BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D17 (995 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0515 - 3864796-3865425 35 0.12 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 33 0.35 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 33 0.47 02_05_0686 - 30900748-30902167,30903442-30904742 33 0.47 12_02_1174 - 26696869-26698191 31 1.1 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 31 1.1 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 31 1.1 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 31 1.1 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 31 1.1 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 1.4 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 31 1.4 09_02_0543 + 10427321-10428315,10428440-10429154 31 1.9 06_01_0486 - 3455030-3455770 31 1.9 03_02_0342 - 7645323-7645909,7646323-7646491 31 1.9 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 31 1.9 01_01_0070 - 542603-542686,542803-543441 31 1.9 12_02_0299 - 17051570-17052474,17053542-17053755 30 2.5 08_01_0059 - 394001-394708 30 3.3 07_03_1751 - 29215074-29216270 30 3.3 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 4.4 11_06_0610 - 25449085-25453284 29 5.8 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 29 5.8 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 29 7.6 04_04_1125 + 31085106-31085714 29 7.6 01_06_0146 + 26969011-26969995,26970878-26970930 29 7.6 >03_01_0515 - 3864796-3865425 Length = 209 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPP 972 PP PP PP PP PP P PPP Sbjct: 84 PPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPP 118 Score = 29.1 bits (62), Expect = 5.8 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +1 Query: 781 PSPLPPXXHVXXXPXXXXXXXXXXXXXXXPPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQ 960 P PL P V P P P PP PP PP P Sbjct: 48 PPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSP--PPPPLPPPPPPPAASPPPPPPS 105 Query: 961 XPPP 972 PPP Sbjct: 106 PPPP 109 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQ-PPXXPPXXXXXLPXXQXPPP 972 PP PP PP Q PP PP +P PPP Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPP 299 Score = 28.7 bits (61), Expect = 7.6 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +1 Query: 772 GXXPSPLPPXXHVXXXPXXXXXXXXXXXXXXXPPXXXPPLXXPPXXQPPXXPPXXXXXLP 951 G P PP V P PP PP QPP PP P Sbjct: 260 GSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVG--GTQPPPPPPPLANGPP 317 Query: 952 XXQXPPP 972 PPP Sbjct: 318 RSIPPPP 324 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 32.7 bits (71), Expect = 0.47 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPPXXXP 984 PP PP PP +PP PP P PPP P Sbjct: 65 PPASPPPAPTPPQTRPPSPPPQQQQ--PRPVSPPPVAEP 101 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 32.7 bits (71), Expect = 0.47 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPPXXXP 984 P PP PP PP PP P + PPP P Sbjct: 321 PAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +3 Query: 861 PXXPXXPTXXPXXPXXXTXXXPXPXXXPPSPXXXTPPAXXPP 986 P P P P P P P PP P P+ PP Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPP 367 >12_02_1174 - 26696869-26698191 Length = 440 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +1 Query: 781 PSPLPPXXHVXXXPXXXXXXXXXXXXXXXPPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQ 960 P P PP P PP PP PP P PP P Q Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQ---PKPQ 180 Query: 961 XPPPXXXP 984 PP P Sbjct: 181 PPPSLQPP 188 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPP 972 PP PP PP QP PP LP PPP Sbjct: 193 PPPTRPPSVKPPVVQPKPQPP---PTLPPPSPPPP 224 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/71 (26%), Positives = 19/71 (26%), Gaps = 2/71 (2%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXP--TXXPXXPXXXTXXXPXPXXXPPSP 953 P P PP PP P P P T P P P P P Sbjct: 160 PPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPP 219 Query: 954 XXXTPPAXXPP 986 PP PP Sbjct: 220 SPPPPPPTVPP 230 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXPXPXXXPPSPXX 959 P S PP PP P P P P P P P PP P Sbjct: 116 PPALSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPP------PPPPPPPPPRPPS 169 Query: 960 XTPPAXXP 983 PP P Sbjct: 170 VKPPVVQP 177 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/69 (24%), Positives = 18/69 (26%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXPXPXXXPPSPXX 959 P P PP PP P P+ P P P P P Sbjct: 155 PPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPP 214 Query: 960 XTPPAXXPP 986 PP PP Sbjct: 215 TLPPPSPPP 223 >12_02_0118 - 13869237-13869307,13869375-13869465,13870321-13870440, 13870668-13870795,13871159-13871270,13871719-13871817, 13871918-13871992,13872099-13872320,13873177-13874034 Length = 591 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 868 PPXXXP-PLXXPPXXQPPXXPPXXXXXLPXXQXPPPXXXP 984 PP P P PP QPP PP P Q PPP P Sbjct: 63 PPGARPFPGSPPPPSQPP--PPFARPAAPVQQQPPPFGGP 100 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/67 (26%), Positives = 19/67 (28%) Frame = +1 Query: 772 GXXPSPLPPXXHVXXXPXXXXXXXXXXXXXXXPPXXXPPLXXPPXXQPPXXPPXXXXXLP 951 G P P P + P PP PP PP PP P P Sbjct: 17 GFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGP 76 Query: 952 XXQXPPP 972 Q PP Sbjct: 77 PQQQQPP 83 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/72 (26%), Positives = 20/72 (27%), Gaps = 3/72 (4%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXX---PTXXPXXPXXXTXXXPXPXXXPPS 950 P P PP P P P P P + P P PPS Sbjct: 56 PPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPS 115 Query: 951 PXXXTPPAXXPP 986 P PP PP Sbjct: 116 PPPSAPPPPPPP 127 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPP 972 PP PP PP PP PP Q PP Sbjct: 107 PPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPP 141 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/70 (25%), Positives = 20/70 (28%), Gaps = 1/70 (1%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXX-PXXPXXXTXXXPXPXXXPPSPX 956 P+P PP P P P P P P + P P PP P Sbjct: 1131 PLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPS 1190 Query: 957 XXTPPAXXPP 986 P PP Sbjct: 1191 GPPPQPAPPP 1200 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 871 PXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPP 972 P PPL P P PP LP PPP Sbjct: 1154 PPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPP 1187 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/69 (26%), Positives = 20/69 (28%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXPXPXXXPPSPXX 959 P+P S P PP P P P P P P P PP P Sbjct: 1159 PLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPP--PLPIQPPPIPPPPVPSS 1216 Query: 960 XTPPAXXPP 986 + PP Sbjct: 1217 PSSLGYQPP 1225 Score = 29.5 bits (63), Expect = 4.4 Identities = 20/72 (27%), Positives = 22/72 (30%), Gaps = 3/72 (4%) Frame = +3 Query: 780 PIPXSXXP-PRXXPPXXXXXXXXXXXXXPXXPXX--PTXXPXXPXXXTXXXPXPXXXPPS 950 P+P P P PP P P P+ P P P P PP Sbjct: 1141 PLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPP- 1199 Query: 951 PXXXTPPAXXPP 986 P PP PP Sbjct: 1200 PLPIQPPPIPPP 1211 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 871 PXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPP 972 P PP PP PP PP P PPP Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPP 378 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/69 (24%), Positives = 19/69 (27%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXPXPXXXPPSPXX 959 P P + PP PP P P P P P P PP Sbjct: 537 PSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPN 596 Query: 960 XTPPAXXPP 986 P+ PP Sbjct: 597 CLVPSPPPP 605 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQP-PXXPPXXXXXLPXXQXPPPXXXP 984 PP PP P P P PP LP PPP P Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPP 624 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +1 Query: 781 PSPLPPXXHVXXXPXXXXXXXXXXXXXXXPPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQ 960 P PLP P PP PPL PP PP LP Sbjct: 591 PPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPS-LPNRL 649 Query: 961 XPPP 972 PPP Sbjct: 650 VPPP 653 Score = 29.5 bits (63), Expect = 4.4 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 3/68 (4%) Frame = +3 Query: 792 SXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXPXPXXXPPSP---XXX 962 S PP PP P P P P P P PP P Sbjct: 686 SKGPPPPPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKR 745 Query: 963 TPPAXXPP 986 PPA PP Sbjct: 746 NPPAPPPP 753 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPP 972 PP PP PP PP PP LP PPP Sbjct: 426 PPPPLPPPPPPPPPPPPPLPPNMPPPLP----PPP 456 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +3 Query: 792 SXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXPXPXXXPPSPXXXTPP 971 S PPR P P P P P P P P PP+P PP Sbjct: 12 SPAPPRPTPAPQATPPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAP---PPAPDMTPPP 68 Query: 972 AXXP 983 P Sbjct: 69 GPGP 72 >06_01_0486 - 3455030-3455770 Length = 246 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Frame = +1 Query: 781 PSPLPPXXHVXXXPXXXXXXXXXXXXXXXPPXXXPPLXXPPXXQPPXXP-PXXXXXLPXX 957 P P P +V P PP PP PP PP P P P Sbjct: 84 PRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPP--TPPYVPPPTPPSPPPYVPPPTP 141 Query: 958 QXPPPXXXP 984 PPP P Sbjct: 142 PSPPPYVPP 150 >03_02_0342 - 7645323-7645909,7646323-7646491 Length = 251 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +3 Query: 861 PXXPXXPTXXPXXPXXXTXXXPXPXXXPPSPXXXTPPAXXPP 986 P P P P P P P PP+P PP P Sbjct: 178 PPRPPAPEYKPPTPTLTPIPTPEPSYGPPAPKPPAPPVEDEP 219 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPP 972 PP PP P PP PP P PPP Sbjct: 71 PPPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPP 105 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPPXXXP 984 PP P PP PP PP P P P P Sbjct: 76 PPSFAPENALPPSSPPPPSPPPPPPSSPPPVPPSPTAAP 114 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 1/70 (1%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXPXPXXXPP-SPX 956 P P + P P P P P P P P P PP SP Sbjct: 55 PAPTATPTPPVAPAKAPPVAPAVAPVTPPPPT-PKKAPPPPVTPPPVTPPPVTPPPVSPP 113 Query: 957 XXTPPAXXPP 986 TPP PP Sbjct: 114 PATPPPALPP 123 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPP--XXXXXLPXXQXPPPXXXP 984 PP PP+ PP PP PP LP PPP P Sbjct: 93 PPVTPPPVTPPPVTPPPVSPPPATPPPALP-PSTPPPVAAP 132 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 30.3 bits (65), Expect = 2.5 Identities = 21/73 (28%), Positives = 21/73 (28%), Gaps = 4/73 (5%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXP----XPXXXPP 947 PIP PP P P P P P P P P PP Sbjct: 228 PIPFLTPPPPPFLPFPLPPIPFLTPPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPP 287 Query: 948 SPXXXTPPAXXPP 986 SP PPA P Sbjct: 288 SPPPPPPPAFPFP 300 >08_01_0059 - 394001-394708 Length = 235 Score = 29.9 bits (64), Expect = 3.3 Identities = 20/71 (28%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXX--PXPXXXPPSP 953 P P PP PP P PT P P + P P PP+P Sbjct: 5 PPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAP 64 Query: 954 XXXTPPAXXPP 986 PP PP Sbjct: 65 ---VPPPPSPP 72 Score = 29.5 bits (63), Expect = 4.4 Identities = 18/68 (26%), Positives = 20/68 (29%) Frame = +3 Query: 783 IPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXPXPXXXPPSPXXX 962 +P P R PP P P P P P PP P Sbjct: 1 MPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP-HI 59 Query: 963 TPPAXXPP 986 +PPA PP Sbjct: 60 SPPAPVPP 67 >07_03_1751 - 29215074-29216270 Length = 398 Score = 29.9 bits (64), Expect = 3.3 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 2/71 (2%) Frame = -2 Query: 985 GGXXAGGVFXXGEGGXXXG--XGXXXVXXXGXXGXXVGXXGXXGXXXXXXXXXXXXXGGW 812 GG AGG F G+GG G G G G G G G GG Sbjct: 309 GGAGAGGGFGGGKGGGFGGGFGGGKGGGVGGGAGGGFGGGGGAGAGGGFGGGKGGGFGGG 368 Query: 811 XRGGXXEXGMG 779 GG G G Sbjct: 369 VGGGHGAGGGG 379 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPP 969 PP PP PP PP PP + PP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXP 966 PP PP PP +PP PP P P Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 883 PPLXXPPXXQPPXXPPXXXXXLPXXQXPPP 972 P L PP PP PP P PPP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPP 378 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPPXXXP 984 PP PP PP PP PP P + PP P Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPP---PIKKGAPPPAPP 390 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 29.1 bits (62), Expect = 5.8 Identities = 19/69 (27%), Positives = 20/69 (28%), Gaps = 6/69 (8%) Frame = +1 Query: 784 SPLPPXXHVXXXPXXXXXXXXXXXXXXXPPXXXPP------LXXPPXXQPPXXPPXXXXX 945 SP PP + P PP PP L PP PP P Sbjct: 1151 SPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPP 1210 Query: 946 LPXXQXPPP 972 P PPP Sbjct: 1211 PPVKSPPPP 1219 >07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089, 4287286-4287350,4288346-4288451,4288529-4288750, 4289619-4289852,4289948-4290037,4290605-4291507 Length = 650 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/69 (24%), Positives = 21/69 (30%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXPXPXXXPPSPXX 959 P+P + PP+ P P P P P P P P P Sbjct: 31 PLPSALMPPKKRRLFTPAPRHAATPPPPPPPPTPAVEPTLPIPPASTPPTP----PQPSA 86 Query: 960 XTPPAXXPP 986 T P+ PP Sbjct: 87 STEPSTAPP 95 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 868 PPXXXPPLXXPPXXQPPXXPPXXXXXLPXXQXPPPXXXP 984 PP PP P PP PP +P P P P Sbjct: 76 PPALPPPPPLPAIVVPPALPPTPAIAVPPALPPIPAIVP 114 >04_04_1125 + 31085106-31085714 Length = 202 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/69 (24%), Positives = 18/69 (26%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXXPXXPXXPTXXPXXPXXXTXXXPXPXXXPPSPXX 959 P PP PP P P T P P T P P +P Sbjct: 35 PTTKPPPPPCQPPPPTPTPATPTTPPTPWTPPPATPTPPTPTPWTPTPATPPPTPATPAT 94 Query: 960 XTPPAXXPP 986 T P P Sbjct: 95 PTTPPTPAP 103 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 28.7 bits (61), Expect = 7.6 Identities = 19/72 (26%), Positives = 22/72 (30%), Gaps = 4/72 (5%) Frame = +3 Query: 780 PIPXSXXPPRXXPPXXXXXXXXXXXXX-PXXPXXPTXXPXXPXXXTXXXPXPXXXP---P 947 P+P S P P P P PT P P P P P P Sbjct: 48 PLPASAAAPTTPSPNHSGDPSRPIPSQAPAPPPPPTADPSPPLPHDNRTPQPRAAPPPAP 107 Query: 948 SPXXXTPPAXXP 983 +P PP+ P Sbjct: 108 APDQPAPPSPPP 119 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,674,196 Number of Sequences: 37544 Number of extensions: 275288 Number of successful extensions: 2144 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1524 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2916970260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -