BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_D01 (885 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_4971| Best HMM Match : Ras (HMM E-Value=0) 45 9e-05 SB_27557| Best HMM Match : Ras (HMM E-Value=0) 42 5e-04 SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 42 7e-04 SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44625| Best HMM Match : Ras (HMM E-Value=0) 42 7e-04 SB_10811| Best HMM Match : Ras (HMM E-Value=0) 41 0.001 SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 40 0.004 SB_7589| Best HMM Match : Ras (HMM E-Value=0) 38 0.011 SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) 36 0.033 SB_50523| Best HMM Match : Ras (HMM E-Value=0) 35 0.076 SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) 35 0.10 SB_13045| Best HMM Match : Ras (HMM E-Value=0) 34 0.13 SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05) 34 0.18 SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_8315| Best HMM Match : Ras (HMM E-Value=0) 33 0.41 SB_36483| Best HMM Match : Ras (HMM E-Value=0) 31 0.94 SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.94 SB_50855| Best HMM Match : Ras (HMM E-Value=0) 31 0.94 SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) 31 1.2 SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_37124| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_53143| Best HMM Match : PKD (HMM E-Value=2.7e-18) 29 3.8 SB_54971| Best HMM Match : Ras (HMM E-Value=0) 29 6.6 SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) 29 6.6 >SB_34767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 62.5 bits (145), Expect = 4e-10 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 VDFALK + W NT IRLQ+W IAG ERF +MTRVYYK Sbjct: 53 VDFALKTIQWAQNTTIRLQIWLIAGQERFSSMTRVYYK 90 >SB_4971| Best HMM Match : Ras (HMM E-Value=0) Length = 209 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = +3 Query: 516 NTIEQPSXVDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 NT VDF ++ L D TI +LQ+WD AG ERF +T YY+ Sbjct: 35 NTYISTIGVDFKIRTLTVDGKTI-KLQIWDTAGQERFRTLTTAYYR 79 >SB_27557| Best HMM Match : Ras (HMM E-Value=0) Length = 184 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 VDF ++VL + I+LQ+WD AG ERF ++T YY+ Sbjct: 48 VDFHVRVLELKGDVRIKLQIWDTAGQERFRSITYSYYR 85 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 Query: 451 IGELGTGKTSIIKRYVHQFF 510 IG+LG GKTS+IKRYVHQFF Sbjct: 677 IGDLGVGKTSLIKRYVHQFF 696 >SB_22342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 VDF ++ + D TI +LQ+WD AG ERF +T YY+ Sbjct: 64 VDFKIRTIELDGKTI-KLQIWDTAGQERFRTITSSYYR 100 >SB_44625| Best HMM Match : Ras (HMM E-Value=0) Length = 128 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 VDF ++ +N D + +LQ+WD AG ERF +T YY+ Sbjct: 12 VDFKIRTINIDGEKV-KLQIWDTAGQERFRTITSTYYR 48 >SB_10811| Best HMM Match : Ras (HMM E-Value=0) Length = 304 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/38 (44%), Positives = 27/38 (71%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 V+F K++N ++ +LQ+WD AG ERF ++TR YY+ Sbjct: 130 VEFGSKIVNVGGKSV-KLQIWDTAGQERFRSVTRSYYR 166 >SB_24842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/37 (45%), Positives = 26/37 (70%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYY 650 VDF +K ++ D + +LQ+WD AG ERF ++T+ YY Sbjct: 42 VDFTIKTVDVDGEKV-KLQIWDTAGQERFRSITQSYY 77 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/38 (44%), Positives = 26/38 (68%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 VDF +K +N + I +QLWD AG ERF ++T+ Y++ Sbjct: 931 VDFQIKTMNVNGQCIA-IQLWDTAGQERFRSITKQYFR 967 >SB_7589| Best HMM Match : Ras (HMM E-Value=0) Length = 640 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 VDF +K L D T LQLWD AG ERF ++ + Y++ Sbjct: 477 VDFQMKTLVVDGKTYA-LQLWDTAGQERFRSIAKSYFR 513 >SB_32061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 VDF +K L + N +L +WD AG ERF +T YY+ Sbjct: 43 VDFKVKTLTVEGNKA-KLAIWDTAGQERFRTLTPSYYR 79 >SB_33745| Best HMM Match : Ras (HMM E-Value=2.5e-21) Length = 115 Score = 36.3 bits (80), Expect = 0.033 Identities = 14/38 (36%), Positives = 26/38 (68%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 +DF +K + + ++ ++LQ+WD AG ER+ +T YY+ Sbjct: 56 IDFKVKTV-FRNDKRVKLQIWDTAGQERYRTITTAYYR 92 >SB_50523| Best HMM Match : Ras (HMM E-Value=0) Length = 154 Score = 35.1 bits (77), Expect = 0.076 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 585 IRLQLWDIAGXERFGNMTRVYYK 653 I+LQ+WD AG ERF +T YY+ Sbjct: 5 IKLQIWDTAGQERFHTITTAYYR 27 >SB_33743| Best HMM Match : Ras (HMM E-Value=2e-34) Length = 241 Score = 34.7 bits (76), Expect = 0.10 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +3 Query: 585 IRLQLWDIAGXERFGNMTRVYYK 653 ++LQ+WD AG ERF +T+ YY+ Sbjct: 95 VKLQIWDTAGQERFRTITQSYYR 117 >SB_13045| Best HMM Match : Ras (HMM E-Value=0) Length = 629 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 V+FA + + + II+ Q+WD AG ER+ +T YY+ Sbjct: 47 VEFATRSIQVEGK-IIKAQVWDTAGQERYRAITSAYYR 83 >SB_12680| Best HMM Match : Ras (HMM E-Value=3.4e-05) Length = 243 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 5/41 (12%) Frame = +3 Query: 540 VDFALKVLNW-----DSNTIIRLQLWDIAGXERFGNMTRVY 647 VDF + + W ++ ++LQ WD+A ERF MT VY Sbjct: 88 VDFYVHFIEWRETDKKKDSTVKLQFWDVAEHERFLKMTAVY 128 >SB_22243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 585 IRLQLWDIAGXERFGNMTRVYYK 653 IRL LWD AG E F +T+ YY+ Sbjct: 34 IRLMLWDTAGQEEFDAITKAYYR 56 >SB_17958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/38 (39%), Positives = 24/38 (63%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 VD +VL+ + + +LQ WD AG E+F +T+ YY+ Sbjct: 46 VDVGTRVLDIHGDRV-KLQCWDTAGQEKFRGITQSYYR 82 >SB_8315| Best HMM Match : Ras (HMM E-Value=0) Length = 565 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 585 IRLQLWDIAGXERFGNMTRVYYK 653 I LQLWD AG ERF ++T +++ Sbjct: 166 IHLQLWDTAGQERFRSLTTAFFR 188 >SB_36483| Best HMM Match : Ras (HMM E-Value=0) Length = 213 Score = 31.5 bits (68), Expect = 0.94 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 VDF + + D + +LQLWD AG E++ ++R +++ Sbjct: 45 VDFFIHDFDLDGKKV-KLQLWDTAGEEKYRALSRSFFR 81 >SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 365 Score = 31.5 bits (68), Expect = 0.94 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 528 QPSX-VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 QP+ +DF K + D + RLQ+WD AG ERF + Y + Sbjct: 193 QPTIGIDFMTKTVLLDDFEV-RLQIWDTAGQERFRCLIHSYIR 234 >SB_50855| Best HMM Match : Ras (HMM E-Value=0) Length = 733 Score = 31.5 bits (68), Expect = 0.94 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = +3 Query: 576 NTIIRLQLWDIAGXERFGNMTRVYYK 653 +T ++ ++WD AG ER+ ++ +YY+ Sbjct: 67 DTTVKFEIWDTAGQERYHSLAPMYYR 92 >SB_58218| Best HMM Match : Ras (HMM E-Value=1.4013e-44) Length = 212 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 585 IRLQLWDIAGXERFGNMTRVYYK 653 + L +WD AG ERF +T+ YY+ Sbjct: 60 VTLSVWDTAGVERFRTVTKNYYR 82 >SB_24843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 31.1 bits (67), Expect = 1.2 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERF-GNMTRVYYK 653 VDF K L + ++LQLWD AG ERF +M YY+ Sbjct: 81 VDFWEKSLELNGE-FVKLQLWDTAGQERFRKSMVCHYYR 118 >SB_37124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +1 Query: 397 HTHRLVLNAGSIYIRSSXIGELGTGKTSIIKRYVHQFF 510 + H V+ + ++ +G+ +GKTS+++RY+H F Sbjct: 15 YVHSAVIMGSKVDVKVVLLGKEYSGKTSLVERYLHHRF 52 >SB_48712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 Query: 540 VDFALKVLNWDSNTIIRLQLWDIAGXERFGNMTRVYYK 653 V+F K + D + LQ+WD AG ERF ++ +Y+ Sbjct: 246 VEFLNKDVKLDGESYT-LQIWDTAGQERFKSLRTPFYR 282 >SB_53143| Best HMM Match : PKD (HMM E-Value=2.7e-18) Length = 2111 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 631 FPKRSCPAISHSCNLIMVFESQFS-TFSAKSTXD 533 FPK S PAIS SC + VF + ++K++ D Sbjct: 980 FPKLSIPAISASCKVARVFPKSYKINIASKNSID 1013 >SB_54971| Best HMM Match : Ras (HMM E-Value=0) Length = 239 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 585 IRLQLWDIAGXERFGNMTRVYY 650 I+ +WD AG E+FG + YY Sbjct: 81 IKFNVWDTAGQEKFGGLRDGYY 102 >SB_39864| Best HMM Match : Ras (HMM E-Value=1.6e-30) Length = 421 Score = 28.7 bits (61), Expect = 6.6 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 588 RLQLWDIAGXERFGNMTRVYYK 653 + +WD AG ERF ++ +YY+ Sbjct: 10 KFNIWDTAGQERFKSLAPLYYR 31 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,363,556 Number of Sequences: 59808 Number of extensions: 396638 Number of successful extensions: 755 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2526446612 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -