BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D18 (985 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 36 0.037 03_01_0515 - 3864796-3865425 36 0.065 02_05_0686 - 30900748-30902167,30903442-30904742 33 0.46 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 31 1.1 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 31 1.4 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 31 1.4 11_01_0066 - 536281-537196,537397-537452 31 1.9 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 1.9 06_01_0486 - 3455030-3455770 30 2.5 01_01_0070 - 542603-542686,542803-543441 30 2.5 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 30 3.3 03_02_0738 - 10824121-10825572 30 3.3 02_02_0663 - 12740733-12741104,12741260-12741326,12741709-127418... 30 3.3 01_05_0439 - 22159425-22159520,22160137-22160345,22161028-221610... 30 3.3 12_02_1174 - 26696869-26698191 29 4.3 08_01_0059 - 394001-394708 29 4.3 04_03_0904 + 20717005-20718087 29 4.3 11_06_0610 - 25449085-25453284 29 5.7 09_02_0543 + 10427321-10428315,10428440-10429154 29 5.7 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 29 5.7 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 29 5.7 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 29 5.7 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 29 7.5 08_01_0998 - 10136050-10138356 29 7.5 06_03_1237 + 28602250-28604196 29 7.5 03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828,997... 29 7.5 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 29 7.5 01_01_0570 - 4231100-4232560 29 7.5 07_03_1751 - 29215074-29216270 28 9.9 07_01_0862 - 7172083-7172931 28 9.9 07_01_0080 + 587674-588510 28 9.9 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 28 9.9 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 28 9.9 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 797 KXXPPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPP 910 K PP P P PPP PP P P KK PP Sbjct: 350 KLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 809 PXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P P P PPP PP P P KK PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 >03_01_0515 - 3864796-3865425 Length = 209 Score = 35.5 bits (78), Expect = 0.065 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P K PPP Sbjct: 83 PPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPP 118 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P K PPP Sbjct: 89 PPPPPPPAASPPP----PPPSPPPPSPVKSSPPPPP 120 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP PS PPP PP P + PPP Sbjct: 74 PPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPP 109 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 797 KXXPPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 K PP P PPP P P P KK PPP Sbjct: 342 KGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPP 380 Score = 31.9 bits (69), Expect = 0.81 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 791 KXKXXPPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 K PP P PPP PP P P KK PPP Sbjct: 342 KGPPPPPPAKGPPPPPPPKGPSPPPPPPPGG---KKGGPPP 379 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P K PPP Sbjct: 326 PPPPPPPKAAPPP---PPPKGPPPPPPAKGPPPPPP 358 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +1 Query: 778 PXXXKKXXXXPXXXXPXKXXPPPXXXXPXXPPXHXXLKKKXXXPPPXXXXXXXXPXPXXX 957 P K P P K PPP P PP K PPP P P Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPP--PKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGK 373 Query: 958 XXXAXXPP 981 PP Sbjct: 374 KGGPPPPP 381 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 797 KXXPPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 K PP P PPP PP P P K PPP Sbjct: 333 KAAPPPPPPKGPPPPPPAKGPPPPPPP----KGPSPPPP 367 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P + PPP PP P P + PPP Sbjct: 121 PPPPPHPPEDPPPHPPHPPDHPPPPP--PCRVPPPP 154 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P + PPP Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPP 299 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P PS PPP PP P P K PPP Sbjct: 342 PVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPP 377 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P PPP Sbjct: 206 PPRPLPPASPPPPSIATPPPSPASPPPPSTATPPPP 241 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP + P PPP PP P P PPP Sbjct: 553 PPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPP 588 >06_01_0486 - 3455030-3455770 Length = 246 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 809 PXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P P+ P PP PP P PT PPP Sbjct: 117 PPPTPPYVPPPTPPSPPPYVPPPTPPSPPPYVPPP 151 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P P P P P PP P PT PPP Sbjct: 84 PRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPP 119 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 809 PXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P P P K PPP PP P P PPP Sbjct: 82 PPPPTPKKAPPPPVTPPPVTPPPVT--PPPVSPPP 114 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXP 877 PP P P PPP PP P P Sbjct: 428 PPLPPPPPPPPPPPPPLPPNMPPP 451 >03_02_0738 - 10824121-10825572 Length = 483 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXP 871 PP PS P PPP PP P Sbjct: 78 PPPPSPPSSSPPPLSFPPPPPP 99 >02_02_0663 - 12740733-12741104,12741260-12741326,12741709-12741809, 12741852-12742273,12743678-12743685,12745164-12745396 Length = 400 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 809 PXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P P P PPP PP P P + + PPP Sbjct: 38 PPPKRPRWEPPPYLPPPPPYPIPQPA-RPRAAPPP 71 >01_05_0439 - 22159425-22159520,22160137-22160345,22161028-22161066, 22161196-22161356,22161447-22161518,22162002-22162183, 22162580-22162703,22164196-22164299,22165526-22165725, 22165838-22166069,22166156-22166239,22166329-22166386, 22166724-22166771,22167924-22168081,22168451-22168501, 22168585-22168658,22168760-22168835,22169685-22169729, 22169833-22169899,22169978-22170095,22170580-22170775, 22171551-22171640,22171985-22172039,22172755-22172975, 22173362-22173454,22173608-22173721,22173918-22173981, 22174081-22174181,22174306-22174447,22174528-22174729, 22174883-22174976,22176172-22176348 Length = 1248 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +3 Query: 297 IEEAKPNGALDEVF-KKYCDKSAQLKGCISSVLQGVRPCVGNDYANHINDAQNSTNQLID 473 I+ A P+G + F KK + Q +S ++Q + DY N+A+ +TN L+D Sbjct: 421 IDNASPSGFNTQAFLKKRSRATNQPVESMSMIMQFIETQGFLDYLERCNNAEENTNNLLD 480 >12_02_1174 - 26696869-26698191 Length = 440 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 797 KXXPPXPSXPXKXPPPXXXXPPXXPXPT-XX*KKKXXPPP 913 K PP P PPP PP P T + K PPP Sbjct: 209 KPQPPPTLPPPSPPPPPPTVPPRTPGDTPAVVEPKPQPPP 248 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +2 Query: 791 KXKXXPPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 K + P P P PPP PP P + K PPP Sbjct: 145 KPQPPPSLPPPPPPPPPPPPPRPPSVKPPVV--QPKPQPPP 183 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 797 KXXPPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 K PP P PPP PP P + K PPP Sbjct: 178 KPQPPPSLQPPSPPPPPPTRPPSVKPPVV--QPKPQPPP 214 >08_01_0059 - 394001-394708 Length = 235 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPT 880 PP PS P + PPP P P P+ Sbjct: 25 PPPPSPPIRPPPPPTPRPYAPPPPS 49 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXP 877 PP PS P PPP P P P Sbjct: 45 PPPPSHPLAPPPPHISPPAPVPPP 68 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 809 PXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P P P PP P P PT + K PPP Sbjct: 206 PTPYTPTPTPPSYKPQPKPNPPPTYKPQPKPNPPP 240 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KK---KXXPPP 913 PP P+ P P P P P PT K K PPP Sbjct: 118 PPKPTPPTYKPQPKPTPAPYTPTPTPPTYKPQPKPTPPP 156 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ PPP PP P + K PPP Sbjct: 1152 PPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPP 1187 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ PPP PP P K PPP Sbjct: 1168 PPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPP 1203 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ PPP PP P + K PPP Sbjct: 1184 PPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPP 1219 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ PPP PP P K PPP Sbjct: 1200 PPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPP 1235 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ PPP PP P K PPP Sbjct: 1232 PPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPP 1267 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 Query: 809 PXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P P+ P PPP P PT + PPP Sbjct: 26 PPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPPP 60 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P ++ PP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPP 141 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PP PP P + + PPP Sbjct: 107 PPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPP 142 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXP--PXXPXPTXX*KKKXXPPP 913 PP P PPP P P P P K PPP Sbjct: 592 PPAPKAAPPPPPPKSTGPGPPRPPPPAMPGSSKTRPPP 629 >07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089, 4287286-4287350,4288346-4288451,4288529-4288750, 4289619-4289852,4289948-4290037,4290605-4291507 Length = 650 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ P P PP P P+ + PPP Sbjct: 61 PPTPAVEPTLPIPPASTPPTPPQPSASTEPSTAPPP 96 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 815 PSXPXKXPPPXXXXPPXXPXPT 880 PS P PPP PP P PT Sbjct: 80 PSPPPPPPPPPPPPPPLSPTPT 101 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXP 871 PP P P PPP PP P Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPP 94 >08_01_0998 - 10136050-10138356 Length = 768 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +2 Query: 137 GVLADDFSQITAVVTSQCTKNNAEDKVPXS*SSIAYLWKLPQGTGRF 277 GV+ + +TA+ T N E +VP S SS+ L+ L RF Sbjct: 298 GVIPPEIFNLTALRTIDVGTNRLEGEVPASISSLRNLYGLDLSNNRF 344 >06_03_1237 + 28602250-28604196 Length = 648 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -1 Query: 244 VRNAASTXRDFVFSIVLGALRGHNRCNLTKVISQH 140 VR+ + T V+ +LGA R H + + KV+++H Sbjct: 435 VRSMSVTPHGGVWGALLGACRIHGKSEIAKVVAEH 469 >03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828, 9971146-9971935,9972002-9972051,9972618-9972704 Length = 571 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +2 Query: 797 KXXPPXPSXPXKXPPPXXXXPP--XXPXPTXX*KKKXXPPP 913 K PP P P K PP P P P K PPP Sbjct: 77 KVSPPPPQKPDKVSPPPAQKPSKVSPPPPPPQKSAKVSPPP 117 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPT 880 P P P PPP PP P PT Sbjct: 87 PSSPPPPSPPPPPPSSPPPVPPSPT 111 >01_01_0570 - 4231100-4232560 Length = 486 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -2 Query: 912 GGGXXFFF*XXVGXGXXGGXXXXGGGXFXGXXGXGG 805 GGG +G G GG GGG G G GG Sbjct: 257 GGGAGGGMGGDIGGGAGGGVGGGGGGGMGGGGGFGG 292 >07_03_1751 - 29215074-29216270 Length = 398 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 912 GGGXXFFF*XXVGXGXXGGXXXXGGGXFXGXXGXGGXXXF 793 GGG F G G GG GG F G G G F Sbjct: 318 GGGKGGGFGGGFGGGKGGGVGGGAGGGFGGGGGAGAGGGF 357 >07_01_0862 - 7172083-7172931 Length = 282 Score = 28.3 bits (60), Expect = 9.9 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 791 KXKXXPPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 K K PP PS P + P P P P KKK PPP Sbjct: 179 KKKPLPP-PSPPPQPPLPEKENTPLPPLLLPP-KKKPLPPP 217 >07_01_0080 + 587674-588510 Length = 278 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXP 877 PP PS PPP PP P P Sbjct: 96 PPPPSSGSPPPPPPPPPPPPPPPP 119 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P K PPP P P P K++ PPP Sbjct: 58 PPPPPQPAKEPPP--PTKPKHPKP----KQQQHPPP 87 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +2 Query: 797 KXXPPXPSXPXKXPPP----XXXXPPXXPXPTXX*KKKXXPPP 913 K PP P P PPP PP P P + PPP Sbjct: 962 KRPPPPPPPPNVAPPPFTRQDIPPPPPSPPPLPITQPPSVPPP 1004 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,038,569 Number of Sequences: 37544 Number of extensions: 467316 Number of successful extensions: 2637 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2227 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2870111300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -