BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_C22 (1038 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.07 |ndk1||nucleoside diphosphate kinase|Schizosaccharomy... 125 9e-30 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 49 9e-07 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 49 9e-07 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 49 1e-06 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 44 5e-05 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 42 2e-04 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 41 2e-04 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 40 8e-04 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 37 0.004 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 36 0.007 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 35 0.016 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 33 0.050 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 31 0.20 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 31 0.27 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 30 0.47 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 30 0.47 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 28 0.66 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 29 0.81 SPAC19A8.05c |vps27|sst4|sorting receptor for ubiquitinated memb... 28 2.5 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 28 2.5 SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe... 28 2.5 SPBC11B10.08 |||conserved fungal protein|Schizosaccharomyces pom... 27 4.3 SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pomb... 27 4.3 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 26 7.3 >SPAC806.07 |ndk1||nucleoside diphosphate kinase|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 125 bits (302), Expect = 9e-30 Identities = 56/98 (57%), Positives = 73/98 (74%) Frame = +1 Query: 142 ERTFIMVKPDGVQRGLVGTIIERFEKKGFXLVGLKFVWPSEELLQQHYSDLASRPFFPGL 321 E+TFI VKPD VQRGL+G II +FE KG+ L LKF+ PS +L+++HY++ +PF+ L Sbjct: 4 EQTFIAVKPDAVQRGLIGYIISKFELKGYKLRALKFLVPSRDLVEEHYAEHKGKPFYEKL 63 Query: 322 VKYMSSGPVVPMVWEGLNVVKTGRQMLGATXPTDSXPG 435 V +M+SGPV M+WEG VKTGR MLGA+ P DS PG Sbjct: 64 VGFMASGPVCAMIWEGKQAVKTGRLMLGASNPLDSAPG 101 Score = 37.9 bits (84), Expect = 0.002 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +2 Query: 419 LTRXPAXIRGDLWIQVGRNIIHGSDXVES 505 L P IRGD I +GRN+ HGSD +ES Sbjct: 96 LDSAPGTIRGDYGIDLGRNVCHGSDSIES 124 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 49.2 bits (112), Expect = 9e-07 Identities = 30/71 (42%), Positives = 30/71 (42%) Frame = -1 Query: 1038 GVLGGGGGXXXXXGXXXGXGGEXGGGXGGXXGGGXXXXVXTXXEXGGGXGGXGGGXGXRG 859 G GG GG G G G GGG GG GGG GG GG GG G RG Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGG----------RGGARGGRGGRGGARG 55 Query: 858 XRXGXXGXGGG 826 R G G GG Sbjct: 56 GRGGSSGGRGG 66 Score = 39.9 bits (89), Expect = 6e-04 Identities = 28/67 (41%), Positives = 28/67 (41%) Frame = -3 Query: 1030 GGGGGXXXXXGGXAXXXGXXXGGGGGXGGGGXXXXGXDGXXGRGXXXGXXGGXGXEGXXG 851 GG GG GG G GG GG GGG G G GRG G GG G G G Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRG--GARG--GRGGRGGARGGRG--GSSG 62 Query: 850 GXXGXGG 830 G G G Sbjct: 63 GRGGAKG 69 Score = 39.9 bits (89), Expect = 6e-04 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -1 Query: 1029 GGGGGXXXXXGXXXGXGGEXGGGXGGXXGGGXXXXVXTXXEXGGGXGGXGGGXGXRGXRX 850 G GG G G GG GG GG GG GG GG GG G RG Sbjct: 13 GSRGGRGGFNGGRGGFGGGRGGARGGGRGGAR-----------GGRGGRGGARGGRGGSS 61 Query: 849 GXXGXGGGXXXV 814 G G G V Sbjct: 62 GGRGGAKGGAKV 73 Score = 39.1 bits (87), Expect = 0.001 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = -3 Query: 1030 GGGGGXXXXXGGXAXXXGXXXGGGGGXGG--GGXXXXGXDGXXGRGXXXGXXGGXGXEGX 857 G GG GG G G GGG GG GG G GRG G G G G Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRG--GSSGG 63 Query: 856 XGGXXG 839 GG G Sbjct: 64 RGGAKG 69 Score = 34.7 bits (76), Expect = 0.022 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = -1 Query: 1038 GVLGGGGGXXXXXGXXXGXGGEXGGGXGGXXGGGXXXXVXTXXEXGGGXGGXGGGXGXRG 859 G GG GG G GG GGG GG GG GG GG GG G RG Sbjct: 20 GFNGGRGGF------GGGRGGARGGGRGGARGG--------RGGRGGARGGRGGSSGGRG 65 Query: 858 XRXG 847 G Sbjct: 66 GAKG 69 Score = 27.9 bits (59), Expect = 2.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = -3 Query: 1036 GVGG--GGGXXXXXGGXAXXXGXXXGGGGGXGGGGXXXXG 923 G GG GGG GG G G GG GG G G Sbjct: 31 GRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 27.5 bits (58), Expect = 3.3 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -3 Query: 1036 GVGG-GGGXXXXXGGXAXXXGXXXGGGGGXGGGGXXXXGXDGXXGRGXXXGXXGG 875 G GG GG GG G GG G GG G GRG G GG Sbjct: 17 GRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARG-----GRGGSSGGRGG 66 Score = 27.1 bits (57), Expect = 4.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -3 Query: 1036 GVGGGGGXXXXXGGXAXXXGXXXGGGGGXGGGGXXXXGXDG 914 G G GG GG G G GG GG G G Sbjct: 29 GGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKG 69 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 49.2 bits (112), Expect = 9e-07 Identities = 37/124 (29%), Positives = 42/124 (33%), Gaps = 5/124 (4%) Frame = +3 Query: 681 PXXPXPXPXTAXRASPFXD-RPIGSPPXLXX-IAXXXXXXXXXXXXXXXSXXPPXPXXPP 854 P P P T + P R + +PP I + PP P P Sbjct: 363 PPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPS 422 Query: 855 XXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXP---XXXAXPPLXXXSPPP 1025 PS P P P P PS P PP PP P P A PPL +P P Sbjct: 423 LPPSAP--PSLPPSAP----PSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAP 476 Query: 1026 PPTP 1037 PP P Sbjct: 477 PPAP 480 Score = 43.6 bits (98), Expect = 5e-05 Identities = 24/67 (35%), Positives = 25/67 (37%) Frame = +2 Query: 830 PPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXXPXXX 1009 PP P P L P PP PP PP S + P P P PP P P Sbjct: 415 PPVPTPPSLPP--SAPPSLPPSAPP-SLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPP 471 Query: 1010 XXPPPPP 1030 P PPP Sbjct: 472 AAPAPPP 478 Score = 38.7 bits (86), Expect = 0.001 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 13/82 (15%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPX--------PPPPPXXXPXX 986 PP P S P PP P P S P PPP PP PP P Sbjct: 339 PPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGR 398 Query: 987 XAX--PPLXXXS---PPPPPTP 1037 A PPL S PP PTP Sbjct: 399 SAPALPPLGNASRTSTPPVPTP 420 Score = 36.7 bits (81), Expect = 0.005 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +3 Query: 861 PSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPPP 1031 P P PP P PPPP PPP PP +PPPPP Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPP--PPPRSNAAGSIPLPPQGRSAPPPPP 365 Score = 36.7 bits (81), Expect = 0.005 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +2 Query: 812 PTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 P P P P P P PP P PP + PP P PPP P P Sbjct: 428 PPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPP--AAPAPPPAPAPAP 484 Score = 36.3 bits (80), Expect = 0.007 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 5/72 (6%) Frame = +2 Query: 830 PPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPX-----SPPXPXX 994 PP P P PP PPP S PP PPP PP Sbjct: 271 PPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNG 330 Query: 995 XPXXXXXPPPPP 1030 PPPPP Sbjct: 331 SSNSSLPPPPPP 342 Score = 35.5 bits (78), Expect = 0.012 Identities = 21/72 (29%), Positives = 23/72 (31%) Frame = +3 Query: 822 SXXPPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPP 1001 S P P PP + PP P P + PP PPP A Sbjct: 249 SAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALA--- 305 Query: 1002 LXXXSPPPPPTP 1037 PPPPP P Sbjct: 306 ANKKRPPPPPPP 317 Score = 34.3 bits (75), Expect = 0.029 Identities = 33/118 (27%), Positives = 38/118 (32%), Gaps = 1/118 (0%) Frame = +3 Query: 648 LSGDXMTPXSYPXXPXPXPXTAXRASPFXDRPIGSPPXLXXIAXXXXXXXXXXXXXXXSX 827 +S P + P P AS P+ +PP L A S Sbjct: 385 VSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPP---------SA 435 Query: 828 XPPXPXXPPXXPSXPXPPXXPXXXPLPXX-PSXPXXXXPPPPXPPPPPXXXPXXXAXP 998 P P P P P PP P PLP P+ P P PP P PP A P Sbjct: 436 PPSLPMGAPAAP--PLPPSAPIAPPLPAGMPAAP----PLPPAAPAPPPAPAPAPAAP 487 Score = 33.9 bits (74), Expect = 0.038 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 870 PXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPPPTP 1037 P PP P P P PPPPP P S PPPP P Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPP 366 Score = 33.9 bits (74), Expect = 0.038 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = +3 Query: 861 PSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPPP 1031 P P PP +P P PPPP P P + P PPP Sbjct: 337 PPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPP 393 Score = 33.5 bits (73), Expect = 0.050 Identities = 22/61 (36%), Positives = 23/61 (37%), Gaps = 10/61 (16%) Frame = +2 Query: 827 PPPXPXXPXLXPLXPXPPPX---PPXPPPXSXXVXTXXXXPPP-------XXPPXPPPXS 976 PPP P P PP PP PPP S + PPP PP PPP Sbjct: 338 PPPPPPRSNAAGSIPLPPQGRSAPPPPPPRS--APSTGRQPPPLSSSRAVSNPPAPPPAI 395 Query: 977 P 979 P Sbjct: 396 P 396 Score = 32.7 bits (71), Expect = 0.087 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 5/61 (8%) Frame = +3 Query: 864 SXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXS-----PPPP 1028 S P PP P P P P PPPPP P PP S PP P Sbjct: 335 SLPPPPPPPRSNAAGSIPLPPQGRSAP---PPPPPRSAPSTGRQPPPLSSSRAVSNPPAP 391 Query: 1029 P 1031 P Sbjct: 392 P 392 Score = 32.7 bits (71), Expect = 0.087 Identities = 25/82 (30%), Positives = 27/82 (32%), Gaps = 13/82 (15%) Frame = +2 Query: 827 PPPXPXXPXLXPLXPX----PPPXPPX--------PPPXSXX-VXTXXXXPPPXXPPXPP 967 PPP PL P PPP PP PPP S + PPP P Sbjct: 341 PPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSA 400 Query: 968 PXSPPXPXXXPXXXXXPPPPPN 1033 P PP P PP+ Sbjct: 401 PALPPLGNASRTSTPPVPTPPS 422 Score = 32.3 bits (70), Expect = 0.12 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 1/58 (1%) Frame = +2 Query: 809 PPTXFXPPPXPXX-PXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSP 979 PP+ PP P P PL P P PP P P P P P P +P Sbjct: 432 PPSA--PPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 31.1 bits (67), Expect = 0.27 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +3 Query: 840 PXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSP 1019 P PP PS P P P P P PP P + S Sbjct: 230 PPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSK 289 Query: 1020 PPPPTP 1037 PP P P Sbjct: 290 PPLPPP 295 Score = 30.3 bits (65), Expect = 0.47 Identities = 20/73 (27%), Positives = 21/73 (28%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 P + PP P P P P P PPP PP PP P P Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLSAPAPPPIPPP-SNGTVSSPPNSPPRPIAPVSMNP 282 Query: 989 XXXPXXXXXPPPP 1027 PPP Sbjct: 283 AINSTSKPPLPPP 295 Score = 28.3 bits (60), Expect = 1.9 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 934 SXPPXXPPXPPPXLXPX-PXXXPXSXXXPPPPPQHP 1038 S PP PP PP P P P + PP P P Sbjct: 422 SLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAP 457 Score = 28.3 bits (60), Expect = 1.9 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 943 PXXPPXPP--PXLXPXPXXXPXSXXXPPPPPQHP 1038 P PP PP P P P P + PP P P Sbjct: 444 PAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPP 477 Score = 27.5 bits (58), Expect = 3.3 Identities = 17/68 (25%), Positives = 19/68 (27%) Frame = +3 Query: 834 PXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXX 1013 P P P PS P P P P P PP + PP+ Sbjct: 361 PPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTP 420 Query: 1014 SPPPPPTP 1037 PP P Sbjct: 421 PSLPPSAP 428 Score = 26.2 bits (55), Expect = 7.6 Identities = 25/115 (21%), Positives = 30/115 (26%), Gaps = 5/115 (4%) Frame = +1 Query: 709 PPAXHXPSXTGPSDPXPXXXTSLPSPQTPXXXXPTNLXXXXXXXXXSXPXXXXXXXXXXX 888 PP + + P P P ++P P N + P Sbjct: 377 PPLSSSRAVSNPPAPPP----AIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLP 432 Query: 889 XXAXPXLXXRXNXXXSXPPXXPPXPP-----PXLXPXPXXXPXSXXXPPPPPQHP 1038 A P L PP P PP P P P P P P P P Sbjct: 433 PSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 48.8 bits (111), Expect = 1e-06 Identities = 34/82 (41%), Positives = 34/82 (41%), Gaps = 5/82 (6%) Frame = -1 Query: 1038 GVLGGGGGXXXXXGXXXGXGGEXG-----GGXGGXXGGGXXXXVXTXXEXGGGXGGXGGG 874 G GG GG G G GG G GG GG GGG GGG GG GGG Sbjct: 192 GFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGF-GGGPGGFEGGPGGFGGGPGGFGGG 250 Query: 873 XGXRGXRXGXXGXGGGXXXVGG 808 G G G G GGG GG Sbjct: 251 LG--GFGGGPGGFGGGPGGHGG 270 Score = 44.0 bits (99), Expect = 4e-05 Identities = 28/70 (40%), Positives = 28/70 (40%) Frame = -1 Query: 1038 GVLGGGGGXXXXXGXXXGXGGEXGGGXGGXXGGGXXXXVXTXXEXGGGXGGXGGGXGXRG 859 G GG GG G G GG GG GG G G GGG GG GGG G G Sbjct: 208 GGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPG-----GFGGGLGGFGGGPGGFG 262 Query: 858 XRXGXXGXGG 829 G G G Sbjct: 263 GGPGGHGGPG 272 Score = 36.7 bits (81), Expect = 0.005 Identities = 30/88 (34%), Positives = 30/88 (34%), Gaps = 11/88 (12%) Frame = -1 Query: 1038 GVLGGGGGXXXXXGXXXGXGGEXGGGXGGXXGG-----------GXXXXVXTXXEXGGGX 892 G L GG G G GGG GG GG G GG Sbjct: 164 GGLALGGLASHALGNLFHHRGHNGGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGH 223 Query: 891 GGXGGGXGXRGXRXGXXGXGGGXXXVGG 808 GG GGG G G G G GGG GG Sbjct: 224 GGFGGGPG--GFEGGPGGFGGGPGGFGG 249 Score = 34.7 bits (76), Expect = 0.022 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = -3 Query: 1021 GGXXXXXGGXAXXXGXXXGGGGGXGGGGXXXXGXDGXXGRGXXXGXXG--GXGXEGXXGG 848 G G G GG GG G G G G G G G G G G GG Sbjct: 177 GNLFHHRGHNGGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGG 236 Query: 847 XXGXGG 830 G GG Sbjct: 237 PGGFGG 242 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 43.6 bits (98), Expect = 5e-05 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +2 Query: 890 PXPPPXSXXVXTXXXXPPPXXPPXP----PPXSPPXPXXXPXXXXXPPPPP 1030 P PPP + V T P P PP P PP PP P PPPPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 43.2 bits (97), Expect = 6e-05 Identities = 26/63 (41%), Positives = 28/63 (44%) Frame = +3 Query: 849 PPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPP 1028 PP P+ P P P+P P P PPPP PPPP A PP PPPP Sbjct: 733 PPPPPAVIVPTPAPA--PIPVPPPAPIMGGPPPP--PPPPG---VAGAGPP-----PPPP 780 Query: 1029 PTP 1037 P P Sbjct: 781 PPP 783 Score = 37.9 bits (84), Expect = 0.002 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +3 Query: 831 PPXPXXPPXXPSX-PXPPXXPXXXPLPXXPSXPXXXX--PPPPXPPPPPXXXPXXXAXPP 1001 PP P P+ P PP P P P P PPPP PPPP P Sbjct: 736 PPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAP 795 Query: 1002 LXXXSPPP 1025 P P Sbjct: 796 APQAEPEP 803 Score = 36.7 bits (81), Expect = 0.005 Identities = 22/56 (39%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = +2 Query: 827 PPPXPXXPXLXPLXPXPPPXP-PXPPPXSXXVXTXXXXPPPXXP-PXPPPXSPPXP 988 PPP P P + + P P P P P PPP PPP PPP PP P Sbjct: 732 PPPPP--PAV--IVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 36.7 bits (81), Expect = 0.005 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPP 970 PP P P P + P P PP PPP PPP PP PPP Sbjct: 736 PPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPG----VAGAGPPP--PPPPPP 783 Score = 35.1 bits (77), Expect = 0.016 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +3 Query: 834 PXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPP------PPXPPPPP 968 P P P P P P P P P PP PP PPPPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 34.3 bits (75), Expect = 0.029 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +2 Query: 869 PXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXXPXXXXXPPPPP 1030 P PPP P P + P PP PPP PP PPPPP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPP-PPP--PPPGVAGAGPPPPPPPPP 783 Score = 32.7 bits (71), Expect = 0.087 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +2 Query: 812 PTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXP 964 P PPP P P + PPP PP PPP + P P P P Sbjct: 756 PIMGGPPPPPPPPGVA--GAGPPPPPP-PPPAVSAGGSRYYAPAPQAEPEP 803 Score = 30.7 bits (66), Expect = 0.35 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 903 LPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPPPTP 1037 L P P P P P P P P P+ PPPPP P Sbjct: 729 LKSPPPPPPAVIVPTPAPAPIPVPPP-----APIMGGPPPPPPPP 768 Score = 28.3 bits (60), Expect = 1.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +1 Query: 940 PPXXPPX---PPPXLXPXPXXXPXSXXXPPPPPQHP 1038 PP PP P P P P P PPPP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPP 767 Score = 26.2 bits (55), Expect = 7.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 943 PXXPPXPPPXLXPXPXXXPXSXXXPPPPPQHP 1038 P PP P P P P PPPP P Sbjct: 750 PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 41.5 bits (93), Expect = 2e-04 Identities = 31/123 (25%), Positives = 37/123 (30%), Gaps = 7/123 (5%) Frame = +2 Query: 689 PXPPPXXRXPXIXLX*PAHRIPXLXXXXXXXXXXXXXHXXPPTXFXPPPXPXXPXLXPLX 868 P P P P + + A +P P PP P P Sbjct: 1122 PVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPV 1181 Query: 869 PXP----PPXPPX---PPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXXPXXXXXPPPP 1027 P P PP PP PP V PP PP P P + P P P P Sbjct: 1182 PKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPA 1241 Query: 1028 PNT 1036 P++ Sbjct: 1242 PSS 1244 Score = 40.3 bits (90), Expect = 4e-04 Identities = 25/76 (32%), Positives = 27/76 (35%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 PP+ PPP P L PP P P S V T P PP P S P Sbjct: 966 PPSI--PPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPP 1023 Query: 989 XXXPXXXXXPPPPPNT 1036 P P P P+T Sbjct: 1024 VPLPSADAPPIPVPST 1039 Score = 38.7 bits (86), Expect = 0.001 Identities = 20/68 (29%), Positives = 22/68 (32%) Frame = +3 Query: 834 PXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXX 1013 P P PS PP +P P P PP PP P P Sbjct: 1155 PSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPS 1214 Query: 1014 SPPPPPTP 1037 + PP PTP Sbjct: 1215 TAPPVPTP 1222 Score = 38.3 bits (85), Expect = 0.002 Identities = 31/128 (24%), Positives = 39/128 (30%), Gaps = 6/128 (4%) Frame = +3 Query: 669 PXSYPXXPXPXPXTAXRASPFXDRPIGSPPXLXX-----IAXXXXXXXXXXXXXXXSXXP 833 P + P P P P + +SP + P PP + S P Sbjct: 963 PAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAP 1022 Query: 834 PXPXXPPXXPSXPXPPXXPXXXPLPXX-PSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXX 1010 P P P P P P P+P P P P PPP P + P Sbjct: 1023 PVPLPSADAPPIPVPSTAPPV-PIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSG 1081 Query: 1011 XSPPPPPT 1034 P P P+ Sbjct: 1082 APPVPAPS 1089 Score = 37.9 bits (84), Expect = 0.002 Identities = 22/73 (30%), Positives = 22/73 (30%) Frame = +2 Query: 812 PTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPX 991 P PP P P P P PP P P V P PP P P P Sbjct: 1115 PAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPS---VAAPPVPAPSGAPPVPKPSVAAPPV 1171 Query: 992 XXPXXXXXPPPPP 1030 P P P P Sbjct: 1172 PAPSSGIPPVPKP 1184 Score = 37.1 bits (82), Expect = 0.004 Identities = 24/79 (30%), Positives = 27/79 (34%), Gaps = 7/79 (8%) Frame = +3 Query: 822 SXXPPXPXX-----PPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPP--XPPPPPXXXP 980 S PP P P P PP P P+ P+ P PP P PP P Sbjct: 968 SIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPPVPLP 1027 Query: 981 XXXAXPPLXXXSPPPPPTP 1037 A P + PP P P Sbjct: 1028 SADAPPIPVPSTAPPVPIP 1046 Score = 37.1 bits (82), Expect = 0.004 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 4/76 (5%) Frame = +3 Query: 822 SXXPPXPXXPPXXPSXPXPPXXPXXXPLPXX-PSXPXXXXPPPPXPPP---PPXXXPXXX 989 S PP P P P P P P P P PP P P PP P Sbjct: 1089 SGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVA 1148 Query: 990 AXPPLXXXSPPPPPTP 1037 A P PP P P Sbjct: 1149 APPVPAPSGAPPVPKP 1164 Score = 36.3 bits (80), Expect = 0.007 Identities = 21/75 (28%), Positives = 23/75 (30%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 PP P P P P P PP + P PP P P S P Sbjct: 1121 PPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPP 1180 Query: 989 XXXPXXXXXPPPPPN 1033 P P PPP+ Sbjct: 1181 VPKPAAGVPPVPPPS 1195 Score = 35.5 bits (78), Expect = 0.012 Identities = 28/86 (32%), Positives = 29/86 (33%), Gaps = 14/86 (16%) Frame = +3 Query: 822 SXXPPXPXXPPXXPSXPXP---PXXPXXXPLPXXPSXPXXXXPP--------PPXPPP-- 962 S PP P PS P P P P +P P P PP PP P P Sbjct: 1061 SAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPK-PSVAAPPVPKPSVAVPPVPAPSG 1119 Query: 963 -PPXXXPXXXAXPPLXXXSPPPPPTP 1037 PP P A P PP P P Sbjct: 1120 APPVPKPSVAAPPVPVPSGAPPVPKP 1145 Score = 35.5 bits (78), Expect = 0.012 Identities = 24/76 (31%), Positives = 25/76 (32%), Gaps = 7/76 (9%) Frame = +2 Query: 827 PPPXPXXPXLXPLXPXPPPXPPXP-----PPXSXXVXTXXXXPPPXX--PPXPPPXSPPX 985 PPP P P P P PP P PP P P PP P P P Sbjct: 1063 PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAP- 1121 Query: 986 PXXXPXXXXXPPPPPN 1033 P P P P P+ Sbjct: 1122 PVPKPSVAAPPVPVPS 1137 Score = 34.3 bits (75), Expect = 0.029 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 P PP P P P P PP P P V P PP P P P Sbjct: 1095 PKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPS---VAAPPVPVPSGAPPVPKPSVAAPP 1151 Query: 989 XXXPXXXXXPPPP 1027 P P P Sbjct: 1152 VPAPSGAPPVPKP 1164 Score = 33.9 bits (74), Expect = 0.038 Identities = 21/76 (27%), Positives = 24/76 (31%), Gaps = 4/76 (5%) Frame = +3 Query: 822 SXXPPXPXX----PPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXX 989 S PP P P PS PP +P P+ P P PP P Sbjct: 1080 SGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGA 1139 Query: 990 AXPPLXXXSPPPPPTP 1037 P + PP P P Sbjct: 1140 PPVPKPSVAAPPVPAP 1155 Score = 33.5 bits (73), Expect = 0.050 Identities = 21/75 (28%), Positives = 23/75 (30%), Gaps = 1/75 (1%) Frame = +2 Query: 812 PTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXP-PPXXPPXPPPXSPPXP 988 P PP P P+ P PPP P P PP P P P P Sbjct: 1035 PVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIP-P 1093 Query: 989 XXXPXXXXXPPPPPN 1033 P P P P+ Sbjct: 1094 VPKPSVAAPPVPKPS 1108 Score = 33.5 bits (73), Expect = 0.050 Identities = 19/72 (26%), Positives = 21/72 (29%) Frame = +2 Query: 812 PTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPX 991 P+ P P P + P P P PP V P PP P P P Sbjct: 1074 PSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPV 1133 Query: 992 XXPXXXXXPPPP 1027 P P P Sbjct: 1134 PVPSGAPPVPKP 1145 Score = 33.1 bits (72), Expect = 0.066 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 1/75 (1%) Frame = +2 Query: 812 PTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXP-PPXXPPXPPPXSPPXP 988 P PP P P P P P P P P P PP P P P Sbjct: 1044 PIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPP 1103 Query: 989 XXXPXXXXXPPPPPN 1033 P P P P+ Sbjct: 1104 VPKPSVAVPPVPAPS 1118 Score = 32.7 bits (71), Expect = 0.087 Identities = 35/130 (26%), Positives = 38/130 (29%), Gaps = 7/130 (5%) Frame = +3 Query: 669 PXSYPXXPXPXPXTAXRASPFXDRPIGSPPXLXXIAXXXXXXXXXXXXXXXSXXPPXPXX 848 P P P P + A P P G+PP S PP P Sbjct: 1132 PVPVPSGAPPVPKPSVAAPPVP-APSGAPPV------PKPSVAAPPVPAPSSGIPPVPKP 1184 Query: 849 ----PPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPP--PPXXXPXXXAXP-PLX 1007 PP P PP +P P P PP P P PP P A P P Sbjct: 1185 AAGVPPVPPPSEAPPVPKPSVGVPPVP--PPSTAPPVPTPSAGLPPVPVPTAKAPPVPAP 1242 Query: 1008 XXSPPPPPTP 1037 P TP Sbjct: 1243 SSEAPSVSTP 1252 Score = 31.9 bits (69), Expect = 0.15 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 4/73 (5%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXX-PLPXXPSXPXXXXPPPPXPPP---PPXXXPXXXAXP 998 PP P P P P P P P P PP P PP P Sbjct: 1102 PPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPV 1161 Query: 999 PLXXXSPPPPPTP 1037 P + PP P P Sbjct: 1162 PKPSVAAPPVPAP 1174 Score = 30.7 bits (66), Expect = 0.35 Identities = 19/68 (27%), Positives = 20/68 (29%), Gaps = 3/68 (4%) Frame = +2 Query: 827 PPPXPXXPXLXP---LXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXX 997 PPP P P + P PPP P P P PP P P S Sbjct: 1192 PPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVST 1251 Query: 998 PXXXXXPP 1021 P P Sbjct: 1252 PRSSVPSP 1259 Score = 30.3 bits (65), Expect = 0.47 Identities = 30/121 (24%), Positives = 31/121 (25%), Gaps = 2/121 (1%) Frame = +3 Query: 669 PXSYPXXPXPXPXTAXRASPFXDRPIGSPPXLXXIAXXXXXXXXXXXXXXXSXXPPXPXX 848 P P P P + A P G PP A P Sbjct: 1151 PVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPK---PSVGV 1207 Query: 849 PPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXP--PPPPXXXPXXXAXPPLXXXSPP 1022 PP P PP LP P P PP P P P P P SP Sbjct: 1208 PPVPPPSTAPPVPTPSAGLPPVP-VPTAKAPPVPAPSSEAPSVSTPRSSVPSPHSNASPS 1266 Query: 1023 P 1025 P Sbjct: 1267 P 1267 Score = 29.5 bits (63), Expect = 0.81 Identities = 20/74 (27%), Positives = 20/74 (27%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 PP P P P P P P PP PPP P S P P Sbjct: 1022 PPVPLPSADAPPIPV--PSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAP 1079 Query: 989 XXXPXXXXXPPPPP 1030 P PP Sbjct: 1080 SGAPPVPAPSGIPP 1093 Score = 29.5 bits (63), Expect = 0.81 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 2/69 (2%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXP--PPPPXXXPXXXAXPPL 1004 PP P PS PP P P P+ P PP P P PP P A Sbjct: 1193 PPSEAPPVPKPSVGVPP-VPPPSTAPPVPT-PSAGLPPVPVPTAKAPPVPAPSSEAPSVS 1250 Query: 1005 XXXSPPPPP 1031 S P P Sbjct: 1251 TPRSSVPSP 1259 Score = 26.6 bits (56), Expect = 5.7 Identities = 25/116 (21%), Positives = 31/116 (26%) Frame = +2 Query: 689 PXPPPXXRXPXIXLX*PAHRIPXLXXXXXXXXXXXXXHXXPPTXFXPPPXPXXPXLXPLX 868 P P P P + P+ IP + PP P P P + P Sbjct: 1160 PVPKPSVAAPPVPA--PSSGIPPVPKPAAGVPPVPPPSEAPPV---PKPSVGVPPVPPPS 1214 Query: 869 PXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXXPXXXXXPPPPPNT 1036 PP P V T P P P S P P P ++ Sbjct: 1215 TAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSSVPSPHSNASPSPTSS 1270 Score = 26.6 bits (56), Expect = 5.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 952 PPXPPPXLXPXPXXXPXSXXXPPPPP 1029 PP PPP P P P P PPP Sbjct: 1189 PPVPPPSEAP-PVPKPSVGVPPVPPP 1213 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 41.1 bits (92), Expect = 2e-04 Identities = 20/51 (39%), Positives = 23/51 (45%), Gaps = 5/51 (9%) Frame = +3 Query: 900 PLPXXPSXPXXXXPPP---PXPPPPPXXXPXXXAXPPLXXXSP--PPPPTP 1037 P+ P P PP P PPPPP P + PP+ P PPPP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 38.3 bits (85), Expect = 0.002 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +3 Query: 849 PPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPP 1028 PP P PP P P S P PPP PP P P PPL S P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVP----PPPSAPPMP--AGPPSAPPPPLPASSAPSV 1743 Query: 1029 PTP 1037 P P Sbjct: 1744 PNP 1746 Score = 35.5 bits (78), Expect = 0.012 Identities = 19/58 (32%), Positives = 23/58 (39%) Frame = +2 Query: 854 LXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXXPXXXXXPPPP 1027 + P P P P P + + PPP PPP +PP P P PPPP Sbjct: 1681 MAPAHPVSTP-PVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPP---SAPPPP 1734 Score = 35.5 bits (78), Expect = 0.012 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 834 PXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPP 965 P PP S P PP P P P PS P PP PPPP Sbjct: 1694 PQSAAPPQM-SAPTPPPPPMSVPPP--PSAPPMPAGPPSAPPPP 1734 Score = 32.7 bits (71), Expect = 0.087 Identities = 16/53 (30%), Positives = 20/53 (37%) Frame = +2 Query: 830 PPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 P P + P PPP PPP + + PP PP P +P P Sbjct: 1694 PQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPP--PPLPASSAPSVP 1744 Score = 31.9 bits (69), Expect = 0.15 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 2/68 (2%) Frame = +2 Query: 827 PPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXP--PPXSPPXPXXXP 1000 PP P + PP PP P PPP PP P PP +PP P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVP-----------PPPSAPPMPAGPPSAPPPPLPAS 1738 Query: 1001 XXXXXPPP 1024 P P Sbjct: 1739 SAPSVPNP 1746 Score = 31.1 bits (67), Expect = 0.27 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPP 947 PP P P PS P P P P P P+ P P Sbjct: 1708 PPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 29.5 bits (63), Expect = 0.81 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 840 PXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXP 956 P PP S P PP P P+P P PPPP P Sbjct: 1705 PTPPPPPMSVPPPPSAP---PMPAGP----PSAPPPPLP 1736 Score = 28.7 bits (61), Expect = 1.4 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSP 979 PP P P P P P P PP P PP PPP P P P Sbjct: 1699 PPQMSAPTPPPP-PMSVPPPPSAPPMPAGPP----------SAPPPPLPASSAPSVP 1744 Score = 28.3 bits (60), Expect = 1.9 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Frame = +2 Query: 878 PPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXXPXXXXXP--PPPP 1030 P P PP P PP P PP P P P PPPP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSV-PPPPSAPPMPAGPPSAPPPP 1734 Score = 28.3 bits (60), Expect = 1.9 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +3 Query: 945 PPXPPPPPXXXPXXXAXPPLXXXSPPPPP 1031 P P P P A P + +PPPPP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPP 1711 Score = 28.3 bits (60), Expect = 1.9 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +1 Query: 955 PXPPPXLXPXPXXXPXSXXXPP--PPPQHP 1038 P PPP P P P PP PPP P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 26.6 bits (56), Expect = 5.7 Identities = 17/68 (25%), Positives = 20/68 (29%) Frame = +2 Query: 827 PPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXXPXX 1006 P P P+ PP P P P + + PP P P S P Sbjct: 1470 PAPSSAPAPPAPVSQLPPAVPNVPVPSM--IPSVAQQPPSSVAPATAPSSTLPPSQSSFA 1527 Query: 1007 XXXPPPPP 1030 P PP Sbjct: 1528 HVPSPAPP 1535 Score = 26.6 bits (56), Expect = 5.7 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +3 Query: 915 PSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPPPTP 1037 P+ P P P PP PP+ PPPP P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSV--PPPPSAP 1721 Score = 26.6 bits (56), Expect = 5.7 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +1 Query: 934 SXPPXXPPX--PPPXLXPXPXXXPXSXXXPPPPPQHP 1038 S PP P PP P P P S PP P P Sbjct: 1688 STPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMP 1724 Score = 26.2 bits (55), Expect = 7.6 Identities = 19/75 (25%), Positives = 22/75 (29%) Frame = +2 Query: 812 PTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPX 991 P P P P + P P P P P S PP P P P P Sbjct: 1451 PMHAVAPVQPKAPGMVTNAPAPSSAPAPPAPVSQL--------PPAVPNVPVPSMIPSVA 1502 Query: 992 XXPXXXXXPPPPPNT 1036 P P P++ Sbjct: 1503 QQPPSSVAPATAPSS 1517 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 39.5 bits (88), Expect = 8e-04 Identities = 26/78 (33%), Positives = 29/78 (37%), Gaps = 4/78 (5%) Frame = +2 Query: 809 PPTXFXPPPX-PXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXP---PPXS 976 P + PP P P + P P P PP P S PPP P P PP + Sbjct: 133 PQSELRPPTSAPPRPSIPP--PSPASAPPIP---SKAPPIPSSLPPPAQPAAPVKSPPSA 187 Query: 977 PPXPXXXPXXXXXPPPPP 1030 P P P PPPP Sbjct: 188 PSLPSAVPPMPPKVPPPP 205 Score = 39.1 bits (87), Expect = 0.001 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 875 PPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXXPXXXXXPPPP 1027 PP P P P S P P PP P +PP P P PPP Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPP 174 Score = 38.7 bits (86), Expect = 0.001 Identities = 35/128 (27%), Positives = 41/128 (32%), Gaps = 5/128 (3%) Frame = +3 Query: 666 TPXSYPXXPXPX-----PXTAXRASPFXDRPIGSPPXLXXIAXXXXXXXXXXXXXXXSXX 830 TP S+ P P P ++ +RP S P L + S Sbjct: 66 TPKSFAAPPVPTGAPSLPTSSNNTQQAEERP--SMPALGGLFAGGMPKLRHIGKSSASAA 123 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXX 1010 PP PP S PP P PS P P P PP P P A P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPS-PASAPPIPSKAPPIPSSLP-PPAQPAAPV 181 Query: 1011 XSPPPPPT 1034 SPP P+ Sbjct: 182 KSPPSAPS 189 Score = 37.5 bits (83), Expect = 0.003 Identities = 22/67 (32%), Positives = 24/67 (35%), Gaps = 4/67 (5%) Frame = +3 Query: 840 PXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXP----PPPPXXXPXXXAXPPLX 1007 P P PS P PP P+P PPP P PP A PP+ Sbjct: 140 PTSAPPRPSIP-PPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMP 198 Query: 1008 XXSPPPP 1028 PPPP Sbjct: 199 PKVPPPP 205 Score = 35.1 bits (77), Expect = 0.016 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXX--PPPPXPPPPPXXXPXXXAXPPL 1004 PP P P PS PP P P+ PS P PP P PPP A Sbjct: 158 PPIPSKAPPIPSSLPPPAQPAA-PVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSS 216 Query: 1005 XXXSPPPP 1028 S PP Sbjct: 217 RPSSFAPP 224 Score = 33.1 bits (72), Expect = 0.066 Identities = 17/60 (28%), Positives = 19/60 (31%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 PP+ PP P P PP P P + PP P PPP P Sbjct: 151 PPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAP 210 Score = 31.5 bits (68), Expect = 0.20 Identities = 21/74 (28%), Positives = 24/74 (32%), Gaps = 4/74 (5%) Frame = +2 Query: 827 PPPXPXXPXLXPLXPXPPPXPP--XPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXXP 1000 PP P P P P P PP P + PP P SP P P Sbjct: 184 PPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKFPNRGP 243 Query: 1001 --XXXXXPPPPPNT 1036 PP PP++ Sbjct: 244 SIPSASVPPVPPSS 257 Score = 29.1 bits (62), Expect = 1.1 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +1 Query: 709 PPAXHXPSXTGPSDPXPXXXTSLPSPQTP 795 PPA H P+ T S P S+PS P Sbjct: 223 PPAGHAPNVTSESPKFPNRGPSIPSASVP 251 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 37.1 bits (82), Expect = 0.004 Identities = 22/71 (30%), Positives = 24/71 (33%), Gaps = 2/71 (2%) Frame = +3 Query: 831 PPXPXXP--PXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPL 1004 P P P P PS P PP P +P P P P P P P P + Sbjct: 620 PQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSV 679 Query: 1005 XXXSPPPPPTP 1037 P PP P Sbjct: 680 ----PQPPAVP 686 Score = 36.3 bits (80), Expect = 0.007 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXP--PL 1004 PP P PS P PP P +P P P P P P P P P Sbjct: 592 PPVAPVVPEAPSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQ 651 Query: 1005 XXXSPPPPPTP 1037 P P P Sbjct: 652 RPAVPVVPEAP 662 Score = 35.9 bits (79), Expect = 0.009 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 2/70 (2%) Frame = +3 Query: 834 PXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXP--PLX 1007 P PP P P P P +P P P PP P P A P P Sbjct: 602 PSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEA 661 Query: 1008 XXSPPPPPTP 1037 P PP P Sbjct: 662 PSVPQPPAAP 671 Score = 34.7 bits (76), Expect = 0.022 Identities = 20/69 (28%), Positives = 21/69 (30%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXX 1010 PP P PS P PP P P P P P P P P + Sbjct: 577 PPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSV-- 634 Query: 1011 XSPPPPPTP 1037 P PP P Sbjct: 635 --PQPPAAP 641 Score = 33.5 bits (73), Expect = 0.050 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 1/68 (1%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXP-XXXXPPPPXPPPPPXXXPXXXAXPPLX 1007 PP P PS P P P P P P P P P PP A Sbjct: 637 PPAAPVVPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQPPAVPVVPEAGQLNE 696 Query: 1008 XXSPPPPP 1031 PP PP Sbjct: 697 PVVPPLPP 704 Score = 32.7 bits (71), Expect = 0.087 Identities = 20/74 (27%), Positives = 23/74 (31%), Gaps = 5/74 (6%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPP-----PPXPPPPPXXXPXXXAX 995 PP P PS PP P +P P P P P P P Sbjct: 517 PPAAPVVPEAPSVHQPPAAPVAPEVPSAPQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQ 576 Query: 996 PPLXXXSPPPPPTP 1037 PP+ +P P P Sbjct: 577 PPVAPVAPEVPSVP 590 Score = 31.1 bits (67), Expect = 0.27 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 4/73 (5%) Frame = +3 Query: 831 PPXPXXP--PXXPSXPXPPXXPXXXPLPXXPSXPXXXXPP--PPXPPPPPXXXPXXXAXP 998 P P P P P P P P +P P PP P P P P Sbjct: 539 PEVPSAPQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAPVV 598 Query: 999 PLXXXSPPPPPTP 1037 P P PP P Sbjct: 599 PEAPSVPQPPVAP 611 Score = 30.7 bits (66), Expect = 0.35 Identities = 21/73 (28%), Positives = 22/73 (30%), Gaps = 4/73 (5%) Frame = +3 Query: 831 PPXPXXP--PXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXP-- 998 P P P P S P PP P +P P P P P P P P Sbjct: 560 PQRPAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAPEVPSV 619 Query: 999 PLXXXSPPPPPTP 1037 P P P P Sbjct: 620 PQRPAVPVVPEAP 632 Score = 26.6 bits (56), Expect = 5.7 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 8/68 (11%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXP-PPXSXXVXTXXXXPPPXXPPXPP------ 967 PP P P P P P P P P PP + V P P P P Sbjct: 637 PPAAPVVPEVPSVPQ-RPAVPVVPEAPSVPQPPAAPVVPEVPSVPQPPAVPVVPEAGQLN 695 Query: 968 -PXSPPXP 988 P PP P Sbjct: 696 EPVVPPLP 703 Score = 26.6 bits (56), Expect = 5.7 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +2 Query: 830 PPXPXXPXLXPLXPXPPPXPPXP-PPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 P P P P P P P P PP V P PP PP P Sbjct: 659 PEAPSVPQ-PPAAPVVPEVPSVPQPPAVPVVPEAGQLNEPVVPPLPPHDETQEP 711 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 36.3 bits (80), Expect = 0.007 Identities = 26/83 (31%), Positives = 27/83 (32%), Gaps = 7/83 (8%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPP-------PXXPPXPP 967 PP F PP P PPP PP PPP P P PP Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPP-PPPAVEDQAADANEPDDYYSSGRAVSPEIPP 225 Query: 968 PXSPPXPXXXPXXXXXPPPPPNT 1036 +P P PPPPP T Sbjct: 226 TYTPKQADPLP---APPPPPPPT 245 Score = 28.7 bits (61), Expect = 1.4 Identities = 19/63 (30%), Positives = 21/63 (33%), Gaps = 13/63 (20%) Frame = +2 Query: 830 PPXPXXPXLXPLXPXPPPXPPXPPPXS-------------XXVXTXXXXPPPXXPPXPPP 970 PP PL PPP PP PP S + + PPP P PP Sbjct: 224 PPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATPSQPP 283 Query: 971 XSP 979 P Sbjct: 284 RPP 286 Score = 28.3 bits (60), Expect = 1.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 918 SXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPPP 1031 S P PPP PP P PPPPP Sbjct: 159 SAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPP 196 Score = 26.2 bits (55), Expect = 7.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 870 PXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPP 968 P P P P S P PPP PPPPP Sbjct: 167 PPPSFQPPSAAAPAT-SLPSDYNPPP--PPPPP 196 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 35.1 bits (77), Expect = 0.016 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +1 Query: 934 SXPPXXPPXPPPXLXPXPXXXPXSXXXPPPPP 1029 S PP PP PP P P P S PPPPP Sbjct: 3 SLPPGNPPPPP----PPPGFEPPSQPPPPPPP 30 Score = 30.7 bits (66), Expect = 0.35 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 942 PPPXPPPPPXXXPXXXAXPPLXXXSPPPPPTP 1037 PP PPPPP P PP S PPPP P Sbjct: 5 PPGNPPPPP---PPPGFEPP----SQPPPPPP 29 Score = 30.3 bits (65), Expect = 0.47 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 827 PPPXPXXPXLXPLXPXPPPXPP 892 PPP P P P PPP PP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPPP 30 Score = 29.9 bits (64), Expect = 0.62 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPP 970 PP PP PPP PP PP PPP Sbjct: 5 PPGNPPPPPP------PPGFEPPSQPPPPPPP 30 Score = 27.9 bits (59), Expect = 2.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 906 PXXPSXPXXXXPPPPXPPPPP 968 P P P PP PPPPP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPP 29 Score = 27.9 bits (59), Expect = 2.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 906 PXXPSXPXXXXPPPPXPPPPP 968 P P P P P PPPPP Sbjct: 10 PPPPPPPGFEPPSQPPPPPPP 30 Score = 26.6 bits (56), Expect = 5.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 LXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPP 958 L P P PPP PP P S PPP PP Sbjct: 4 LPPGNPPPPPPPPGFEPPS--------QPPPPPPP 30 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 33.5 bits (73), Expect = 0.050 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 4/71 (5%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXX 1010 PP P P PP P P P P PPPP P PP Sbjct: 208 PPPPMHHKPGEHMPPPPMH--HEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMH 265 Query: 1011 XSP----PPPP 1031 P PPPP Sbjct: 266 HEPGEHMPPPP 276 Score = 33.5 bits (73), Expect = 0.050 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 4/71 (5%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXX 1010 PP P P PP P P P P PPPP P PP Sbjct: 221 PPPPMHHEPGEHMPPPPMH--HEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMH 278 Query: 1011 XSP----PPPP 1031 P PPPP Sbjct: 279 HEPGEHMPPPP 289 Score = 33.5 bits (73), Expect = 0.050 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 4/71 (5%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXX 1010 PP P P PP P P P P PPPP P PP Sbjct: 234 PPPPMHHEPGEHMPPPPMH--HEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMH 291 Query: 1011 XSP----PPPP 1031 P PPPP Sbjct: 292 HEPGEHMPPPP 302 Score = 33.5 bits (73), Expect = 0.050 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 4/71 (5%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXX 1010 PP P P PP P P P P PPPP P PP Sbjct: 247 PPPPMHHEPGEHMPPPPMH--HEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMH 304 Query: 1011 XSP----PPPP 1031 P PPPP Sbjct: 305 HEPGEHMPPPP 315 Score = 33.5 bits (73), Expect = 0.050 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 4/71 (5%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXX 1010 PP P P PP P P P P PPPP P PP Sbjct: 260 PPPPMHHEPGEHMPPPPMH--HEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMH 317 Query: 1011 XSP----PPPP 1031 P PPPP Sbjct: 318 HEPGEHMPPPP 328 Score = 33.5 bits (73), Expect = 0.050 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 4/71 (5%) Frame = +3 Query: 831 PPXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXX 1010 PP P P PP P P P P PPPP P PP Sbjct: 273 PPPPMHHEPGEHMPPPPMH--HEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMH 330 Query: 1011 XSP----PPPP 1031 P PPPP Sbjct: 331 HEPGEHMPPPP 341 Score = 32.3 bits (70), Expect = 0.12 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 4/61 (6%) Frame = +3 Query: 861 PSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSP----PPP 1028 P PP P P P P PPPP P PP P PPP Sbjct: 203 PGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 262 Query: 1029 P 1031 P Sbjct: 263 P 263 Score = 26.2 bits (55), Expect = 7.6 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 4/40 (10%) Frame = +3 Query: 924 PXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSP----PPPP 1031 P P PPPP P PP P PPPP Sbjct: 198 PAHHEPGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPP 237 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 31.5 bits (68), Expect = 0.20 Identities = 19/62 (30%), Positives = 21/62 (33%) Frame = +3 Query: 852 PXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPPP 1031 P P+ PP P P+P P P PP PP P A P P P Sbjct: 492 PLPPTTFAPPGVPLP-PIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAVPAMPG 550 Query: 1032 TP 1037 P Sbjct: 551 IP 552 Score = 28.7 bits (61), Expect = 1.4 Identities = 22/73 (30%), Positives = 23/73 (31%) Frame = +2 Query: 809 PPTXFXPPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 PPT F PP P P P P P PP V PP P P + P Sbjct: 494 PPTTFAPPGVPLPP--IPGAPGMPNLNMSQPP---MVPPGMALPPGMPAPFPGYPAVPAM 548 Query: 989 XXXPXXXXXPPPP 1027 P P P Sbjct: 549 PGIPGATAPPGAP 561 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 31.1 bits (67), Expect = 0.27 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 903 GGGXGGXGGGXGXRGXRXGXXGXGGG 826 GGG G GG G RG G G GGG Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGG 471 Score = 27.1 bits (57), Expect = 4.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 961 GGGXGGGGXXXXGXDGXXGRGXXXGXXGGXGXEGXXGGXXGXG 833 GGG GG G G GRG G G G G G G Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGGR-GRGRGGARSGNPNRG 487 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 30.3 bits (65), Expect = 0.47 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 834 PXPXXPPXXPSXPXPPXXPXXXPLPXXPSXPXXXXPPPPXPPPPP 968 P P PP P+ P P PLP P P P P P PP Sbjct: 102 PLPREPPL-PNEPVPEE-----PLPGEPPLPDEPVPEEPLPGEPP 140 Score = 27.1 bits (57), Expect = 4.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 900 PLPXXPSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPPPTP 1037 PLP P P P P P PP P PP P P Sbjct: 102 PLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEP--LPGEPPLPNEP 145 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 30.3 bits (65), Expect = 0.47 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = -1 Query: 1026 GGGGXXXXXGXXXGXGGEXGGGXGGXXGGGXXXXVXTXXEXGGGXGGXGGG--XGXRG 859 G GG G G G GG G GGG GG GG GG G RG Sbjct: 136 GRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFG-GGSRGGSRGGFRGGSRGGFRG 192 Score = 27.5 bits (58), Expect = 3.3 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 1038 GVLGGGGGXXXXXGXXXGXGGEXGGGXGGXXGGGXXXXVXTXXEXGGGXGGXGGGXGXR 862 G GG GG G GG GG GG GG GG GG GG R Sbjct: 142 GFRGGRGGSRGGFGGN-SRGGFGGGSRGGFGGGS------RGGSRGGFRGGSRGGFRGR 193 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 28.3 bits (60), Expect = 1.9 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 9/49 (18%) Frame = +2 Query: 869 PXPPPXPPXP---------PPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 P PPP PP P P S + P PPP PP P Sbjct: 905 PTPPPPPPLPVKTSLNTFSHPDSVNIVANDTSVAGVMPAFPPPPPPPPP 953 Score = 26.2 bits (55), Expect = 7.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 Query: 939 PPPPXPPPP 965 PPPP PPPP Sbjct: 945 PPPPPPPPP 953 Score = 26.2 bits (55), Expect(2) = 0.66 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 Query: 942 PPPXPPPPP 968 PPP PPPPP Sbjct: 945 PPPPPPPPP 953 Score = 21.8 bits (44), Expect(2) = 0.66 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +3 Query: 918 SXPXXXXPPPPXPPPP 965 S P P P PPPP Sbjct: 897 SLPTIITHPTPPPPPP 912 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 29.5 bits (63), Expect = 0.81 Identities = 18/70 (25%), Positives = 22/70 (31%) Frame = +2 Query: 827 PPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXPXXXPXX 1006 PPP + PL P P + V + P P PP S P Sbjct: 1010 PPPKQPANRVVPLPPTASQRASAYEPPTVSVPSPSALSPSVTPQLPPVSSRLPPVSATRP 1069 Query: 1007 XXXPPPPPNT 1036 PPP +T Sbjct: 1070 QIPQPPPVST 1079 Score = 26.6 bits (56), Expect = 5.7 Identities = 15/54 (27%), Positives = 17/54 (31%) Frame = +2 Query: 827 PPPXPXXPXLXPLXPXPPPXPPXPPPXSXXVXTXXXXPPPXXPPXPPPXSPPXP 988 PPP P PPP P + PP P P P +P P Sbjct: 910 PPPTASMTASAPAIASPPP-PKVGETYHPPTASGTRVPPVQQPSHPNPYTPVAP 962 >SPAC19A8.05c |vps27|sst4|sorting receptor for ubiquitinated membrane proteins, ESCRT 0 complex|Schizosaccharomyces pombe|chr 1|||Manual Length = 610 Score = 27.9 bits (59), Expect = 2.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 675 SYPXXPXPXPXTAXRASPFXDRPIGSPPXLXXIA 776 SYP P T R+SPF RP +P L A Sbjct: 339 SYPSVPAHTVSTDIRSSPFSGRPSDNPSTLISTA 372 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 27.9 bits (59), Expect = 2.5 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +3 Query: 915 PSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPPPTP 1037 P+ P PP P P P P SP PP P Sbjct: 721 PAIKPQVTPAPPTPAPTPAVKHHPPPPPVRSSISPSMPPAP 761 >SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 143 Score = 27.9 bits (59), Expect = 2.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 1026 GGGGXXXXXGXXXGXGGEXGGGXGGXXGGG 937 GGG G G GG GG GG G G Sbjct: 112 GGGHHGPLHGPHGGFGGRGGGRMGGRGGRG 141 >SPBC11B10.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 204 Score = 27.1 bits (57), Expect = 4.3 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +3 Query: 915 PSXPXXXXPPPPXPPPPPXXXPXXXAXPPLXXXSPPPPPTP 1037 P P PP PPP A P S P P P Sbjct: 48 PPPPSVDHSAPPSGPPPSYSNSAAPATPAASASSAAPAPAP 88 >SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pombe|chr 2|||Manual Length = 662 Score = 27.1 bits (57), Expect = 4.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 236 TSXKPFFSKRSIMVPTRPRCTPSGLT 159 T KPF +KRS ++P RP T L+ Sbjct: 509 TIPKPFVNKRSKVLPLRPSVTHDNLS 534 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 26.2 bits (55), Expect = 7.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 Query: 939 PPPPXPPPP 965 PPPP PPPP Sbjct: 306 PPPPPPPPP 314 Score = 26.2 bits (55), Expect = 7.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 Query: 942 PPPXPPPPP 968 PPP PPPPP Sbjct: 306 PPPPPPPPP 314 Score = 23.0 bits (47), Expect(2) = 7.3 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 Query: 881 PXPPXPPPXSXXVXTXXXXPPP 946 P PP PPP S P P Sbjct: 306 PPPPPPPPPSNDFWKDSNEPAP 327 Score = 21.4 bits (43), Expect(2) = 7.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 863 LXPXPPPXPP 892 L P PPP PP Sbjct: 305 LPPPPPPPPP 314 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,337,096 Number of Sequences: 5004 Number of extensions: 66036 Number of successful extensions: 1285 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 152 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 543234592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -