BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D09 (882 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084154-10|AAK29873.1| 1140|Caenorhabditis elegans Hypothetical... 34 0.12 AL132948-25|CAC51048.1| 438|Caenorhabditis elegans Hypothetical... 29 5.8 >AC084154-10|AAK29873.1| 1140|Caenorhabditis elegans Hypothetical protein Y22D7AR.2 protein. Length = 1140 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +3 Query: 192 FKVSPTPSRYSRLCHLGQGKWGEGRSSGLWERATKDFLVK 311 F S T R+ R+ HL Q WG +S GLW+ A L++ Sbjct: 98 FWYSDTKDRFERITHLNQ--WGNTKSFGLWDSALDSKLIE 135 >AL132948-25|CAC51048.1| 438|Caenorhabditis elegans Hypothetical protein Y39B6A.33 protein. Length = 438 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 346 RSSLKNXPVVTTFTKKSLVALSQSPEDLPSPHXPCPK 236 R++ N PVV TKK AL + +++ H PK Sbjct: 59 RTATANKPVVPKLTKKQQAALEKITKNITQEHVTLPK 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,627,823 Number of Sequences: 27780 Number of extensions: 323756 Number of successful extensions: 657 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2223883816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -