BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D18 (985 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 34 0.20 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_16619| Best HMM Match : Dynamitin (HMM E-Value=1.1) 30 2.5 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 30 3.3 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_46239| Best HMM Match : Phage_integrase (HMM E-Value=0.24) 30 3.3 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 29 4.4 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 7.6 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 29 7.6 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 809 PXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P P P PPP PP P P+ + PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP PS P PPP PP P PPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P P P PP P P + PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P + PPP PP P P PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P P + PP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP P P P PPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PP PP P P PPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P P P PP P P PPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P P P PPP PP P P PPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P PPP PP P P PPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 P P P PPP PP P P PPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPT 880 PP PS P PPP PP P T Sbjct: 1165 PPPPSSPSPPPPPPPPPPPPTPTTT 1189 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPT 880 PP P P P P PP P PT Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPPT 1185 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXP 877 PP P+ P PPP PP P P Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPP 248 >SB_16619| Best HMM Match : Dynamitin (HMM E-Value=1.1) Length = 667 Score = 30.3 bits (65), Expect = 2.5 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = -1 Query: 346 YFLKTSSSAPFGLASSISVFRTFKSTSPL-RQFPKVRNAASTXRDFVFSIVLGALRGHNR 170 YF++T +S P L SSI PL +F + + + + ++V L HN Sbjct: 197 YFVRTQASGPVPLPSSI---HEADDMLPLCFEFGSLNSQTLLMLEHLLTLVYMPLLSHNA 253 Query: 169 CNLTKVISQHTGSENR 122 + T+ IS+ G+ NR Sbjct: 254 SHRTEGISEGRGTTNR 269 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ P PPP PP P P PPP Sbjct: 149 PPPPNPPY--PPPLYPPPPNPPPPNAPYPPPPYPPP 182 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PPP PP P PPP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ PPP PP P PT PPP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNG--PPPPPPP 400 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ PPP PP P PT PPP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNG--PPPPPPP 390 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ PPP PP P PT PPP Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNG--PPPPPPP 410 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ PPP P P PT K PPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPT---NKPPPPPP 379 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPT 880 PP P+ PPP PP P PT Sbjct: 387 PPPPTNGPPPPPPPTNGPPPPPPPT 411 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXP 877 PP P P PPP PP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXP 877 PP P P PPP PP P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFP 489 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXP 877 PP P P PPP PP P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXP 877 PP P P PPP PP P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXP 877 PP P P PPP PP P P Sbjct: 473 PPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P PPP PP P P PPP Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP 989 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXP 877 PP S P + PPP PP P P Sbjct: 936 PPGGSAPSQPPPPGGNAPPPPPPP 959 >SB_46239| Best HMM Match : Phage_integrase (HMM E-Value=0.24) Length = 364 Score = 29.9 bits (64), Expect = 3.3 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 459 WYCFGHH*CGSHSRCLHKDAR 397 W+C+G+ G SRC+H+ R Sbjct: 302 WFCWGYFSYGESSRCIHRGVR 322 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P P PP PP P K PPP Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXPPP 913 PP P+ P PPP P P P + PP Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 806 PPXPSXPXKXPPPXXXXPPXXPXPTXX*KKKXXP 907 PP P P PPP PP P T ++ P Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 791 KXKXXPPXPSXPXKXP-PPXXXXPPXXPXPT 880 K + PP P P P PP PP P PT Sbjct: 171 KPETKPPKPPAPSTIPTPPTPPAPPSPPIPT 201 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 912 GGGXXFFF*XXVGXGXXGGXXXXGGGXFXGXXGXGGXXXF 793 GGG F G G GG GGG G G GG F Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGF 127 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,934,887 Number of Sequences: 59808 Number of extensions: 466627 Number of successful extensions: 1952 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1594 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2919714245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -