BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D06 (945 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) 29 5.5 SB_24756| Best HMM Match : 7tm_1 (HMM E-Value=2e-08) 29 7.2 >SB_3903| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17) Length = 609 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = -1 Query: 339 FIAESG-PDERVHLCHVSTQPKQPTCRCC*Y*HHLNNPS---VWSFRCEDGANNTNHTPK 172 F+ ++G P + V + V + +QP+C+ C Y H +P+ + C+ + T H K Sbjct: 98 FVPQTGVPSKTVSVQPVQVKKEQPSCKFCGYRHSFAHPTRCPAFKRNCKI-CSKTGHFAK 156 Query: 171 DGENEDRDKGVAH 133 +N+ + H Sbjct: 157 MCKNKQKKDPEVH 169 >SB_24756| Best HMM Match : 7tm_1 (HMM E-Value=2e-08) Length = 690 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -2 Query: 734 NRKQGLIKEQLRMPDL*I*EKRKLLLQSKFDMTVP 630 +RKQ I Q +M DL E +KLL + K+D VP Sbjct: 75 HRKQQQIIRQKQMIDLCRTEGQKLLFEGKYDRAVP 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,002,970 Number of Sequences: 59808 Number of extensions: 497280 Number of successful extensions: 899 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 899 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2764790632 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -