BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D03 (885 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 24 7.1 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 9.4 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.8 bits (49), Expect = 7.1 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 532 FWDSCTVFCTAACSFSRRXVAFFSTFRVXLAELLG 428 FWD FC C FS +F FRV L G Sbjct: 407 FWDGGRDFCFLICLFSFPRY-YFIDFRVKPNSLWG 440 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 9.4 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = +3 Query: 465 KNATXLREKLQAAVQNTVQESQKLAKKVSSNVQET 569 +NA R+ Q A +E+ KLA+ + T Sbjct: 1431 RNAEDARKNAQTAQDKYAEEASKLAENIKKRANAT 1465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 578,843 Number of Sequences: 2352 Number of extensions: 8431 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95093730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -