BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D06 (945 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1685.16 |vma9||V-type ATPase subunit e|Schizosaccharomyces p... 34 0.025 SPBP4H10.19c |||calreticulin/calnexin homolog|Schizosaccharomyce... 29 1.3 SPBC4B4.08 |ght2||hexose transporter Ght2 |Schizosaccharomyces p... 26 6.7 >SPBC1685.16 |vma9||V-type ATPase subunit e|Schizosaccharomyces pombe|chr 2|||Manual Length = 33 Score = 34.3 bits (75), Expect = 0.025 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 247 LILTAATCWLFWLCAYMAQMNPLIGP 324 LILT + C+L W Y+AQ++PL P Sbjct: 3 LILTFSCCYLLWAITYLAQLHPLEAP 28 >SPBP4H10.19c |||calreticulin/calnexin homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 381 Score = 28.7 bits (61), Expect = 1.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 128 SKWATPLSRSSFSPSFGVWLVLFAPSSHLKDQ 223 S+W P+++ GVW ++ AP SHL+D+ Sbjct: 47 SRWRAPVNKD-----LGVWDLVEAPGSHLRDE 73 >SPBC4B4.08 |ght2||hexose transporter Ght2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 531 Score = 26.2 bits (55), Expect = 6.7 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +1 Query: 166 SILWGVVGIICPIFAPKGPNRGIIQV 243 ++LWG++ +I +F P+ P R +IQV Sbjct: 189 NLLWGIITMIGILFLPESP-RYLIQV 213 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,340,707 Number of Sequences: 5004 Number of extensions: 69454 Number of successful extensions: 123 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 481321826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -