BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D01 (885 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 3.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 7.4 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 7.4 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 23.0 bits (47), Expect = 3.2 Identities = 14/47 (29%), Positives = 18/47 (38%) Frame = +3 Query: 426 EHLYKILXHRRIGYREDFHNQTICPPVLQXNTIEQPSXVDFALKVLN 566 E L K L R E FH C P N + S +D + + N Sbjct: 243 ESLKKSLNFRTPSCLETFHTLEKCRPDPPQNLVINESIIDLSQQTYN 289 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 7.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 362 NNPLTQRQETQK*IRSDNFD 303 NNPL+ Q T + +R+D+ D Sbjct: 758 NNPLSVNQLTGQCVRNDSSD 777 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 7.4 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 362 NNPLTQRQETQK*IRSDNFD 303 NNPL+ Q T + +R+D+ D Sbjct: 650 NNPLSVNQLTGQCVRNDSSD 669 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,138 Number of Sequences: 336 Number of extensions: 3242 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24513621 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -