXXXXXXPXXPXP-PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 KP P P P P P P P P P PP P P P P Sbjct: 43 KPTPAPTPPKPKPKPA-PTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTP 101 Query: 968 XPLXPPRXXP 997 P PP+ P Sbjct: 102 AP-TPPKPKP 110 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/70 (28%), Positives = 20/70 (28%), Gaps = 1/70 (1%) Frame = +2 Query: 791 KPYSXXXHPXPXXXXXXPXXPXP-PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 KP P P P P P P P P P PP P P P P Sbjct: 54 KPKPAPTPPKPKPAPA-PTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Query: 968 XPLXPPRXXP 997 P P P Sbjct: 113 APAPTPAPKP 122 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 3/50 (6%) Frame = +2 Query: 860 PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXP---PRXXPP 1000 P P P P P P PP P P P P P P PP Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P P P PP P P P P P P P P P Sbjct: 81 PTPPKPKPKPA-PTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKP 128 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 37.1 bits (82), Expect = 0.019 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 5/81 (6%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPX-----PPXPXPXXXXXXXXPXXPPPXXXXXXP 937 PL F L P S P P P PP P P PPP P Sbjct: 31 PLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPP 90 Query: 938 PPXPPPXPXXXPLXPPRXXPP 1000 P PP P P PP PP Sbjct: 91 PLLPP--PEEPPREPPPPPPP 109 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPX--PXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 P S P P P P PP P P PPP PP PP P Sbjct: 49 PSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Query: 968 XPLXPP 985 P PP Sbjct: 109 PPEEPP 114 Score = 35.1 bits (77), Expect = 0.075 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP-PPXPPPXPXXXPLXPPRX 991 P P P P PP P P P PPP P PP PP PL PP Sbjct: 29 PPPLVFPLLPLSP-PPSPPP---SPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPP 84 Query: 992 XP 997 P Sbjct: 85 LP 86 Score = 34.7 bits (76), Expect = 0.099 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPP 975 PP PPP P PPP PP PP Sbjct: 89 PPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +1 Query: 784 PIEALFXXXXPXXXXXXXXPXXXXPXXXXXXXXXXXPPXXXPPPXXXPXXPPPXXPP 954 P ALF P P P PP PP P PPP PP Sbjct: 58 PFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPP 114 Score = 32.3 bits (70), Expect = 0.53 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 PP P P PPP PPP PPP P Sbjct: 77 PPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 911 PPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP P PPP P P PPR PP Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPP 58 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P P P P P PPP PPP PP P Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPPPPP----PPPEEPPPP 116 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP PP P PPPPP Sbjct: 78 PLFPPPPLPRLPPPLLPP---PEEPPREPPPPPPPP 110 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/71 (23%), Positives = 19/71 (26%) Frame = +3 Query: 795 PIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSP 974 P+ +P P P P P PP P P PP Sbjct: 38 PLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPE 97 Query: 975 SXXXAXPPPPP 1007 PPPPP Sbjct: 98 EPPREPPPPPP 108 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP P P P PPP P P PL P PP Sbjct: 30 PPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPP 77 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P P PP PPP PPP P R P Sbjct: 76 PPPLFPPPPLPRLPPPLLPPPEEPPREP---PPPPPPPEEPPPPASCLRTKSP 125 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP--PPXPPPXPXXXPLXPPR 988 P P P P PP P P P PPP P P PPP P P Sbjct: 613 PPPSPLYYPPVTPSPPPPSPVYYPPVT-PSPPPPSPVYYPPVTPSPPPPSPVYYPSETQS 671 Query: 989 XXPP 1000 PP Sbjct: 672 PPPP 675 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP--PPXPPPXPXXXPLXPPR 988 P P P PP P P P PPP P P PPP P P P Sbjct: 598 PPPSPVYYPQVTPSPPPPSPLYYPPVT-PSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPS 656 Query: 989 XXPP 1000 PP Sbjct: 657 PPPP 660 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP--PPXPPPXPXXXPLXPPR 988 P P P PP P P P PPP P P PPP P P P Sbjct: 583 PPPSPVYYPPVTYSPPPPSPVYYPQVT-PSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPS 641 Query: 989 XXPP 1000 PP Sbjct: 642 PPPP 645 Score = 34.7 bits (76), Expect = 0.099 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXP-XXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 P P P PP P P P P P P PPP P P P Sbjct: 568 PPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSP 627 Query: 992 XPP 1000 PP Sbjct: 628 PPP 630 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/71 (28%), Positives = 22/71 (30%), Gaps = 5/71 (7%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPP 952 ++ YS P P PP P P PPP PPP PP Sbjct: 436 VRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPP 495 Query: 953 PXPXXXPLXPP 985 P P PP Sbjct: 496 PPPYVYSSPPP 506 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 PY P P P P PP PPP PPP P P P Sbjct: 478 PYVYSSPPPPPYVYSSP--PPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPE 535 Query: 974 LXPP 985 PP Sbjct: 536 SSPP 539 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P P PPP PP P P + Sbjct: 628 PPPSPVYYPPVTPSPPPPSPVYYPPVT-PSPPPPSPVYYPSETQSPPPPTEYYYSPSQSP 686 Query: 995 PP 1000 PP Sbjct: 687 PP 688 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P PPP P PPP PP+ Sbjct: 643 PPPSPVYYPPVTPSPPPPSPVYYPSETQSP-PPPTEYYYSPSQSPPPTKACKEGHPPQAT 701 Query: 995 P 997 P Sbjct: 702 P 702 Score = 32.7 bits (71), Expect = 0.40 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 4/73 (5%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP----XPPPXP 961 PY P P P P P P PPP PPP PPP P Sbjct: 469 PYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSP--PPPYVYSSPPPPYVYSSPPPPP 526 Query: 962 XXXPLXPPRXXPP 1000 P P PP Sbjct: 527 PSPPPPCPESSPP 539 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPP---PXPPPXPXXXPLXPP 985 P P P PP P P PPP PP PPP P P P Sbjct: 553 PPPSPVYYPPVTQSPPPPSP--VYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTP 610 Query: 986 RXXPP 1000 PP Sbjct: 611 SPPPP 615 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/62 (25%), Positives = 16/62 (25%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P PPP P PP P P Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNS 581 Query: 995 PP 1000 PP Sbjct: 582 PP 583 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +3 Query: 816 PXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXP 995 P P P P P PP P PP P P + P Sbjct: 426 PPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPP-PYVYSSPPPPYVYSSP 484 Query: 996 PPPP 1007 PPPP Sbjct: 485 PPPP 488 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP PP PP SP+ PPPPP Sbjct: 386 PTFKMSPEVRTLPPPIYVYSSPP--PPPSSKMSPTVRAYSPPPPP 428 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 PY P P P P PP P P PPP P PP P Sbjct: 507 PYVYSSPPPPYVYSSPP--PPPPSPPPPCPESS-----PPPPVVYYAPVTQSPPPPSPVY 559 Query: 974 LXPPRXXPP 1000 P PP Sbjct: 560 YPPVTQSPP 568 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPP---PXPPPXPXXXPLXPP 985 P P P PP P P PPP PP PPP P P P Sbjct: 538 PPPPVVYYAPVTQSPPPPSPVYYPPVTQS--PPPPSPVYYPPVTNSPPPPSPVYYP--PV 593 Query: 986 RXXPP 1000 PP Sbjct: 594 TYSPP 598 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PPP PPP P P PP Sbjct: 728 PPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHS 787 Query: 995 PP 1000 PP Sbjct: 788 PP 789 Score = 36.3 bits (80), Expect = 0.032 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 3/66 (4%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP---XPPPXPXXXPLXP 982 H P P P P P P PP PPP PPP P P P Sbjct: 718 HSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Query: 983 PRXXPP 1000 PP Sbjct: 778 VHSPPP 783 Score = 35.5 bits (78), Expect = 0.057 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 1/70 (1%) Frame = +2 Query: 794 PYSXXXH-PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXX 970 P S H P P P P P P PPP PP PP P Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHS 698 Query: 971 PLXPPRXXPP 1000 P P PP Sbjct: 699 PPPPVHSPPP 708 Score = 35.1 bits (77), Expect = 0.075 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P PPP PP PP P P P Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 802 Query: 995 PP 1000 PP Sbjct: 803 PP 804 Score = 34.7 bits (76), Expect = 0.099 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPP--PXPPPXPXXXPLXPPR 988 P P P PP P P PPP PP PPP P P PP Sbjct: 699 PPPPVHSPPPPVHSPPPPVHSPPPPVHSP--PPPVQSPPPPPVFSPPPPAPIYSPPPPPV 756 Query: 989 XXPP 1000 PP Sbjct: 757 HSPP 760 Score = 34.7 bits (76), Expect = 0.099 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P P PP PP P P PP Sbjct: 714 PPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHS 773 Query: 995 PP 1000 PP Sbjct: 774 PP 775 Score = 34.7 bits (76), Expect = 0.099 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P PPP PP PP P P P Sbjct: 736 PPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 795 Query: 995 PP 1000 PP Sbjct: 796 PP 797 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXX--PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P PPP PP PP P P PP PP Sbjct: 692 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPP 743 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PP PPP P P PP Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 801 Query: 995 PP 1000 PP Sbjct: 802 PP 803 Score = 33.9 bits (74), Expect = 0.17 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P PPP PPP P P PP Sbjct: 735 PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHS 794 Query: 995 PP 1000 PP Sbjct: 795 PP 796 Score = 33.5 bits (73), Expect = 0.23 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PPP PP PP P P P Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPPPVHSP--PPPPVHSPPPPVHSPPPPVHSPPPPVHSP 713 Query: 995 PP 1000 PP Sbjct: 714 PP 715 Score = 33.1 bits (72), Expect = 0.30 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 6/68 (8%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPX---PXXXXXXXXPXXPPPXXXXXXPPPX---PPPXPXXXPL 976 P P P PP P P P PP PPP PPP P P Sbjct: 753 PPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSP- 811 Query: 977 XPPRXXPP 1000 PP PP Sbjct: 812 PPPVFSPP 819 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P PPP PP PP P P P PP Sbjct: 670 PPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 729 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P PPP PP PP P P P + PP Sbjct: 677 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPP 736 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P PPP PP PP P P P PP Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Score = 32.3 bits (70), Expect = 0.53 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 6/68 (8%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPX---PXXXXXXXXPXXPPPXXXXXXPPPX--PPPXPXXXPLX 979 P P P PP P P P PP PPP PPP P P Sbjct: 685 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPP 744 Query: 980 P-PRXXPP 1000 P P PP Sbjct: 745 PAPIYSPP 752 Score = 31.9 bits (69), Expect = 0.70 Identities = 20/76 (26%), Positives = 21/76 (27%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP 952 P F P + P P P P P P PPP P PP Sbjct: 737 PPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 796 Query: 953 PXPXXXPLXPPRXXPP 1000 P P P PP Sbjct: 797 PPVHSPPPPSPIYSPP 812 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP--XPPPXPXXXPLXPPR 988 P P P PP P P PPP PPP PPP P PL PP Sbjct: 774 PPPPVHSPPPPVHSPPPPVHSPPPPVHSP--PPPSPIYSPPPPVFSPPPKP-VTPL-PPA 829 Query: 989 XXP 997 P Sbjct: 830 TSP 832 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P PP P PP P SP PPPP Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPP 673 Score = 29.5 bits (63), Expect = 3.7 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 2/65 (3%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP--XPPPXPXXXPLXPP 985 H P P P P P PPP P P PPP P P Sbjct: 764 HSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPV 823 Query: 986 RXXPP 1000 PP Sbjct: 824 TPLPP 828 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP PP P SP PPPPP Sbjct: 694 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/62 (25%), Positives = 16/62 (25%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P PP PPP P P PP Sbjct: 624 PQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHS 683 Query: 995 PP 1000 PP Sbjct: 684 PP 685 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P PP SP PPPPP Sbjct: 735 PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GG GGG GGG G G GG G G Sbjct: 97 GGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 Query: 819 XG 814 G Sbjct: 157 GG 158 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 987 RGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 RG G GG GGG GGG G G G G G Sbjct: 87 RGSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYG 132 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 36.3 bits (80), Expect = 0.032 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP P P PPP PPP PPP P P R PP Sbjct: 9 PPPPLPPRLELRRQ-RAPPPQPPPPPPPPPPPPPPRLGPRLRLRLLPP 55 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 35.9 bits (79), Expect = 0.043 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 4/73 (5%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP----PXP 961 P + P P P P P P P PP PPP PP P P Sbjct: 511 PVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPP 570 Query: 962 XXXPLXPPRXXPP 1000 PP PP Sbjct: 571 PVFSPPPPVYSPP 583 Score = 35.9 bits (79), Expect = 0.043 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXP-PRX 991 P P P PP P P PPP PP PP P P P P Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVH 603 Query: 992 XPP 1000 PP Sbjct: 604 SPP 606 Score = 35.1 bits (77), Expect = 0.075 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 4/66 (6%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP----PPXPXXXPLXP 982 P P P P P P PP PPP P PP P P P Sbjct: 494 PQPPKESPQPDDPYDQSPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPP 553 Query: 983 PRXXPP 1000 P PP Sbjct: 554 PVYSPP 559 Score = 35.1 bits (77), Expect = 0.075 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 4/67 (5%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX--PPPXXXXXXPP--PXPPPXPXXXPLX 979 H P P P PP P P PPP PP PPP P P Sbjct: 548 HSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPP 607 Query: 980 PPRXXPP 1000 P PP Sbjct: 608 PVHSPPP 614 Score = 35.1 bits (77), Expect = 0.075 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 6/74 (8%) Frame = +2 Query: 797 YSXXXHPXPXXXXXXPXXPXPPX----PXPXXXXXXXXPXXPPPXXXXXXPPPX--PPPX 958 YS P P P PP P P PPP PPP PPP Sbjct: 556 YSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPP 615 Query: 959 PXXXPLXPPRXXPP 1000 P PP PP Sbjct: 616 PPVYSPPPPVFSPP 629 Score = 34.7 bits (76), Expect = 0.099 Identities = 20/71 (28%), Positives = 22/71 (30%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXS 971 SP+ +P P P P P P P P PP PP S Sbjct: 510 SPVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPP--PPPPPVHS 567 Query: 972 PSXXXAXPPPP 1004 P PPPP Sbjct: 568 PPPPVFSPPPP 578 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-XPPPXPXXXPLXPPRX 991 P P P PP P P PP PPP PP P P P Sbjct: 536 PPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHS 595 Query: 992 XPP 1000 PP Sbjct: 596 PPP 598 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP--XPPPXPXXXPLXPPR 988 P P P PP P P PPP PPP PPP + P Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPP 641 Query: 989 XXPP 1000 PP Sbjct: 642 PRPP 645 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-XPPPXPXXXPLXPPRX 991 P P P PP P PPP PPP PP P P PP Sbjct: 575 PPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSP--PPSQ 632 Query: 992 XPP 1000 PP Sbjct: 633 SPP 635 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PP PP PP P PP+ Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKIN 648 Query: 995 PP 1000 P Sbjct: 649 SP 650 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP PP P PPPPP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPP--PPVHSPPPPPVYSPPPPPPP 564 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/62 (25%), Positives = 17/62 (27%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PP PPP P P + Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSP 655 Query: 995 PP 1000 PP Sbjct: 656 PP 657 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 2/51 (3%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX--PPPXPXXXPLXPPRXXP 997 P PP P PPP PP PPP P PP P Sbjct: 621 PPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAPVEKKETPPAHAP 671 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 35.9 bits (79), Expect = 0.043 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 6/63 (9%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX------PPPXXXXXXPPPXPPPXPXXXPL 976 P P P P P P P P PPP PPP P P PL Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPL 158 Query: 977 XPP 985 PP Sbjct: 159 TPP 161 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 35.9 bits (79), Expect = 0.043 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP PPP P PP PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 34.7 bits (76), Expect = 0.099 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPP 975 PP PPP P PPP PP PP Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 32.7 bits (71), Expect = 0.40 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PP PPP P PP PP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 PP P P P PPP PPP PP P Sbjct: 64 PPPPPPTSPPP---PSPPPPSPPPPSPPPPSPPPP 95 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PP PPP PP P P PP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PPP PPP PPP P PP Sbjct: 69 PTSPPPPSP---PPPSPPPPSPPPPSPPP 94 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 895 PXXXPPPXXXPXXPPPXXPPXXXXXPP 975 P PP P PPP PP PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 P P PP P P P PPP PPP PPP Sbjct: 69 PTSPPPPSPPP--------PSPPPP----SPPPPSPPP 94 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PP P P P PPP P PPP P PP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPP 414 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP 952 P P P PP P P PPP P P PP Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P P P P P PPP P PP P Sbjct: 370 PPPPVPAPQMP-SSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGP 421 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PP P P P PPP P PPP P PP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPP 414 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP 952 P P P PP P P PPP P P PP Sbjct: 371 PPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPP 416 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P P P P P PPP P PP P Sbjct: 370 PPPPVPAPQMP-SSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGP 421 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 35.5 bits (78), Expect = 0.057 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P PP P P P PPP PPP PPP P Sbjct: 305 PQKSIPPPPPPPPPPLLQQPP-PPPSVSKAPPPPPPPPPP 343 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPP 985 PPP PPP PPP P PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPP 328 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PPP P PPP P PP PP Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 866 PXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P PPP PPP P P PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +3 Query: 909 PPXXXPXXXPPXXPP--XXXXXSPSXXXAXPPPPP 1007 P P PP PP PS A PPPPP Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPP 339 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 35.5 bits (78), Expect = 0.057 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P PP P P P PP PP PP P PP Sbjct: 406 PIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 35.1 bits (77), Expect = 0.075 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP PP PS PPPPP Sbjct: 406 PIVALPPPPPPSPPLPPPVYSPPPSPP-VFSPPPSPPVYSPPPPP 449 Score = 33.9 bits (74), Expect = 0.17 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPP-XXXXXSPSXXXAXPPPPP 1007 P P P PP P PP PP PS + PPPPP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP--LXPPRXX 994 P P P P P P P P P P P PPP P P + PP Sbjct: 124 PPSTPKPPTKPPPSTPKP--PTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPT 181 Query: 995 PP 1000 PP Sbjct: 182 PP 183 Score = 34.7 bits (76), Expect = 0.099 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 3/73 (4%) Frame = +2 Query: 791 KPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX---PPPXP 961 KP + HP P P P P P PP PPP PP P Sbjct: 75 KPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKP 134 Query: 962 XXXPLXPPRXXPP 1000 PP PP Sbjct: 135 PPSTPKPPTTKPP 147 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P PP PP PP P + PP PP Sbjct: 134 PPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPP 193 Score = 33.1 bits (72), Expect = 0.30 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 1/71 (1%) Frame = +2 Query: 791 KPYSXXXHPXPXXXXXX-PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 KP + HP P P P P P P P PPP PP PPP Sbjct: 84 KPPTVKPHPKPPTVKPPHPKPPTKPHPHP-KPPIVKPPTKPPP--STPKPPTKPPPSTPK 140 Query: 968 XPLXPPRXXPP 1000 P P P Sbjct: 141 PPTTKPPPSTP 151 Score = 33.1 bits (72), Expect = 0.30 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P P PP PP PP P + PP PP Sbjct: 147 PPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPT---PPVITPPTPTPPVVTPPTPTPP 203 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/70 (25%), Positives = 20/70 (28%), Gaps = 1/70 (1%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPX-PXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXX 970 P+ HP P PP P P PP PP P P Sbjct: 36 PHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPP 95 Query: 971 PLXPPRXXPP 1000 + PP PP Sbjct: 96 TVKPPHPKPP 105 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-XPPPXPXXXPLXPPRX 991 P P P PP P P PP PP PP P + PP Sbjct: 151 PKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTP 210 Query: 992 XPP 1000 PP Sbjct: 211 TPP 213 Score = 31.9 bits (69), Expect = 0.70 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 7/70 (10%) Frame = +2 Query: 812 HPXPXX-XXXXPXXPXPPXPXPXXXXXXXXPXXP---PPXXXXXXPPPXPPPXPXXXPL- 976 HP P P P P P P P P PP P PPP P P Sbjct: 109 HPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTP 168 Query: 977 --XPPRXXPP 1000 PP PP Sbjct: 169 TPTPPVVTPP 178 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/71 (26%), Positives = 20/71 (28%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 +KP P P P P P P P PPP P P Sbjct: 97 VKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHH 156 Query: 968 XPLXPPRXXPP 1000 P PP PP Sbjct: 157 KP--PPTPCPP 165 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPP--PXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP P P P PP P PP PP P P P PP Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTP-KPPTVKPHPKPP 77 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/72 (26%), Positives = 20/72 (27%), Gaps = 1/72 (1%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXP-XXPPPXXXXXXPPPXPPPXPX 964 +KP P P P PP P P PP PP PP P Sbjct: 44 VKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPK 103 Query: 965 XXPLXPPRXXPP 1000 P PP Sbjct: 104 PPTKPHPHPKPP 115 Score = 30.3 bits (65), Expect = 2.1 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P PP PP PP P + PP Sbjct: 178 PTPTPPVITPPTPTPPVVTP---PTPTPPVITPP---TPTPPVITPPTPTPPVVTPPTPT 231 Query: 995 PP 1000 PP Sbjct: 232 PP 233 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P PP P P PP PP PP P + PP Sbjct: 188 PTPTPPVVTPPTPTPPVITP---PTPTPPVITPP---TPTPPVVTPPTPTPPVVTPPTPT 241 Query: 995 PP 1000 PP Sbjct: 242 PP 243 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/69 (27%), Positives = 20/69 (28%), Gaps = 6/69 (8%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXP---XPXXXXXXXXPXXPPPXXXXXXPPPXP---PPXPXXXP 973 H P P P P P P P P P P P PP P Sbjct: 155 HHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPV 214 Query: 974 LXPPRXXPP 1000 + PP PP Sbjct: 215 ITPPTPTPP 223 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPX-PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 P P P P PP P P PP PP P P P P Sbjct: 34 PAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKP-PTVKPHP 92 Query: 992 XPP 1000 PP Sbjct: 93 KPP 95 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPP-PXPPPXPXXXPLXPPRX 991 P P P P PP P P PP PP P PP P P PP Sbjct: 63 PTPKPPTVKPH-PKPPTVKPHPKPPTVKPHPKPP---TVKPPHPKPPTKPHPHP-KPPIV 117 Query: 992 XPP 1000 PP Sbjct: 118 KPP 120 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 35.5 bits (78), Expect = 0.057 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 4/65 (6%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP----XPPPXPXXXPLXP 982 P P P P P P P P P P PPP P P PL P Sbjct: 52 PSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPP 111 Query: 983 PRXXP 997 P P Sbjct: 112 PPPPP 116 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P + P P P P P P PPP PPP PPP P Sbjct: 66 PQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPL---PPPPPPPLHFSSP 122 Query: 974 L 976 L Sbjct: 123 L 123 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 866 PXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P PPP PPP P P P P PP Sbjct: 50 PAPSPEPEDYLPLPPPPQTP--PPPPPPQSLPPPSPSPEPEHYPP 92 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 35.5 bits (78), Expect = 0.057 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG G G G GGG GGG GGG G G G G G Sbjct: 154 GGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 33.9 bits (74), Expect = 0.17 Identities = 22/76 (28%), Positives = 24/76 (31%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G GG GGG GGG G G GG G G G Sbjct: 135 GGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGG 194 Query: 819 XGXXXXE*GFNRNXNG 772 G G + +G Sbjct: 195 GGGGYGHGGVSTKGSG 210 Score = 32.7 bits (71), Expect = 0.40 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGG---GXGGGXXXXXXGGGXXGXXXXXXXXGXG-XGGXGXXGXXX 832 G GG G G GG G GGG GGG G G G GG G G Sbjct: 100 GELTAGGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGY 159 Query: 831 XXXGXG 814 G G Sbjct: 160 GSGGGG 165 Score = 31.5 bits (68), Expect = 0.92 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 5/67 (7%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXG-----GGXXGXXXXXXXXGXGXGGXGXXGXX 835 GG GG G GGG GGG G GG G G G GG G G Sbjct: 117 GGYGPGGGGGGVV-IGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGG 175 Query: 834 XXXXGXG 814 G G Sbjct: 176 VIIGGGG 182 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 35.1 bits (77), Expect = 0.075 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXP 982 P P P PP P P P P P PPP PPP P P P Sbjct: 695 PPPMQHSTVTKVPPPPPPAP--------PAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P PPP PPP PP P + + PP Sbjct: 709 PPPPAPPAPPTPIVHTSSPPPPPPP------PPPPAPPTPQSNGISAMKSSPP 755 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP--PPXPXXXPLXPPRXXPP 1000 P P PP P P PP PPP P PP P PP PP Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPP-----PPPPAPPAPPTPIVHTSSPPPPPPP 733 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP-PPXPXXXPLXPPRXXPP 1000 P P PP P P PPP P P P P PP PP Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 6/66 (9%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXP-XXXXXXXXPXXPP-----PXXXXXXPPPXPPPXPXXXPLXP 982 P P P PP P P PP P PPP PP P Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRA 786 Query: 983 PRXXPP 1000 P PP Sbjct: 787 PSAPPP 792 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP PP A PPPPP Sbjct: 757 PPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 35.1 bits (77), Expect = 0.075 Identities = 23/68 (33%), Positives = 24/68 (35%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P+S HP P P PP P P P PPP P PPP P P Sbjct: 37 PFSPPHHPPPPHFS--PPHQPPPSPYPH-------PHPPPPSPYPH--PHQPPPPPHVLP 85 Query: 974 LXPPRXXP 997 PP P Sbjct: 86 PPPPTPAP 93 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P P PPP P P P P PP Sbjct: 26 PPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPP-PPPHVL 84 Query: 995 PP 1000 PP Sbjct: 85 PP 86 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 HP P P PP P P PP P P P P P P P Sbjct: 18 HPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHP-PPPSPYPHPHQ 76 Query: 992 XPP 1000 PP Sbjct: 77 PPP 79 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 4/38 (10%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPP----XPXXXPLXPPRXXPP 1000 P PP P P PPP P P PP PP Sbjct: 9 PYYSPPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPP 46 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 34.7 bits (76), Expect = 0.099 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG RG GG GGG GG G G GG G G Sbjct: 362 GGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG RGG G GGG GG GGG G G G G G G Sbjct: 366 GGGYRGGGGYDMGGVGGGGAGGYGAG--GGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 32.3 bits (70), Expect = 0.53 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGG-XXGXXXXXXXXGXGXGGXGXXGXXXXXX 823 GG G G G GG GGG GGG G G G GG G G Sbjct: 347 GGYGSSGIGGYGGGMGGAGGGG---YRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGG 403 Query: 822 GXG 814 G G Sbjct: 404 GGG 406 Score = 31.9 bits (69), Expect = 0.70 Identities = 25/81 (30%), Positives = 27/81 (33%), Gaps = 5/81 (6%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXG-----GGXXGXXXXXXXXGXGXGGXGXXGXX 835 GG RGG G GGG GGG G GG G G G G G G Sbjct: 304 GGYNRGGYS---MGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGG 360 Query: 834 XXXXGXGXXXXE*GFNRNXNG 772 G G G++ G Sbjct: 361 MGGAGGGGYRGGGGYDMGGVG 381 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 34.7 bits (76), Expect = 0.099 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P PP PPP PPP P PP PP Sbjct: 649 PRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPP--PPGGGPP 699 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 909 PPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 PP PP PP P PPPPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 PP P P PP PPP PPP Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXP 972 PP PPP P PP PP P Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPPPP 705 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 34.7 bits (76), Expect = 0.099 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G G GGG GGG G G G G G G G G Sbjct: 72 GGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAG 124 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G G GG GGG GGG G G G G G G Sbjct: 64 GGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAG 116 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 34.3 bits (75), Expect = 0.13 Identities = 20/71 (28%), Positives = 21/71 (29%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP 952 P + PY P P P PP P P PP PP PP Sbjct: 364 PYVYKSPPY-VYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPP 422 Query: 953 PXPXXXPLXPP 985 P P PP Sbjct: 423 PSPSYSYSSPP 433 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/73 (27%), Positives = 23/73 (31%) Frame = +3 Query: 786 Y*SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXX 965 Y SP + +P P P P P P PP PP Sbjct: 367 YKSPPYVYSSPPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPP--- 423 Query: 966 XSPSXXXAXPPPP 1004 SPS + PPPP Sbjct: 424 -SPSYSYSSPPPP 435 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 34.3 bits (75), Expect = 0.13 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 GG G G GGG GG GGG G G GG G G G Sbjct: 265 GGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGG 321 Score = 33.1 bits (72), Expect = 0.30 Identities = 20/62 (32%), Positives = 22/62 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG + G +G GGG GGG GGG G G GG G G Sbjct: 250 GGPAKNGGKGAPAAGGGGAGGG---KGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGG 306 Query: 819 XG 814 G Sbjct: 307 GG 308 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G GG GGG G G G G G G Sbjct: 288 GGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAGGVSGGFRPMGGG 337 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP P SP A PPP P Sbjct: 98 PQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAP 136 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P P P P P PP P PPP P P P P Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPP 141 Score = 31.5 bits (68), Expect = 0.92 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PPP P P PP PP PP Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPP 148 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/65 (27%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = +2 Query: 785 LLKPYSXXXHPXPXXXXXXPXXPXPP-XPXPXXXXXXXXPXXPPPXXXXXXP-PPXPPPX 958 ++ P + P P PP P P P PPP P P PPP Sbjct: 90 VISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPA 149 Query: 959 PXXXP 973 P P Sbjct: 150 PVSPP 154 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXP 982 P P P P P PPP PPP P P P P Sbjct: 127 PTPASPPPAPASPPPAPASPPPAPVS--PPPVQAPSPISLPPAP 168 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/70 (25%), Positives = 20/70 (28%), Gaps = 1/70 (1%) Frame = +2 Query: 791 KPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX-PPPXPXX 967 +P + P P P P P PP PPP PPP P Sbjct: 65 QPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTS 124 Query: 968 XPLXPPRXXP 997 P P P Sbjct: 125 PPPTPASPPP 134 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 HP P P P P P PP PP PP P P P Sbjct: 61 HPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPV 120 Query: 992 XPP 1000 PP Sbjct: 121 KPP 123 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/63 (25%), Positives = 16/63 (25%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 HP P P P P PP P PP P P P Sbjct: 57 HPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPA 116 Query: 992 XPP 1000 PP Sbjct: 117 KPP 119 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P PP PP PP P P P PP Sbjct: 143 PVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPP 195 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/63 (25%), Positives = 16/63 (25%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 HP P P P P PP PP PP P P Sbjct: 49 HPHPPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPV 108 Query: 992 XPP 1000 PP Sbjct: 109 KPP 111 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 34.3 bits (75), Expect = 0.13 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG G GGG GGG GGG G G GG G Sbjct: 45 GGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Score = 33.5 bits (73), Expect = 0.23 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G +G GGG GGG GGG G G G GG G G Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGG----GEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGG 85 Query: 819 XG 814 G Sbjct: 86 GG 87 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G G G GG GGG G G G GG G G Sbjct: 45 GGGEGGGGEG---GGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGG 94 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG + G GGG GG GGG G G G GG G Sbjct: 55 GGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGG--------GEGDGGGG 96 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 33.9 bits (74), Expect = 0.17 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P P P PP P PP PP SP PPP Sbjct: 23 PPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPP 66 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/79 (26%), Positives = 22/79 (27%), Gaps = 6/79 (7%) Frame = +2 Query: 767 IVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX------PPPXXXX 928 + PL L P S P P P P P P PPP Sbjct: 4 VPPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSS 63 Query: 929 XXPPPXPPPXPXXXPLXPP 985 P PPP P PP Sbjct: 64 PPPSSSPPPSPPVITSPPP 82 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P PPP PPP P P P Sbjct: 57 PPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTP--ATTPPAPPQTVS 114 Query: 995 PP 1000 PP Sbjct: 115 PP 116 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/73 (26%), Positives = 20/73 (27%), Gaps = 5/73 (6%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXP-----PPXXXXXXPPPXPPPX 958 P + P P P P P P P PP PPP P P Sbjct: 81 PPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPS 140 Query: 959 PXXXPLXPPRXXP 997 P PP P Sbjct: 141 PPGETPSPPGETP 153 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXX---PPXXXXXSPSXXXAXPPPPP 1007 P PP P PP PP SP + PP PP Sbjct: 37 PVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPP 75 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/39 (30%), Positives = 13/39 (33%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P PP P+ PPP P Sbjct: 99 PSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKP 137 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PP P P PPP PP P P L PP Sbjct: 153 PSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDP--STLAPP 195 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 G G RG G GGG GGG GGG G G G GG Sbjct: 108 GGRSGSGRGRGSGGGGGHGGG---GGGGGGRGGGGGSGNGEGYGEGG 151 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G GG G G G G GGG GGG G G G G G G Sbjct: 104 GSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRG-GGGGSGNGEGYGEGGGYG 154 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 G G RG G G G GGG GGG G G GG G Sbjct: 109 GRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYG 158 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGG 910 GG RGG G G G G GGG GG Sbjct: 131 GGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 GG G G GG GGG GGG G G GG Sbjct: 108 GGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGG 155 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G G G G G G G G GGG G G G G G Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 Query: 816 G 814 G Sbjct: 160 G 160 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PPP PP PP P P PP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPP---ATPPPVASPPPPVASP--PPATP 105 Query: 995 PP 1000 PP Sbjct: 106 PP 107 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P PPP P PPP P PP PP Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 3/63 (4%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP---PPXPPPXPXXXPLXPPRX 991 P P PP P P PPP P PP P P P P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLA 117 Query: 992 XPP 1000 PP Sbjct: 118 SPP 120 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P PP PP P P P PP PP Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP--PPVSSPP 78 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP--PPXPPPXPXXXPLXPPR 988 P P P P P P PPP P PP P P P P Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVA 98 Query: 989 XXPP 1000 PP Sbjct: 99 SPPP 102 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/55 (29%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX--PPPXPXXXP 973 P P P P P P P P PPP PPP P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 33.9 bits (74), Expect = 0.17 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PPP PP PP P P PP Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPP---ATPPPVASPPPPVASP--PPATP 105 Query: 995 PP 1000 PP Sbjct: 106 PP 107 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P PPP P PPP P PP PP Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPP 88 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 3/63 (4%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP---PPXPPPXPXXXPLXPPRX 991 P P PP P P PPP P PP P P P P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLA 117 Query: 992 XPP 1000 PP Sbjct: 118 SPP 120 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P PP PP P P P PP PP Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPP--PPVSSPP 78 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP--PPXPPPXPXXXPLXPPR 988 P P P P P P PPP P PP P P P P Sbjct: 39 PPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVA 98 Query: 989 XXPP 1000 PP Sbjct: 99 SPPP 102 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/55 (29%), Positives = 16/55 (29%), Gaps = 2/55 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPX--PPPXPXXXP 973 P P P P P P P P PPP PPP P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 33.9 bits (74), Expect = 0.17 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 1/64 (1%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP-PPXPPPXPXXXPLXPPR 988 H P P PP P P PPP P PP PPP L Sbjct: 225 HQPPPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSA 284 Query: 989 XXPP 1000 PP Sbjct: 285 SKPP 288 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 33.9 bits (74), Expect = 0.17 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P PP P P P PPP P PPP P Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 33.1 bits (72), Expect = 0.30 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 P P PP P P PPP P P PPP Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 935 PPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP P PP PP Sbjct: 244 PPPPPPPIPVKQSATPPPPPPP 265 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P PP P P PPP P PPP P Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/39 (30%), Positives = 14/39 (35%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P PP + + PPPPP Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G RG G G GG GGG GGG G G G GG G G Sbjct: 35 GYGGRGASGGGSYGGRGGYGGGGGRGNRGGG-GGGYQGGDRGGRGSGGGGRDG 86 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G GGG GGG G G G GG G G Sbjct: 11 GGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRG 63 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 33.5 bits (73), Expect = 0.23 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G RG G G GG GGG GGG G G G GG G G Sbjct: 35 GYGGRGASGGGSYGGRGGYGGGGGRGNRGGG-GGGYQGGDRGGRGSGGGGRDG 86 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G GGG GGG G G G GG G G Sbjct: 11 GGAPIPSYGGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRG 63 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P PP P PP PP P A PPP P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 31.9 bits (69), Expect = 0.70 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP PPP P P P PP+ PP Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPP 288 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PP P PP PP PP PP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPP 289 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P PPP P P PPP P PP+ P Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPK-----PQPPPPPKIARPPPAPPKGAAP 306 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP 952 P P P P PP P P PPP PPP PP Sbjct: 266 PPPPAAAPPPQPPPPPPPKP----------QPPPPPKIARPPPAPP 301 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP PP P PP PP Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P PP P P PPP PPP P + PP Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 G RG G GGG GGG GG G G GG G Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYG 625 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 G RGG G G GGG G G GGG G G G GG Sbjct: 581 GSGRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSG-GYGG 626 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 33.1 bits (72), Expect = 0.30 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 G GG G G GG GG GG G G G GG G G Sbjct: 139 GSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAG 198 Query: 819 XG 814 G Sbjct: 199 GG 200 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G GG G GGG GG G G G G GG G G Sbjct: 154 GGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGGGYGSSG 205 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -2 Query: 984 GGXRGXXXGXGGGXG--GGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G GGG G GG G G G G GG G G Sbjct: 134 GGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSG 183 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G GGG GG G G G G GG G Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGG 170 Score = 29.5 bits (63), Expect = 3.7 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXG--GGXGGGXXXXXXGGG-XXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G G GG GGG GG G G G GG G Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGG 178 >At5g07150.1 68418.m00815 leucine-rich repeat family protein contains weak similarity to LRR receptor-like protein kinase [Nicotiana tabacum] gi|7672732|gb|AAF66615; contains Pfam PF00560 domain Leucine Rich Repeat Length = 553 Score = 33.1 bits (72), Expect = 0.30 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P PPP PP P P+ PP PP Sbjct: 152 PSQPSPPSPMEEVPIDFPFFFAPPPQNIGASPPTETQVIPNPSPVPPPPAQPP 204 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 33.1 bits (72), Expect = 0.30 Identities = 23/84 (27%), Positives = 26/84 (30%), Gaps = 4/84 (4%) Frame = +2 Query: 761 ARIVPLXFLLKPYSXXXHPXPXXXXXXPXX-PXPPXPXPXXXXXXXXPXXPPPXXXXXXP 937 A +V +PY P P P PP P PPP P Sbjct: 19 ALLVGSAMATEPYYYSSPPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPP 78 Query: 938 PP---XPPPXPXXXPLXPPRXXPP 1000 PP PPP P P + PP Sbjct: 79 PPVKSPPPPYVYSSPPPPVKSPPP 102 Score = 31.9 bits (69), Expect = 0.70 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX--PPPXXXXXXPPP- 943 P + P P P P P P P P PPP PPP Sbjct: 70 PPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 129 Query: 944 --XPPPXPXXXPLXPPRXXPP 1000 PPP P P + PP Sbjct: 130 KSPPPPYYYHSPPPPVKSPPP 150 Score = 31.9 bits (69), Expect = 0.70 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXP-XXPPPXXXXXXPPP-- 943 P + P P P P P P P P PPP PPP Sbjct: 102 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 161 Query: 944 --XPPPXPXXXPLXPPRXXPP 1000 PPP P P + PP Sbjct: 162 KSPPPPYYYHSPPPPVKSPPP 182 Score = 31.9 bits (69), Expect = 0.70 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX--PPPXXXXXXPPP- 943 P + P P P P P P P P PPP PPP Sbjct: 118 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 177 Query: 944 --XPPPXPXXXPLXPPRXXPP 1000 PPP P P + PP Sbjct: 178 KSPPPPYLYSSPPPPVKSPPP 198 Score = 31.5 bits (68), Expect = 0.92 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX--PPPXXXXXXPPP---XPPPXPXXXPLX 979 P P P P P P P PPP PPP PPP P Sbjct: 52 PPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPP 111 Query: 980 PPRXXPP 1000 P + PP Sbjct: 112 PVKSPPP 118 Score = 31.5 bits (68), Expect = 0.92 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX--PPPXXXXXXPPP---XPPPXPXXXPLX 979 P P P P P P P PPP PPP PPP P Sbjct: 68 PPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 127 Query: 980 PPRXXPP 1000 P + PP Sbjct: 128 PVKSPPP 134 Score = 31.5 bits (68), Expect = 0.92 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX--PPPXXXXXXPPP---XPPPXPXXXPLX 979 P P P P P P P PPP PPP PPP P Sbjct: 100 PPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP 159 Query: 980 PPRXXPP 1000 P + PP Sbjct: 160 PVKSPPP 166 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/74 (27%), Positives = 21/74 (28%), Gaps = 3/74 (4%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX--PPPXXXXXXPPPX 946 P + P P P P P P P P PPP PPP Sbjct: 134 PPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPV 193 Query: 947 -PPPXPXXXPLXPP 985 PP P PP Sbjct: 194 KSPPPPVYIYASPP 207 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 33.1 bits (72), Expect = 0.30 Identities = 24/89 (26%), Positives = 26/89 (29%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG RGG RG GGG GG GGG G G G Sbjct: 104 GGGGRGGGRG-GGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGG 162 Query: 819 XGXXXXE*GFNRNXNGTIRAXXCGXXSNF 733 G G G + CG +F Sbjct: 163 GGGRYGSGGGGGGGGGGLSCYSCGESGHF 191 Score = 30.7 bits (66), Expect = 1.6 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G RG G GGG GGG GGG G G GG G G Sbjct: 91 GGGGSSGGRGGFGG-GGGRGGGRGGGSYGGGYGGR---------GSGGRGGGG 133 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 981 GXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 G G G GG GGG GGG G G GG G Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 33.1 bits (72), Expect = 0.30 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GGG GGG G G G GG G G G Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYG--GGGGHYGGGGGGYGGGGGHHGGGG 114 Query: 819 XG 814 G Sbjct: 115 HG 116 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 GG G G GGG GG GGG G G GG G G G G Sbjct: 44 GGGHGGHGGHGGG-GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGG 99 Score = 31.9 bits (69), Expect = 0.70 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXG--XGGXGXXGXXXXX 826 GG GG G G GG G G GGG G G G GG G G Sbjct: 51 GGHGGGGGHGHG-GHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGH 109 Query: 825 XGXG 814 G G Sbjct: 110 HGGG 113 Score = 31.9 bits (69), Expect = 0.70 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 998 GGXXXXXXGGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GG GGG G GGG GG Sbjct: 78 GGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHGGG 113 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 33.1 bits (72), Expect = 0.30 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 873 PXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P PP P P PP SPS A PPPPP Sbjct: 489 PSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVR-AYPPPPP 532 Score = 32.3 bits (70), Expect = 0.53 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 3/63 (4%) Frame = +2 Query: 821 PXXXXXXPXXPXP---PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRX 991 P P P P P P P PP PPP PPP PP Sbjct: 495 PSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554 Query: 992 XPP 1000 PP Sbjct: 555 SPP 557 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P P P P PPP PPP P P P PP Sbjct: 513 PPPPSSEMSPSVRAYPPPPPLSPPP---PSPPPPYIYSSPPPPSPSPPPPYIYSSPP 566 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP P P P PPP PPP P+ PP Sbjct: 618 PPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/62 (25%), Positives = 16/62 (25%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P PPP PPP P P Sbjct: 675 PPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPP 734 Query: 995 PP 1000 PP Sbjct: 735 PP 736 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = +2 Query: 797 YSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPL 976 Y+ P P P PP P P PPP PPP P P Sbjct: 627 YAVQSPPPPPPVYYPPVTASPPPP-PVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYP- 684 Query: 977 XPPRXXPP 1000 P PP Sbjct: 685 -PVTQSPP 691 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/62 (25%), Positives = 16/62 (25%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P P P PPP P P Sbjct: 690 PPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPP 749 Query: 995 PP 1000 PP Sbjct: 750 PP 751 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPP 1004 P PP P PP PP SP PPPP Sbjct: 528 PPPPPLSPP---PPSPPPPYIYSSPPPPSPSPPPP 559 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPP--PXPPPXPXXXPLXPPR 988 P P P PP P P PPP PP PPP P P Sbjct: 647 PPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPP---VYYPPVTQSPPPSPVYYPPVTQS 703 Query: 989 XXPP 1000 PP Sbjct: 704 PPPP 707 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 10/60 (16%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP----------XPPPXPXXXPLXPPRXXPP 1000 P PP P PPP PPP PPP P P PP PP Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPP--PPSPPPP 543 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 860 PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P PPP PP PPP P + P PP Sbjct: 594 PSPSPPYYQYTSSP--PPPTYYATQSPP-PPPPPTYYAVQSPPPPPP 637 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 32.7 bits (71), Expect = 0.40 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG GG G G GGG G G GGG G Sbjct: 87 GGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGG 120 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 954 GGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GGG GGG GGG G G G GG G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 31.5 bits (68), Expect = 0.92 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G GGG GG G G G GG G G G Sbjct: 108 GGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGGYGGGGGYGGG 167 Query: 819 XG 814 G Sbjct: 168 GG 169 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 G GG G G GGG GGG GGG G G G GG G Sbjct: 84 GNSGGGSSGGRGGFGGGRGGG---RGSGGGYGG--GGGGYGGRGGGGRG 127 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXG-GGXGGGXXXXXXGGGXXG 898 GG GG G G G GG GGG GGG G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 G RGG RG G G G GGG GGG G Sbjct: 98 GGGRGGGRGS--GGGYGGGGGGYGGRGGGGRGG 128 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGG 907 GG GG G G GGG GGG GGG Sbjct: 154 GGGGYGGG-GGYGGGGGGYGGGGRGGGGGGG 183 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPX--PXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 P+ P P P P P P P PPP PPP P P Sbjct: 719 PHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYS 778 Query: 968 XPLXPP 985 P PP Sbjct: 779 PPPSPP 784 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 8/56 (14%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPP--------PXPPPXPXXXPLXPPRXXPP 1000 PP P P P PPP PP P PPP P P PP+ PP Sbjct: 702 PPPPAPYYYSS---PQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSP--PPQSHPP 752 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P P P PPP PP PP P PP Sbjct: 760 PPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP 816 Score = 29.1 bits (62), Expect = 4.9 Identities = 21/73 (28%), Positives = 23/73 (31%), Gaps = 4/73 (5%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXX-PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP-PPXP-- 961 P S P P P P PP P P PP P P PP P Sbjct: 507 PPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTPST 566 Query: 962 XXXPLXPPRXXPP 1000 P+ P + PP Sbjct: 567 PPTPISPGQNSPP 579 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/71 (25%), Positives = 18/71 (25%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXS 971 SP TP P P P P P P P P S Sbjct: 467 SPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSPSIS 526 Query: 972 PSXXXAXPPPP 1004 PS P PP Sbjct: 527 PSPPITVPSPP 537 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 2/65 (3%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXP-PXPXPXXXXXXXXPXXPPPXXXXXXPPPXP-PPXPXX 967 P S P P P P P P P P P PP P PP P Sbjct: 543 PGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPV 602 Query: 968 XPLXP 982 P P Sbjct: 603 IPSPP 607 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 32.7 bits (71), Expect = 0.40 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 HP P P P P P P P PPP PP PP P PP Sbjct: 119 HPTPKKSPSPP--PTPSLPPPAPKKSPSTPSLPPPTPK--KSPPPPPSHHSSSPSNPP 172 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P P P P P P P P PP Sbjct: 85 PSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPP 137 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 32.7 bits (71), Expect = 0.40 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXG 859 G GG G G GGG GG GGG G G G G Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 972 GXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G G GGG GGG GGG G G G GG G G Sbjct: 98 GDVGGGGGGYGGGTPG---GGGGGGGDTGAGAGGGGYGGGGDTG 138 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G GG GGG G G G G G G Sbjct: 97 GGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 960 GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 G GG GGG GGG G G G GG G G G G Sbjct: 98 GDVGGGGGGYGGGTPGGG--GGGGGDTGAGAGGGGYGGGGDTGAGGGVG 144 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 32.7 bits (71), Expect = 0.40 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P P PPP PPP PPP Sbjct: 134 PYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPP 193 Query: 959 PXXXPLXPP 985 P PP Sbjct: 194 PYVYKSPPP 202 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/76 (26%), Positives = 21/76 (27%), Gaps = 5/76 (6%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP--- 943 P + PY P P P P P PPP PPP Sbjct: 57 PYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYV 116 Query: 944 --XPPPXPXXXPLXPP 985 PPP P PP Sbjct: 117 YSSPPPPPYVYKSPPP 132 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 4/61 (6%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP----XPPPXPXXXPLXP 982 P P P P P P P PP PPP PPP P P Sbjct: 152 PPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP 211 Query: 983 P 985 P Sbjct: 212 P 212 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 84 PYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 143 Query: 959 PXXXPLXPP 985 P PP Sbjct: 144 PYVYSSPPP 152 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 4/68 (5%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP----XPPPXP 961 PY P P P P P PPP PPP PPP P Sbjct: 114 PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPP 173 Query: 962 XXXPLXPP 985 PP Sbjct: 174 PYVYQSPP 181 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 154 PYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 213 Query: 959 PXXXPLXPP 985 P PP Sbjct: 214 PYVYKSPPP 222 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 174 PYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 233 Query: 959 PXXXPLXPP 985 P PP Sbjct: 234 PYVYKSPPP 242 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 194 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 253 Query: 959 PXXXPLXPP 985 P PP Sbjct: 254 PYVYKSPPP 262 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 214 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 273 Query: 959 PXXXPLXPP 985 P PP Sbjct: 274 PYVYKSPPP 282 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 234 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 293 Query: 959 PXXXPLXPP 985 P PP Sbjct: 294 PYVYSSPPP 302 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 254 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPP 313 Query: 959 PXXXPLXPP 985 P PP Sbjct: 314 PYVYKSPPP 322 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 274 PYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPP 333 Query: 959 PXXXPLXPP 985 P PP Sbjct: 334 PYVYKSPPP 342 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 104 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPP 163 Query: 959 PXXXPLXPP 985 P PP Sbjct: 164 PYVYSPPPP 172 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 32.3 bits (70), Expect = 0.53 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 12/82 (14%) Frame = +2 Query: 791 KPYSXXXHPXPXXXXXXPXXPXP-----PXPXPXXXXXXXXPXXP----PPXXXXXXPPP 943 KP HP P P P P P P P P P PP PPP Sbjct: 278 KPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPPP 337 Query: 944 ---XPPPXPXXXPLXPPRXXPP 1000 PPP P P PP Sbjct: 338 KIVIPPPKIEHPPPVPVYKPPP 359 Score = 28.3 bits (60), Expect = 8.6 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 7/78 (8%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXX--PXX--PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP---X 946 L P+ HP P P P PP P P PP PP Sbjct: 156 LPPFKGFDHPFPLPPPLELPPFLKKPCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYD 215 Query: 947 PPPXPXXXPLXPPRXXPP 1000 PPP P P PP Sbjct: 216 PPPKKEVPPPVPVYKPPP 233 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 4/66 (6%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX--PPPXXXXXXPP--PXPPPXPXXXPLXP 982 P P P P P P P PPP PP PPP P P P Sbjct: 223 PPPVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPPVPVYKP--P 280 Query: 983 PRXXPP 1000 P+ P Sbjct: 281 PKIEHP 286 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 32.3 bits (70), Expect = 0.53 Identities = 18/71 (25%), Positives = 20/71 (28%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 +KP P P P P P P P PP PPP Sbjct: 285 VKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPP 344 Query: 968 XPLXPPRXXPP 1000 P+ P PP Sbjct: 345 TPIYSPPVKPP 355 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/62 (25%), Positives = 16/62 (25%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PP PPP P P Sbjct: 478 PTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIK 537 Query: 995 PP 1000 PP Sbjct: 538 PP 539 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/71 (23%), Positives = 19/71 (26%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 +KP P P P P P P PP P PP Sbjct: 386 VKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPP 445 Query: 968 XPLXPPRXXPP 1000 P+ P PP Sbjct: 446 TPIYSPPVKPP 456 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/73 (26%), Positives = 20/73 (27%), Gaps = 2/73 (2%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XP 961 +KP P P P P P P P PP PPP P Sbjct: 621 IKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLP 680 Query: 962 XXXPLXPPRXXPP 1000 PP PP Sbjct: 681 PTPTYSPPVKPPP 693 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/72 (26%), Positives = 20/72 (27%), Gaps = 3/72 (4%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXP--PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP-XPX 964 P H P P P P P P P P PP PPP Sbjct: 183 PIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKP 242 Query: 965 XXPLXPPRXXPP 1000 P+ P PP Sbjct: 243 PTPIYSPPIKPP 254 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 4/67 (5%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXP--PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XPXXXPLX 979 H P P P P P P P P PP PPP P Sbjct: 240 HKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYS 299 Query: 980 PPRXXPP 1000 PP PP Sbjct: 300 PPVKSPP 306 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/62 (25%), Positives = 16/62 (25%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P P P P P PP PPP P P Sbjct: 428 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQ 487 Query: 995 PP 1000 PP Sbjct: 488 PP 489 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/75 (28%), Positives = 23/75 (30%), Gaps = 7/75 (9%) Frame = +2 Query: 797 YSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXX---PXXPPPXXXXXXP---PPXPPPX 958 YS +P P P P P P P PPP P PP PP Sbjct: 129 YSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPV 188 Query: 959 -PXXXPLXPPRXXPP 1000 P+ P PP Sbjct: 189 HKPPTPIYSPPIKPP 203 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/71 (23%), Positives = 19/71 (26%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 +KP P P P P P P PP P PP Sbjct: 150 VKPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPP 209 Query: 968 XPLXPPRXXPP 1000 P+ P PP Sbjct: 210 TPIYSPPIKPP 220 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/73 (26%), Positives = 20/73 (27%), Gaps = 2/73 (2%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XP 961 +KP P P P P P P P PP PPP P Sbjct: 268 VKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKP 327 Query: 962 XXXPLXPPRXXPP 1000 PP PP Sbjct: 328 PTPTYSPPIKPPP 340 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/67 (28%), Positives = 19/67 (28%), Gaps = 4/67 (5%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXP--PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XPXXXPLX 979 H P P P P P P P P PP PPP P Sbjct: 358 HKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYS 417 Query: 980 PPRXXPP 1000 PP PP Sbjct: 418 PPIKLPP 424 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/71 (23%), Positives = 19/71 (26%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 +KP P P P P P P P PP PP Sbjct: 369 VKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPP 428 Query: 968 XPLXPPRXXPP 1000 P+ P PP Sbjct: 429 TPIYSPPVKPP 439 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/73 (26%), Positives = 20/73 (27%), Gaps = 2/73 (2%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XP 961 +KP P P P P P P P PP PPP P Sbjct: 536 IKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 595 Query: 962 XXXPLXPPRXXPP 1000 PP PP Sbjct: 596 PTPTYSPPIKPPP 608 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/73 (26%), Positives = 20/73 (27%), Gaps = 2/73 (2%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XP 961 +KP P P P P P P P PP PPP P Sbjct: 570 IKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKP 629 Query: 962 XXXPLXPPRXXPP 1000 PP PP Sbjct: 630 PTPTYSPPIKPPP 642 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/73 (26%), Positives = 20/73 (27%), Gaps = 2/73 (2%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XP 961 +KP P P P P P P P PP PPP P Sbjct: 604 IKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKP 663 Query: 962 XXXPLXPPRXXPP 1000 PP PP Sbjct: 664 PTPTYSPPVKPPP 676 Score = 28.3 bits (60), Expect = 8.6 Identities = 19/73 (26%), Positives = 20/73 (27%), Gaps = 2/73 (2%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XP 961 +KP P P P P P P P PP PPP P Sbjct: 655 IKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVP 714 Query: 962 XXXPLXPPRXXPP 1000 PP PP Sbjct: 715 PTPTYSPPIKPPP 727 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 GG G G GGG GGG G G G G G GG Sbjct: 385 GGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGG 432 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXG---GGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G GGG G G GG G G G GG G G Sbjct: 370 GGGDAGAITQVMQGWGGGGAGAVTQVMQGCGGGGGGGDGGGGQGTGIGGGGGGEQG 425 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 31.9 bits (69), Expect = 0.70 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = +2 Query: 794 PY-SXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP--XPX 964 PY S P P P PP P P PPP PP PPP P Sbjct: 46 PYRSPVTIPPPPPVYSRPVAFPPPPPI---YSPPPPPIYPPPIYSPPPPPIYPPPIYSPP 102 Query: 965 XXPLXPP 985 P+ PP Sbjct: 103 PTPISPP 109 Score = 31.5 bits (68), Expect = 0.92 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP P PPP P P PP PP Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPPIYPPP 84 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP P P P PP PP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P PP PP PP P P PP Sbjct: 43 PPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYP--PPIYS 100 Query: 995 PP 1000 PP Sbjct: 101 PP 102 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +2 Query: 860 PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P PPP P P P+ PP P Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSP 88 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXP 996 P PPP PPP PP PP P Sbjct: 63 PVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 1/63 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP-XPXXXPLXPPRX 991 P P P P P P PP PP PP P P+ PP Sbjct: 110 PTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTT 169 Query: 992 XPP 1000 PP Sbjct: 170 TPP 172 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/78 (25%), Positives = 22/78 (28%), Gaps = 1/78 (1%) Frame = +2 Query: 770 VPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPX-PXXXXXXXXPXXPPPXXXXXXPPPX 946 +P L P P P P P P P P PP PP Sbjct: 33 LPTPTLPSPSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPV 92 Query: 947 PPPXPXXXPLXPPRXXPP 1000 P P+ PP PP Sbjct: 93 STPPIKLPPVQPPTYKPP 110 Score = 31.1 bits (67), Expect = 1.2 Identities = 20/73 (27%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +3 Query: 792 SPIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPP-XXPPXXXXX 968 SP+ TP P P P P PP P PP PP Sbjct: 137 SPVKPPTTP-PVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVK 195 Query: 969 SPSXXXAXPPPPP 1007 P+ PP PP Sbjct: 196 PPTAPPVKPPTPP 208 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/64 (26%), Positives = 18/64 (28%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP--PXPXXXPLXPPR 988 P P PP P P PP P PP P P+ PP Sbjct: 127 PTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPT 186 Query: 989 XXPP 1000 PP Sbjct: 187 YNPP 190 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 895 PXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 P PP P PP PP PP PP Sbjct: 171 PPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPP 205 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG GG G G GG GG GG G G G G G Sbjct: 145 GGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPG 197 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G G GG GG GGG G G G G G Sbjct: 149 GGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASG 201 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G G GG GG GG G G G G G Sbjct: 153 GGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGGASG 205 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 31.9 bits (69), Expect = 0.70 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P P P P PP P P P P P P P PPP P P Sbjct: 162 PLPPPPPPYPS-PLPPPPSPSPTPGPDSPL-PSPGPDSPLPLPGPPPSPSPTP 212 Score = 31.9 bits (69), Expect = 0.70 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 1/70 (1%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPP-PXPPPXPXXX 970 P S P P P P P P P PP P P P P P Sbjct: 214 PDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDS- 272 Query: 971 PLXPPRXXPP 1000 PL P PP Sbjct: 273 PLPSPGPDPP 282 Score = 31.5 bits (68), Expect = 0.92 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP 952 PL P S P P P P P P P P P PP P Sbjct: 226 PLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPS 285 Query: 953 PXP 961 P P Sbjct: 286 PGP 288 Score = 30.7 bits (66), Expect = 1.6 Identities = 18/68 (26%), Positives = 18/68 (26%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P S P P P P P P P P P PP P P Sbjct: 186 PDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSP 245 Query: 974 LXPPRXXP 997 L P P Sbjct: 246 LPSPGPPP 253 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP-PPXPXXXPLXPPRXXP 997 P P PP P P P P P P P P P P P PP P Sbjct: 161 PPLPPPPPPYP---SPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSP 210 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXP-XXXPLXPPRXXPP 1000 P PPP PPP P P P PL P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSP 198 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +2 Query: 815 PXPXXXXXXPXXPXP-PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP-XXXPLXPPR 988 P P P P P P P P P P PPP P P P PL P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSP-GPDSPLPLPGPPPSPSPTPGPDSPLPSPG 222 Query: 989 XXPP 1000 P Sbjct: 223 PDSP 226 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/62 (27%), Positives = 17/62 (27%), Gaps = 1/62 (1%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP-PXPXXXPLXPPRX 991 P P P P P P P PP P P P P P P P Sbjct: 200 PLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTP 259 Query: 992 XP 997 P Sbjct: 260 GP 261 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 935 PPPXPPPXPXXXPLXPPRXXPP 1000 PP PPP P PL PP P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSP 182 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 31.9 bits (69), Expect = 0.70 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG G GG GGG GGG G G GG G Sbjct: 30 GGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHG 74 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = -2 Query: 984 GGXRGXXXGXGG-GXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 GG G G GGG GGG G G G GG G G G G Sbjct: 15 GGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGG 72 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG G G G GGG GGG G G G G G G Sbjct: 40 GGEGGGGEGTSGEGGGGGGDGTKGGGD-GISGGGHGDGLGCSGGGGDG 86 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 31.9 bits (69), Expect = 0.70 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = +2 Query: 851 PXPPXP----XPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PP P P P PP PP PP P PP+ PP Sbjct: 49 PSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPP 102 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPP 1001 P PP P PP PP PS PPP Sbjct: 70 PNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 PP P P PPP PP P P P P Sbjct: 69 PPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTP 107 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 3/51 (5%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP---PXPXXXPLXPPRXXPP 1000 PP P PPP PP PP P P PP PP Sbjct: 43 PPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPP 93 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 31.5 bits (68), Expect = 0.92 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXP 949 P P PP P P P PPP PP P Sbjct: 217 PFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 5/53 (9%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP-----PPXPPPXPXXXPLXPP 985 P P PP P P PPP PP PPP PP Sbjct: 198 PLPPLPPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPP 250 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 31.5 bits (68), Expect = 0.92 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 G GG G G GGG GGG GG G G GG Sbjct: 64 GNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIGAGTSGGSTGG 111 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 31.5 bits (68), Expect = 0.92 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 899 PXXPPPXXXXXXP-PPXPPPXPXXXPLXPPRXXP 997 P PPP P PP PPP P P P P Sbjct: 12 PPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PP P P P PPP PPP PP P L P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPP------PPPPPPQLPFGPKLPFP 45 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +2 Query: 935 PPPXPPPXPXXX---PLXPPRXXPP 1000 PPP PPP P PL PP PP Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPP 33 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 914 PXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PPP PPP P PP PP Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPP 32 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P P P PPP PPP PPP P Sbjct: 407 PTLPPPPVIEITRDPS-PPPSPVQPPPPPSPPPQP 440 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P PPP P PPP P P PP PP Sbjct: 407 PTLPPPPVIEITRDPSPPPSPVQPP--PPPSPPP 438 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 5/62 (8%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGG-----XXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G GGG GG GGG G G G GG G G G Sbjct: 79 GGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLGGIGG 138 Query: 819 XG 814 G Sbjct: 139 VG 140 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/60 (26%), Positives = 17/60 (28%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P P PPP PP P P P P + PP Sbjct: 226 PHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPPVEYPSPPYKKYPP 285 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 911 PPXXXXXXPPPXPPPXPXXXPLXPPR 988 PP PPP PPP P P P R Sbjct: 244 PPQQPPATPPPPPPPPPVEVPQKPRR 269 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 911 PPXXXXXXPPPXPPPXPXXXPLXPP 985 PP PPP PPP P P PP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPP--PP 395 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 5/67 (7%) Frame = +2 Query: 815 PXPXXXXXXPXXPX----PPXPXPXXXXXXXXPXXPPPXXXXXX-PPPXPPPXPXXXPLX 979 P P P P PP P P PPP PPP PPP Sbjct: 161 PPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAARSYKR 220 Query: 980 PPRXXPP 1000 P PP Sbjct: 221 SPPPPPP 227 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/73 (24%), Positives = 19/73 (26%), Gaps = 2/73 (2%) Frame = +3 Query: 795 PIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXX--PPXXXPXXXPPXXPPXXXXX 968 P+ L P P P P P P P P PP Sbjct: 57 PVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSP 116 Query: 969 SPSXXXAXPPPPP 1007 P PPPPP Sbjct: 117 PPPPVLLSPPPPP 129 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/73 (24%), Positives = 19/73 (26%), Gaps = 2/73 (2%) Frame = +3 Query: 795 PIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXX--PPXXXPXXXPPXXPPXXXXX 968 P+ L P P P P P P P P PP Sbjct: 66 PVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSP 125 Query: 969 SPSXXXAXPPPPP 1007 P PPPPP Sbjct: 126 PPPPVLLSPPPPP 138 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/73 (24%), Positives = 19/73 (26%), Gaps = 2/73 (2%) Frame = +3 Query: 795 PIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXX--PPXXXPXXXPPXXPPXXXXX 968 P+ L P P P P P P P P PP Sbjct: 75 PVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSP 134 Query: 969 SPSXXXAXPPPPP 1007 P PPPPP Sbjct: 135 PPPPVNLSPPPPP 147 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/73 (24%), Positives = 19/73 (26%), Gaps = 2/73 (2%) Frame = +3 Query: 795 PIXLXXTPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXX--PPXXXPXXXPPXXPPXXXXX 968 P+ L P P P P P P P P PP Sbjct: 84 PVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSP 143 Query: 969 SPSXXXAXPPPPP 1007 P PPPPP Sbjct: 144 PPPPVLLSPPPPP 156 Score = 28.7 bits (61), Expect = 6.5 Identities = 22/82 (26%), Positives = 24/82 (29%), Gaps = 11/82 (13%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPXP---------PXPXPXXXXXXXXPXXPPP--X 919 P+ F P + P P P P P P P P P PPP Sbjct: 156 PVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPPQAA 215 Query: 920 XXXXXPPPXPPPXPXXXPLXPP 985 PP PPP PP Sbjct: 216 RSYKRSPPPPPPSKYGRVYSPP 237 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/50 (30%), Positives = 15/50 (30%), Gaps = 1/50 (2%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXX-PPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P P P P P PP P PPPPP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = -2 Query: 999 GGXXRGGXRGXXX-GXGGGXGGGXXXXXXGGGXXG 898 GG RGG G G GGG GG GGG G Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -2 Query: 975 RGXXXGXGG-GXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 RG G GG G GG GGG G G G GG Sbjct: 85 RGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGX--GGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G RGG G G G G GGG GGG G G G G G Sbjct: 195 GSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSG 248 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGX--GGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G RGG G G G G GGG GGG G G G G G Sbjct: 203 GSERGGGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSG 256 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG G G G GGG GG GGG G G G GG G Sbjct: 39 GGEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWG--------GGGEGGGG 80 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 30.7 bits (66), Expect = 1.6 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = -2 Query: 999 GGXXRGGXRGXXX---GXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G GG GGG GGG G G GG G Sbjct: 64 GGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 29.1 bits (62), Expect = 4.9 Identities = 21/67 (31%), Positives = 21/67 (31%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG GG G G GGG GG G G G GG G G G Sbjct: 59 GGHGHGGHNGGGGHGLDGYGGGH------GGHYGGGGGHYGGGGGHGGGGHYGGGGHHGG 112 Query: 819 XGXXXXE 799 G E Sbjct: 113 GGHGLNE 119 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGG 907 G GG G G GGG GGG GGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGG 907 GG GG G G GG GGG GGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -2 Query: 987 RGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 RGG RG G G G G G GGG G G G GG G G G G Sbjct: 3 RGGYRG---GRGDGRGRG------GGGDRGRGYSGRGDGRGRGGDGDRGYSGRGDGHG 51 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 30.7 bits (66), Expect = 1.6 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXG 820 GG G G G G G GG G G G G G GG G G G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAG-AGLGLGGGGGGLGGGGGGLLGGGGFGGG 99 Query: 819 XG 814 G Sbjct: 100 AG 101 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = -2 Query: 999 GGXXRGGXR-GXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG GG G G G G G G GGG G G GG G Sbjct: 55 GGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 GG G G G G G GGG GGG G G G GG Sbjct: 60 GGLGIGAGIGAGAGLGLGGGGGGL-GGGGGGLLGGGGFGGGAGGGLGG 106 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 2/51 (3%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXX--PPPXPPPXPXXXPLXPPRXXP 997 P PP PPP PP PPP P P PP+ P Sbjct: 348 PPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPR 988 PPP PPP PP P P PR Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPPQKRPR 399 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPP 975 PP PP PPP PP PP Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 907 PPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PPP PPP PP PP PP Sbjct: 1136 PPPQPPSSPPPPSSPPQLAPAPPPSDHCLPP 1166 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 851 PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 P PP P P P PP PPP PPP Sbjct: 22 PLPPPPPPPMRRSAPSP---PPMSGRVPPPPPPPP 53 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 860 PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 P P P P PPP PPP PPP Sbjct: 626 PYPLPRLVRVGS-PSPPPPSMSGGAPPPPPPP 656 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPP---RXXPP 1000 PP PPP PPP P PP R PP Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPP 48 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +3 Query: 861 PXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAXPPPPP 1007 P P P PP P PP P A PPPPP Sbjct: 169 PSLYPQVQQYPQPSGYPPASGYPPQPSAYPPPSTSGYPPIPSAYPPPPP 217 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 4/67 (5%) Frame = +2 Query: 812 HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX---PPPXXXXXXPPPXPPPXPXXXPLXP 982 +P P P P P P PPP PP PP P P P Sbjct: 178 YPQPSGYPPASGYPPQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGP 237 Query: 983 -PRXXPP 1000 P PP Sbjct: 238 YPGQYPP 244 Score = 28.3 bits (60), Expect = 8.6 Identities = 18/70 (25%), Positives = 20/70 (28%), Gaps = 1/70 (1%) Frame = +2 Query: 794 PYSXXX-HPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXX 970 PYS + P P P P PPP P P P P Sbjct: 159 PYSTAPPYSGPSLYPQVQQYPQPSGYPPASGYPPQPSAYPPPSTSGYPPIPSAYPPPPPS 218 Query: 971 PLXPPRXXPP 1000 PP+ PP Sbjct: 219 SAYPPQPYPP 228 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -2 Query: 981 GXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 G +G G GGG GGG GGG G Sbjct: 187 GRQGRYSGDGGGFGGGGSGFGGGGGGGG 214 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P S P P P PP P P P P P P P P Sbjct: 40 PSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNP 99 Query: 974 LXPP 985 PP Sbjct: 100 RSPP 103 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 815 PXPXXXXXXPXX-PXPPXPXPXXXXXXXXPXXP-PPXXXXXXPP-PXPPPXPXXXPLXPP 985 P P P P P P P P P PP PP PP P P P Sbjct: 27 PPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPI 86 Query: 986 RXXPP 1000 PP Sbjct: 87 TPSPP 91 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P P P P P PPP PP PPP P PP Sbjct: 212 PTKPEPNKPQSAVGANGLPPPPPPPPHQ--AQPPPPPPSGLFPPPPPP 257 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P P P P PPP P P Sbjct: 104 PQPPSSSPEADSPLPPSSSPEANSPQSPASSPKPESLADSPSPPPPPPQPESPSSPSYPE 163 Query: 995 P 997 P Sbjct: 164 P 164 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GG +GG G G GGG GG G G GG G G Sbjct: 61 GGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGG 113 >At2g05170.1 68415.m00544 vacuolar protein sorting 11 family protein / VPS11 family protein similar to Vacuolar protein sorting 11 (hVPS11) (PP3476) (Swiss-Prot:Q9H270) [Homo sapiens]; similar to Vacuolar biogenesis protein END1 (PEP5 protein) (Vacuolar protein sorting 11) (Swiss-Prot:P12868) [Saccharomyces cerevisiae] Length = 932 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 4/85 (4%) Frame = +3 Query: 213 IGEYETAIAXCSEYLKEKKGEVIXEAVKRLIENGKRNTMDFAYQLWTKDG--KEIVKSYF 386 +G Y+ A+ S + G I + K LIE+ + T+D +L T+ G + S Sbjct: 498 LGNYDEALQYVSSLEPSQAGVTIEQYGKILIEHKPKETIDILMRLCTEQGIPNGVFLSML 557 Query: 387 --PIQFRVIFXEQTVKLINKRDHHA 455 P+ F +F + L++ + +A Sbjct: 558 PSPVDFITVFVQHPHSLMHFLERYA 582 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PPP PPP PP P PP Sbjct: 98 PPSPPPPSQACPPPPLPPSPPKKSYCPPP 126 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP 943 P P P PP P P P P P PPP Sbjct: 86 PCLQNIPPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPP 126 >At1g62250.2 68414.m07023 expressed protein Length = 223 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +1 Query: 109 LCLPSSSPCVRWLLTPHLHQELMTYWRSSCI*VSSLVNTRPLS 237 LC P + +RW TP + E+++ WR C +++ R ++ Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWRGFCAVIANAYYIRGMA 222 >At1g62250.1 68414.m07022 expressed protein Length = 267 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/43 (27%), Positives = 23/43 (53%) Frame = +1 Query: 109 LCLPSSSPCVRWLLTPHLHQELMTYWRSSCI*VSSLVNTRPLS 237 LC P + +RW TP + E+++ WR C +++ R ++ Sbjct: 181 LCTPQPT-VIRWSSTPSVSDEILSKWRGFCAVIANAYYIRGMA 222 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 29.9 bits (64), Expect = 2.8 Identities = 24/89 (26%), Positives = 29/89 (32%) Frame = +2 Query: 719 SSYTIKLLXXPQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXX 898 SSY+ K + + PL + + HP P P PP P Sbjct: 42 SSYSPKKYSPYYSASPLPPLQYRRQGPKYTPHPKPYLFNSPP----PPYYSPSPKEDYKS 97 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PPP PPP P P PP Sbjct: 98 P--PPPYVYNSPPPPYYSPSPKVDYKSPP 124 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGX 817 G GG G G GGG G GGG G G G G G G Sbjct: 313 GGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGG 372 Query: 816 G 814 G Sbjct: 373 G 373 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = -2 Query: 999 GGXXRGGXRG---XXXGXGGGXGGGXXXXXXGGG--XXGXXXXXXXXGXGXGGXG 850 GG GG G G GG GGG GGG G G G GG G Sbjct: 340 GGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGG 394 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 981 GXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 G G G GGG GGG GGG G G G GG G Sbjct: 122 GGGGGYSGGGGGYGGGGGGYGGGGGGYG--------GGGDGGGG 157 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG G G G GGG GGG GG G Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 124 GGGYSGGGGGYGGGGGGYGGGGGGYGGG 151 >At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 182 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +2 Query: 800 SXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLX 979 S P P P P P P P P P P P P P P+ Sbjct: 33 SPKPRPLPNPKVPSPKVPTPSVPSPYVPT----PSVPSPSVPTPSVPSPSVPSPNPTPVI 88 Query: 980 PPR 988 PPR Sbjct: 89 PPR 91 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPP 955 PY +P P P P P P PPP P PPP Sbjct: 11 PYGQYPYPYPYPAPYRPPSSEPYPPPPTNQYSAPYYPYPPPPYATPPPYASPPP 64 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 29.9 bits (64), Expect = 2.8 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P P P P P PP PP PP P PL PR P Sbjct: 862 PLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPP--PPFSPLLSPRLPP 911 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXP-XXXPLXPPRXXPP 1000 P PPP P PPP P PL PP P Sbjct: 869 PPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSP 903 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXP-PPXPPPXPXXXPLXPP 985 P P PP P P P PPP P PPP PP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGPP 107 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPR 988 PPP PPP P P P PP+ Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPPPK 86 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PP P PPP P P PP PP Sbjct: 159 PPSPDFPPFSPSIPPPSPPYFPPEPPSIPPP 189 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 29.5 bits (63), Expect = 3.7 Identities = 21/71 (29%), Positives = 23/71 (32%) Frame = +2 Query: 788 LKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXX 967 L+ YS +P P P PP P P P P PP PPP Sbjct: 56 LQRYSPYGNPPPPSPQYSP----PPPPSQSSPPRSRCP--PVPTTGCCNQPPGPPPSTMY 109 Query: 968 XPLXPPRXXPP 1000 P P PP Sbjct: 110 SPPYPYFYTPP 120 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 29.5 bits (63), Expect = 3.7 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P PP P P P P PP PP P + PP PP Sbjct: 126 PEFPVPPSPSPPMPDTPNPP--TPKTPPDVVPPIWEPPRP--PDIFPPESPPP 174 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 2/53 (3%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPX--PXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 P P P PP P P P PP PPP P P P Sbjct: 132 PSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPPLGP 184 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/61 (27%), Positives = 18/61 (29%), Gaps = 1/61 (1%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPX-PXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXP 997 P P P PP P P P PP PP PP + PP Sbjct: 124 PGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPPPGIDPPPPLG 183 Query: 998 P 1000 P Sbjct: 184 P 184 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P P PP PP PP P P PP P Sbjct: 24 PTRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSP 76 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +3 Query: 891 PXXPXXPPXXXPXXXPPXXPPXXXXXS-PSXXXAXPPPPP 1007 P P P P PP PP PS PP PP Sbjct: 32 PSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPP 71 >At4g29240.1 68417.m04182 leucine-rich repeat family protein / extensin family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana] Length = 415 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 974 GGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GGG G GGG GG Sbjct: 34 GGVGVGIGGGGGGGGGGVWVGGGYNNGG 61 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 PY P P P P P PPP PPP P P Sbjct: 185 PYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPP--PPPHGMQGPPPPRPGMPPAPGG 242 Query: 974 LXPPRXXPP 1000 PPR P Sbjct: 243 FAPPRPGMP 251 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXP 973 PY P P P P P PPP PPP P P Sbjct: 185 PYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPP--PPPHGMQGPPPPRPGMPPAPGG 242 Query: 974 LXPPRXXPP 1000 PPR P Sbjct: 243 FAPPRPGMP 251 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 29.5 bits (63), Expect = 3.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 981 GXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 G G G GGG GGG GGG G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGGHG 39 >At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi domain-containing protein similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}, SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1013 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 GG GG +G G GGG G GGG G Sbjct: 22 GGGGGGGEQGRDRGYGGGEQGRGRGSERGGGNRG 55 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 54 PYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPP 113 Query: 959 PXXXPLXPP 985 P PP Sbjct: 114 PYVYSSPPP 122 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 94 PYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPP 153 Query: 959 PXXXPLXPP 985 P PP Sbjct: 154 PYVYSSPPP 162 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 124 PYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 183 Query: 959 PXXXPLXPP 985 P PP Sbjct: 184 PYVYKSPPP 192 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 144 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 203 Query: 959 PXXXPLXPP 985 P PP Sbjct: 204 PYVYKSPPP 212 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 164 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 223 Query: 959 PXXXPLXPP 985 P PP Sbjct: 224 PYVYKSPPP 232 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 184 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 243 Query: 959 PXXXPLXPP 985 P PP Sbjct: 244 PYVYKSPPP 252 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 204 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 263 Query: 959 PXXXPLXPP 985 P PP Sbjct: 264 PYVYKSPPP 272 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 224 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 283 Query: 959 PXXXPLXPP 985 P PP Sbjct: 284 PYVYKSPPP 292 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 244 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 303 Query: 959 PXXXPLXPP 985 P PP Sbjct: 304 PYVYKSPPP 312 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 264 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 323 Query: 959 PXXXPLXPP 985 P PP Sbjct: 324 PYVYKSPPP 332 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 284 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPP 343 Query: 959 PXXXPLXPP 985 P PP Sbjct: 344 PYVYKSPPP 352 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 304 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPS 363 Query: 959 PXXXPLXPP 985 P PP Sbjct: 364 PYVYKSPPP 372 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 334 PYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 393 Query: 959 PXXXPLXPP 985 P PP Sbjct: 394 PYVYSSPPP 402 Score = 29.5 bits (63), Expect = 3.7 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 364 PYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPP 423 Query: 959 PXXXPLXPP 985 P PP Sbjct: 424 PYVYKSPPP 432 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 74 PYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPP 133 Query: 959 PXXXPLXPP 985 P PP Sbjct: 134 PYVYNSPPP 142 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/69 (27%), Positives = 19/69 (27%), Gaps = 5/69 (7%) Frame = +2 Query: 794 PYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPP-----XPPPX 958 PY P P P P P PPP PPP PPP Sbjct: 114 PYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 173 Query: 959 PXXXPLXPP 985 P PP Sbjct: 174 PYVYSSPPP 182 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 29.5 bits (63), Expect = 3.7 Identities = 25/94 (26%), Positives = 27/94 (28%) Frame = +2 Query: 704 YESTLSSYTIKLLXXPQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXX 883 Y S T K P + P + P P P P P PP P Sbjct: 697 YYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSP--PPPPYYSPSPK 754 Query: 884 XXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPP 985 P PPP PPP P P PP Sbjct: 755 VEYKSP--PPPYVYSSPPPPYYSPSPKVEYKSPP 786 >At5g46780.2 68418.m05763 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 25.8 bits (54), Expect(2) = 4.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXP 961 P P PPP PPP P Sbjct: 92 PAPLTQLNHPPPPPPPPP 109 Score = 21.8 bits (44), Expect(2) = 4.7 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 Query: 935 PPPXPPPXPXXXPL 976 PPP PPP P+ Sbjct: 103 PPPPPPPPVQSVPI 116 >At5g46780.1 68418.m05762 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 25.8 bits (54), Expect(2) = 4.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXP 961 P P PPP PPP P Sbjct: 92 PAPLTQLNHPPPPPPPPP 109 Score = 21.8 bits (44), Expect(2) = 4.7 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 Query: 935 PPPXPPPXPXXXPL 976 PPP PPP P+ Sbjct: 103 PPPPPPPPVQSVPI 116 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 972 GXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXG 859 G G GGG GGG GG G G G G Sbjct: 91 GIVVGGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYG 128 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G GG G G G G G G G G G GG G G Sbjct: 150 GEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGG 201 Score = 25.4 bits (53), Expect(2) = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGG 934 GG GG G G GGG G G Sbjct: 90 GGIVVGGGGGGGGGGGGGGGSG 111 Score = 22.2 bits (45), Expect(2) = 4.7 Identities = 11/34 (32%), Positives = 11/34 (32%) Frame = -2 Query: 942 GGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 GGG GGG G G G G G Sbjct: 145 GGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTG 178 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 29.1 bits (62), Expect = 4.9 Identities = 20/83 (24%), Positives = 24/83 (28%), Gaps = 4/83 (4%) Frame = +2 Query: 749 PQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXX----PPP 916 P ++ ++ P S P P PP P P PPP Sbjct: 8 PSLLMLVLAFYVVVVPTSAQCKYSPQSPPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPP 67 Query: 917 XXXXXXPPPXPPPXPXXXPLXPP 985 PP PPP P PP Sbjct: 68 PPYVYNSPPPPPPYIYNSPPRPP 90 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGG 934 GG GG G G GGG GGG Sbjct: 212 GGGGLGGGNGSGGGGGGGGGGG 233 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXP 961 PPP PPP PPP P Sbjct: 25 PPPPYYYLDPPPPPPPFP 42 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 G GG G G GG GGG GGG G Sbjct: 15 GGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRFG 47 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 998 GGXXXXXXGGXXXXXGGXXGGGXXGXXXGGGXXXGG 891 GG GG GG GGG GGG GG Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGG 42 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 987 RGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 RGG G G GG GGG GGG G G G G Sbjct: 6 RGG--GGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRFG 47 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 29.1 bits (62), Expect = 4.9 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 G GG G G G G GGG GGG G G G G G Sbjct: 15 GGGSGGGGGSGDGSGSGDGGG---SGDGGGSRDSDGSGDSSGGGSGDSGGFG 63 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPR 988 P P PP P PPP P PP P P PP+ Sbjct: 11 PPAPPPPSPPSPPSSNDQQTTSPPPSDNQETTSPPPPSSPDIAP--PPQ 57 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 29.1 bits (62), Expect = 4.9 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGG-GXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXGXXXXXXGXG 814 GG G G GGG GG G G G G G G G G G G Sbjct: 123 GGGVGGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLG 180 Score = 28.7 bits (61), Expect = 6.5 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -2 Query: 999 GGXXRGGXRGXXXGX--GGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGG 856 GG GG G G GG GG GGG G G G GG Sbjct: 146 GGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGG 195 >At5g49160.1 68418.m06085 DNA (cytosine-5-)-methyltransferase (ATHIM) identical to SP|P34881 DNA (cytosine-5)-methyltransferase AthI (EC 2.1.1.37) {Arabidopsis thaliana} Length = 1534 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 357 PLSITGRRSPWCSSCRFRSDASR 289 PLS GR S +C+SC+ R D + Sbjct: 869 PLSDIGRSSGFCTSCKIREDEEK 891 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPPXPXXXP 973 P PPP PPP PPP P P Sbjct: 88 PQPPPPPPIENLPPP-PPPLPKFSP 111 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 935 PPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP P L P PP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPP 119 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 900 PXXPPXXXPXXXPPXXPPXXXXXS--PSXXXAXPPPPP 1007 P PP P PP PP S + PPPPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 3/58 (5%) Frame = +2 Query: 785 LLKPYSXXXHPXPXXXXXXPXXPXPPXPXP---XXXXXXXXPXXPPPXXXXXXPPPXP 949 LL Y P P P PP P P P PP PPP P Sbjct: 29 LLTSYKYSPPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 797 YSXXXHPXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP 952 YS P P P PP P PPP PP PP Sbjct: 35 YSPPPPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/75 (25%), Positives = 21/75 (28%), Gaps = 4/75 (5%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPX----PPXPXPXXXXXXXXPXXPPPXXXXXXPP 940 P ++ P P P P P PP P PPP PP Sbjct: 80 PYVYISPPPPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 139 Query: 941 PXPPPXPXXXPLXPP 985 P P P PP Sbjct: 140 PYYSPSPKVDYKSPP 154 >At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-containing protein similar to P58 protein, Bos primigenius taurus, PIR:A56534; similar to p58 (GI:1353270) {Homo sapiens}; contains Pfam PF00226: DnaJ domain; contains Pfam PF00515: TPR Domain Length = 482 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -2 Query: 975 RGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXGXXG 841 RG GG GGG GGG G G GG G G Sbjct: 434 RGEDLEDMGGGGGGGYNPFHGGGGGGQQYTFHFEGGFPGGGGGFG 478 >At4g32285.1 68417.m04593 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related Aux22d, Vigna radiata, PID:D1021691; contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to clathrin assembly protein AP180 (GI:6492344) [Xenopus laevis] Length = 635 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 842 PXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P PP P PPP PPP P P P Sbjct: 371 PPAPAPPVEEPVDMNEIKA--LPPPENHTPPPPPAPEPKP 408 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -2 Query: 999 GGXXR--GGXRGXXXGXGGGXGGGXXXXXXGGG 907 GG R GG G G GGG GGG GG Sbjct: 68 GGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 28.7 bits (61), Expect = 6.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -2 Query: 999 GGXXR--GGXRGXXXGXGGGXGGGXXXXXXGGG 907 GG R GG G G GGG GGG GG Sbjct: 68 GGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 935 PPPXPPPXPXXXPLXP 982 PPP PPP P PL P Sbjct: 73 PPPPPPPRPPPPPLSP 88 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 28.7 bits (61), Expect = 6.5 Identities = 20/76 (26%), Positives = 21/76 (27%), Gaps = 5/76 (6%) Frame = +2 Query: 773 PLXFLLKPYSXXXHPXPXXXXXXPXXPX-----PPXPXPXXXXXXXXPXXPPPXXXXXXP 937 P + P S P P P P PP P PPP P Sbjct: 606 PKVYYKSPPSPYHAPSPKVLYKSPPHPHVCVCPPPPPCYSPSPKVVYKSSPPPYVYSSPP 665 Query: 938 PPXPPPXPXXXPLXPP 985 PP P P PP Sbjct: 666 PPYHSPSPKVHYKSPP 681 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 28.7 bits (61), Expect = 6.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PPP P P PP PP Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSPPADLPP 85 Score = 28.3 bits (60), Expect = 8.6 Identities = 21/76 (27%), Positives = 22/76 (28%), Gaps = 1/76 (1%) Frame = +2 Query: 776 LXFLLKPYSXXXHPXPXXXXXXPXX-PXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPP 952 L + Y P P P P PP P PPP P PP Sbjct: 29 LLYTYNNYQPQHSPLPSPVYSSPADLPPPPTP---VYSPPPADLPPPPTPYYSPPADLPP 85 Query: 953 PXPXXXPLXPPRXXPP 1000 P P P P PP Sbjct: 86 PTPIYPP--PVAFPPP 99 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 899 PXXPPPXXXXXXPPPXPPP 955 P PPP PPP PPP Sbjct: 267 PPPPPPGSWQPSPPPPPPP 285 >At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P PP P PP P P P P P+ PP PP Sbjct: 127 PVPPVTVPKLPVPPVTVPKLPLPPISGLPIPPVVGPNLPLP---PLPIVGPILPPGTTPP 183 >At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +2 Query: 821 PXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 P P P PP P PP P P P P P+ PP PP Sbjct: 127 PVPPVTVPKLPVPPVTVPKLPLPPISGLPIPPVVGPNLPLP---PLPIVGPILPPGTTPP 183 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 28.7 bits (61), Expect = 6.5 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +2 Query: 815 PXPXXXXXXPXXPXPPXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXPXXXPLXPPRXX 994 P P P PP P P PP PPP P P + P Sbjct: 222 PLPPPPGRAALPPPPPLPMAVRKGVAAPPL--PPPGTAALPPPPPLPMAAGKGVAAPPPP 279 Query: 995 PP 1000 PP Sbjct: 280 PP 281 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGG 934 G RGG RG G G G GGG Sbjct: 53 GSGRGGGRGDGRGDGRGIGGG 73 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 998 GGXXXXXXGGXXXXXGGXXGGGXXGXXXGGG 906 GG GG GG GGG G GGG Sbjct: 72 GGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 102 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 860 PXPXPXXXXXXXXPXXPPPXXXXXXPPPXPPPXP 961 P P P P P PPP PPP P Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPP 42 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGG 937 GG RGG RG G GG GG Sbjct: 76 GGGGRGGDRGGGGGGRGGRGG 96 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 895 PXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 P PPP P P PP PP PP Sbjct: 58 PMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPP 92 >At4g15150.1 68417.m02326 glycine-rich protein Length = 102 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 984 GGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 GG RG GGG GGG GG G G G G G Sbjct: 40 GGGRGLKKPGGGGGGGG--ATSGGGSNSGVGGRGRLTGTGFGVTG 82 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 999 GGXXRGGXRGXXXGXGGGXGGG 934 GG GG G G GGG GGG Sbjct: 125 GGYSYGGGGGGYGGGGGGYGGG 146 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 28.3 bits (60), Expect = 8.6 Identities = 20/83 (24%), Positives = 24/83 (28%), Gaps = 4/83 (4%) Frame = +2 Query: 749 PQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPX----PPXPXPXXXXXXXXPXXPPP 916 P+ + PL ++ P P P P PP P PPP Sbjct: 40 PKIEYKTPPLPYIDSSPPPTYSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPP 99 Query: 917 XXXXXXPPPXPPPXPXXXPLXPP 985 PPP P P PP Sbjct: 100 YVYSSPPPPTYSPSPKVEYKSPP 122 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 28.3 bits (60), Expect = 8.6 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 13/55 (23%) Frame = +2 Query: 857 PPXPXPXXXXXXXXPXXPPPXXXXXXP-------------PPXPPPXPXXXPLXP 982 PP P P P PPP P PP PPP P P P Sbjct: 9 PPPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPPLPPARPFGP 63 >At2g17870.1 68415.m02070 cold-shock DNA-binding family protein contains Pfam domains, PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 301 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 987 RGGXRGXXXGXGGGXGGGXXXXXXGGGXXGXXXXXXXXGXGXGGXG 850 RGG G G GGG G G GG G G G G Sbjct: 177 RGGSGGNRYGGGGGRGSGGDGCYMCGGVGHFARDCRQNGGGNVGGG 222 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/65 (24%), Positives = 18/65 (27%) Frame = +3 Query: 813 TPXPXXXXXXXXXXXXPXXXPXXXXXPXXPXXPPXXXPXXXPPXXPPXXXXXSPSXXXAX 992 +P P P P P PP P PP S + Sbjct: 57 SPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSS 116 Query: 993 PPPPP 1007 PPPPP Sbjct: 117 PPPPP 121 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PPP P P P PP PP Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPP 182 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 892 PPXXXPPPXXXPXXPPPXXPPXXXXXPPXXXXXXPP 999 PP PP P P PP PP PP Sbjct: 148 PPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPP 183 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 998 GGXXXXXXGGXXXXXGGXXGGGXXGXXXGGG 906 GG GG GG GGG G GGG Sbjct: 785 GGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP PP PPP P PP PP Sbjct: 193 PPPNQGMGGAPP-PPPHIGNNPNMPPHIQPP 222 >At1g51580.1 68414.m05806 KH domain-containing protein Length = 621 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 908 PPPXXXXXXPPPXPPPXPXXXPLXPPRXXPP 1000 PPP P P PP P P P R P Sbjct: 449 PPPPFMGPYPEPPPPFGPRQYPASPDRYHSP 479 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 935 PPPXPPPXPXXXPLXPPRXXPP 1000 PPP PP P PL P PP Sbjct: 223 PPPPPPSQPLPRPLLLPPPPPP 244 >At1g26110.1 68414.m03186 expressed protein Length = 611 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 996 GXXRGGXRGXXXGXGGGXGGGXXXXXXGGGXXG 898 G RGG G G GG GGG GG G Sbjct: 571 GYSRGGYGGRGYGGYGGRGGGGGGYGYGGRGQG 603 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 28.3 bits (60), Expect = 8.6 Identities = 22/93 (23%), Positives = 28/93 (30%), Gaps = 9/93 (9%) Frame = +2 Query: 749 PQXXARIVPLXFLLKPYSXXXHPXPXXXXXXPXXPXPPXP----XPXXXXXXXXPXXPPP 916 P +++ PL +L P + P P PP P P P PP Sbjct: 58 PPPDSQLPPLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETPPAPPN 117 Query: 917 XXXXXXPPP-----XPPPXPXXXPLXPPRXXPP 1000 PPP PPP + P P Sbjct: 118 ESNDNNPPPSQDLQSPPPSSPSPNVGPTNPESP 150 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,657,096 Number of Sequences: 28952 Number of extensions: 441728 Number of successful extensions: 12209 Number of sequences better than 10.0: 175 Number of HSP's better than 10.0 without gapping: 1629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5840 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2489714688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -